4EEZA

Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
339
structure length
339
Chain Sequence
MKAAVVRHNPDGYADLVEKELRAIKPNEALLDMEYCGVCHTDLHVAAGDFGNKAGTVLGHEGIGIVKEIGADVSSLQVGDRVSVAWFFEGCGHCEYCVSGNETFCREVKNAGYSVDGGMAEEAIVVADYAVKVPDGLDPIEASSITCAGVTTYKAIKVSGVKPGDWQVIFGAGGLGNLAIQYAKNVFGAKVIAVDINQDKLNLAKKIGADVTINSGDVNPVDEIKKITGGLGVQSAIVCAVARIAFEQAVASLKPMGKMVAVAVPNTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQFGAEGKVKPIVATRKLEEINDIIDEMKAGKIEGRMVIDFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase 1
publication title Structure-guided engineering of Lactococcus lactis alcohol dehydrogenase LlAdhA for improved conversion of isobutyraldehyde to isobutanol.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
total genus 107
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4eezA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4eezA01
4RQTA 3M6IA 1UXIA 1E1KA 2RIRA 3BMCB 4EJMA 1N7HA 3KYCB 3DOCA 1M6WA 2C07A 2Y99A 1X1EA 4TVBA 4A26A 1U1IA 2P5UA 2HJSA 1BW9B 3KEOA 5I9NA 1C0KA 1PR9A 2BH9A 5IZCC 1VE9A 1SAYA 1C1XB 1KEVA 5ENVA 2I6TA 4OSOA 4UREA 3WLFA 4Q3NA 3HDJA 4FIZA 4RL6A 5A06A 3D4PA 1WZEA 2ZYGA 1NHGA 5C7IO 2C20A 2V65A 4B7XA 4KWIA 1GY8A 1ZH8A 2SCUA 2CVQA 3AWDA 3GC6A 3I9JA 4E2WA 4RPKA 4YWJA 4ZHSA 3B1FA 1DLJA 5ER6A 4NMHA 4OYRA 4FJ2A 4ZQFA 3D3EA 4N5MA 4BGEA 1I3NA 3UKOA 1E77A 3VHRA 2X9VA 5TX7A 2ILTA 4DL9A 1H9BA 1PL7A 3AY7A 3E18A 1XHLA 2O3UA 4M54A 3H9EO 1NBOA 4PRKA 3GQVA 2Z5LA 3QVTA 1P3DA 1D1SA 5C7LO 1Y81A 3ZWCA 3OJ0A 1YB4A 1WZIA 4A0SA 2FMUA 1YBVA 2FHSA 4IDBA 4J9UE 2A4KA 1ZSNA 4I5EA 3RASA 3JQAA 1BDBA 3H2SA 3IKVA 3RROA 1ADGA 2GZ3A 1HDCA 2OBYA 4L8VA 4AJHA 2Q1SA 4R54A 5JDCC 5BT9A 5LDHA 3GRKA 4MDHA 1GYRA 1V0JA 2EKPA 4C4OA 1WVGA 2P9CA 1P77A 3H3JA 3RUEA 4BKUA 3VPGA 3F1LA 5CDGA 3OQ6A 3VDRA 2Y1EA 3GUCA 4HXYA 1VSUA 3DFUA 3NJ8A 1PQWA 4G2NA 2PD6A 2DBQA 1BXKA 2P68A 1WWKA 3AFMA 2GERA 5FI3A 1PQUA 3RIHA 1ARZA 3EVTA 4E13A 1PJQA 5KJCA 1QYDA 4AJ1A 1UH5A 5U1PA 4J7CA 1H6AA 1EMDA 1LC0A 4UVIA 2C82A 4BO8A 4GLLA 2FSVA 3PXXA 1U5AA 2GLXA 2VOJA 3PP8A 3VKUA 2O3QA 1MA0A 4CMEC 4E21A 3HHPA 1Y5RA 2AW5A 1A7AA 3TOZA 1ZSVA 3CPSA 2PR2A 1U3TA 1KOLA 4H16A 4XJSA 3VPFA 1RYEA 1VRWA 2W2LA 2NADA 1HDGO 3FTPA 4NNJA 4NK4A 5JW6A 3FI9A 1K6XA 3VZSA 3INGA 1YVEI 2O4UX 3QE3A 1EBUA 3JYOA 5AXDA 1WPQA 5KKCA 2EP7A 2JD1A 3ZNNA 1BXGA 1LSOA 3LSYA 1FDSA 1QP8A 2QQ5A 2CDAA 3UN1A 4NJMA 2QZZA 4Z9FA 2I5PO 3WSWA 4TRMA 1NWCA 3LC1O 1GYQA 2C59A 4J4TA 3EUWA 2VHWA 2JFGA 3ZWNA 1IB6A 3KYDA 4GLOA 1GQ2A 3I6QA 4A7PA 3E6AA 2YQ5A 4E31A 5JBIA 1QLHA 5JE8A 4GX5A 1YBAA 4R1TA 1E92A 3GDOA 4ZICA 3ZU5A 3CTMA 2FR1A 4IIVA 3A14A 4IDAA 3G1UA 4F6CA 3RVDA 3SEFA 2G76A 5IDWA 4ZU3A 4XYMA 4RF3A 1V35A 3AUAA 3DZFA 5TJ9A 3AJRA 1P31A 3Q2IA 3WQRA 2CF5A 2Q49A 4HFMA 3FNGA 4J3FA 1SO8A 1LDMA 4J1NA 3WYBA 4HP8A 4E5KA 1D1TA 1XSEA 2VUUA 3B20A 3UGKA 3L6DA 1GCUA 3DTTA 2NLOA 1KVTA 4GL4A 3JQ8A 1DFIA 4BNZA 1IZ9A 4PCVA 3GZNB 2X5JO 1E7MA 1YB5A 2NVBA 1W73A 4XGNA 1DOHA 1PZGA 2G1UA 4PGFA 4XD2A 5HRUA 5I7VA 3LVFO 3ANNA 3WJAA 1OFGA 2DUUA 1ZIDA 3DZBA 4ZRMA 4TVOA 3WTBA 2XXJA 4OJNA 4CQMB 2Q4EA 2ZB7A 3JQBA 5A9SB 2QG4A 4MKXA 4BL5A 4LMRA 2AEJA 3GGPA 3IAHA 1ZVMA 2D0IA 1B8VA 1AE1A 4GMGA 2ZTUA 5JAQA 1GV0A 1E3WB 1NX6A 2OHXA 1O8CA 4YQZA 3IP3A 1EDZA 3V2GA 3GDFA 3TJRA 5BQFA 4JQCA 3RAJA 3JYNA 5CHEA 3IC5A 4PG6A 4EITA 4AJ4A 3GVHA 3O8QA 4FFRA 3HDYA 3JQCA 1VSVA 1NR1A 2D59A 3B1KA 1HEUA 2X5KO 3JD1A 3WLEA 5JCXA 4IJWA 4GPD1 4JP2A 3P5SA 3GMSA 3VPXA 1G6KA 2VZ0A 3L07A 1TT5A 3VH4A 4EYEA 5K0ZA 3H65A 2IYPA 2JHGA 3HADA 3AM4A 3LC2O 1U4OA 5BSFA 4Y8VA 3C1TA 4A10A 1FDVA 1JW9B 1EK5A 3WGTA 3KETA 3PLNA 4RJTA 1GYPA 2ZATA 3UCEA 1Q7GA 5BSHA 1R16A 1H0KA 2J5QA 2VYVA 3DO5A 5F5LA 3D1LA 3GG9A 4D3SA 3SBOA 3TFOA 3AU9A 1MG0A 1YQGA 5U4QA 1ISHA 1WDMA 1EQ2A 3CMCO 4J7UA 4AJPA 3WMXA 1GPDG 2PA3A 3GHYA 4OO3A 4YT4A 3LT4A 4Z0PA 5FEUA 3A06A 3WQQA 3MJCA 5ILOA 1LSSA 4NZ9A 1ID1A 1HTBA 4JX8A 5G0VA 3NT2A 1FJHA 1GDHA 1J6UA 1I2CA 4IXTA 2OO5A 3ONFA 4ZJUA 1ZMTA 4WUVA 3T7EA 1EFLA 1I24A 2NSDA 1SCUA 2WYUA 2DTXA 4UVDA 3GK3A 4M89A 4CM4A 4PG4A 3MTJA 5T57A 2I9PA 4DYDA 2FWMX 4GAEA 1GPJA 1PJLA 3QWAA 4KOAA 4YJHB 4MVJM 5EPOA 5G4KA 4AFNA 4EBFA 1D4FA 3FBTA 2FOIA 2DPGA 3QWHA 4BNVA 4HY3A 4CUKA 1LDGA 2RAFA 3WIDA 4BKQA 2WSBA 3KV3O 1ZK2A 2IRWA 1VJTA 2ZJ1A 3DMTA 2B4RO 4BO3A 2RHRA 4GSLA 1I01A 1H93A 2WD7A 3K31A 2GF2A 3E03A 5LDGA 3S55A 4XRGA 4RZHA 3O03A 4IS2A 3D64A 1IYZA 1Z7EA 3F47A 4XYGA 2HJRA 1YBMA 5F21A 5T6BA 4MOWA 1AGNA 1ZK1A 3BTUA 3ZV4A 2POQX 3RSHA 1SBYA 4UVHA 1OC4A 1DFHA 1GAEO 1HZJA 2LDBA 4L4XA 1C3VA 5G0WA 1H94A 1Q7BA 3RFTA 2Q99A 1D3AA 4B3JA 4CM9A 4LW8A 1PZFA 3PDUA 1LJ8A 1ZKMA 4WLVA 4MVJH 4MP3A 1GZ4A 2A9FA 5ILGA 3TRIA 1NFRA 3F1KA 1UP6A 4FGWA 4IGFA 1OZAA 1TLTA 3HB4X 2VWPA 1S6YA 3Q9NA 4Q39A 4YJGA 4CODB 4H7PA 5A3VA 3WJ7A 3NKLA 4EJ0A 1O94A 4PG7A 1E5QA 4OXYA 3GT0A 3ETEA 1AXEA 2JD2A 4B79A 5JO0A 1UJMA 2ZIZA 3WR5A 4BNKA 4WK6A 3RU7A 2BKAA 3CINA 4J6FA 4JGBA 3BMNB 3DBHA 2OZPA 4N7RA 2JCXA 2NV6A 1JLLA 2WTBA 4LVUA 1QV6A 1ZBQA 1SNYA 2C2YA 3TZ6A 1C1DB 4K6FA 4RVFA 5JSFA 3CZMA 2H1SA 3RUHA 1B26A 1QYXA 4XB2A 3NX4A 1HYEA 4Q9NA 2GASA 4B4VA 1X14A 1ISMA 3AUTA 4J2HA 3T4XA 3ENKA 4YAGA 5TLSA 1M67A 4PZCA 4XGKA 2PNFA 5DULA 1YL7A 5GZ6A 3CXRA 3Q11A 2X86A 1BVRA 1F8GA 4J0FA 3UOGA 2OGUA 2B4TO 3WWYA 1AHIA 3DBLB 4Y67A 4IMRA 4IM7A 1UAYA 4TSKA 3JD4A 4CR7A 3KRTA 3ZU4A 1KERA 5DCWA 4IDFA 3D7LA 4ZQHA 5TT1A 4JP3A 3WNQA 5CFZA 5ENDA 3DBRB 3TF5A 3ZNOA 1RYDA 5EIOA 2EGGA 1ZCJA 3WBFA 3A1NA 5GZ3A 1L7DA 4YR9A 2QHXA 3VDQA 3EMKA 2X22A 5G0UA 3P2YA 2Q4BA 5KVSA 1HSOA 1RM3A 1UZNA 1LSJA 4RVSA 2DC1A 5CDUA 2O7SA 3GPIA 1M6HA 2DBVO 2TMGA 1CEQA 1U2DA 3LC7O 4MINA 3BMOB 1ADBA 3NDRA 1E3EA 1DIAA 4N5NA 4EW6A 4BNFA 4I9UA 1GU7A 4PLVA 1Z45A 1F8FA 3ZWBA 4OXNA 2HK9A 1N1GA 1ZK4A 3ST7A 2X0NA 3HDQA 2WWRA 4MPDA 2I3AA 3RD5A 5L53A 3KO8A 4GKVA 1YQDA 2NU7A 2CFCA 1PGPA 5KVVA 1LRKA 4I9HA 4II2A 2PKQO 3JD2A 3ICCA 1P0CA 2ZYDA 1NQAO 1Y8QA 4BNTA 1LDEA 3HNPA 1TT7A 3QP9A 5DNAA 4PG5A 2E48A 4UVEA 1WNTA 4WOJA 2BELA 4BMVA 2WYVA 4DRYA 4IUYA 2NVUA 3WS7A 4EUFA 3DHNA 1PSDA 3ADOA 4CLDA 1UZLA 1LXCA 2IEBA 3GRPA 3WWZA 4FJ0A 1BMDA 5TQVA 4MVJI 1KS9A 3TPCA 4AJLA 2NQTA 4CV3A 2FZWA 4QECA 4CUZA 4BIIA 4RV9A 1K2WA 3ZU2A 1HE5A 3ZNQA 1MG5A 3QVWA 1YOVB 3IMFA 4MP8A 4Y6PA 3W4KA 2FPPA 4WJZA 2NUAA 1CF2O 1HL3A 2VUSA 3WIEA 1LLQA 3KYCA 3PHIA 1B8UA 4URFA 3AK4A 4N54A 1O89A 3ZH2A 2Q3EA 4D3FA 4IBOA 4IJUA 4O6VA 4IPTA 4XEHA 5KOIA 3LF2A 3PIIA 5JYEA 3Q9UA 5JAIA 4LRTB 2YY7A 1I3MA 1HDZA 3BHJA 4W82A 2NQ8A 5EQFA 1J4AA 4GGPA 4BNUA 1N2SA 1SMKA 3FD8A 2DM6A 3L0DA 4JROA 1I30A 2P4QA 2BRUA 1PS8A 1R4MB 4O59O 4AJEA 1B16A 1HSZA 5EERA 3GGOA 4HBGA 3FF4A 1LNQA 1DRVA 3U62A 4CR6A 4CV0A 3I4CA 3GG2A 1MFZA 2A94A 3TFQA 1Q2XA 2YJZA 5DOZA 4CL8A 1UXGA 1NQOA 1B0AA 2J6IA 4DIBA 1YH3A 4CMBA 3IKTA 3OMLA 4R41A 1QMGA 2JKVA 1B14A 4P38A 3OSUA 4RVGA 5DBFA 3KM0A 4PFJA 2NTJA 4E2ZA 4CQLB 1F14A 1HE2A 4NIMA 4YAKA 2HK7A 3JQGB 3GNQA 3BHIA 3O4RA 3EVNA 1ZNQO 4U8GA 1C0LA 4A73A 3E82A 1ML3A 1QXSA 1MUUA 3P2OA 5KJ6A 2O4CA 1OMOA 3ZDFA 3A4VA 3BYZA 4R3WA 3BTSA 1VL8A 4MVJA 1IPEA 5GY7A 1ZMOA 4WNIA 5KVQA 2CZCA 3RUIA 4Z0HO 4D46A 3C1AA 5CDTA 3PQDA 2J5RA 1Z75A 4DIOA 3GLQA 4PLWA 4ND3A 4LK3A 3I9KA 5L7YA 1DO8A 2X58A 2VQ3A 3EDMA 3F5QA 5COQA 2BI7A 1A7KA 4ALIA 1FXSA 1H2BA 4CMKA 4DA9A 2Q50A 4NBWA 1LUAA 1PTJA 1PWXA 3JV7A 1GEEA 4GKBA 2FP4A 1ULSA 3ROPA 1WP4A 5KJ1A 3RUAA 1PL8A 3ZHXA 5KCZA 1EVYA 2ZYAA 5IG2A 2C5AA 1XR3A 3RJ5A 1DC6A 2P4HX 5THQA 4QFCA 2X4GA 3AI2A 3HSKA 2GN9A 1SEVA 4TKLA 4HADA 3BIOA 4NHEA 3IUSA 3LQFA 4NR0A 4Z3KA 4N18A 3H8VA 3IJRA 4CLXA 2PH3A 3SXPA 1I2ZA 1NVGA 3U49A 3TZKA 3STHA 4DQXA 1A5ZA 1JKJA 1ONPA 3ADPA 4YB8A 2PY6A 1ULUA 4XX0A 3ONEA 4KP7A 1VPDA 5JC8A 2O48X 4H3VA 2X23A 4NBTA 4B7UA 2O3JA 4BNMA 3F4BA 4CLEA 4F6LA 5DP2A 6LDHA 4S1VA 4ZQBA 3U9LA 4ONEA 5T8KC 1ENZA 1PJSA 1R0KA 2CVZA 4C7KA 2YDYA 5DDIP 3RBZA 4NI5A 4YAEA 3NUGA 1W6UA 3JTMA 3D0OA 4NDNE 3QY9A 2YV3A 4FGSA 1DIBA 3CIFA 4WECA 4YPOA 1RWBA 3WNVA 4QT0A 2CD9A 1LQTA 3H7AA 2VT2A 1MB4A 1F12A 1OI7A 1FMCA 1DRUA 3OEYA 2VT3A 3I9LA 4DUPA 4PLCA 3I4FA 2PGJA 5LC1A 4B4WA 1QKIA 3JQFC 4FFOA 1YJQA 1PS9A 4I5FA 2VHVA 3RKRA 1ZEMA 3VVCA 2NACA 1GUZA 5IDXA 3AU8A 3NDJA 3MJ4A 4IMPA 1K6IA 4YA6A 3ZV3A 1KY5A 1MC5A 5TJHA 5JCJA 4CM9D 2G82A 5FI5A 3L6EA 5A9TA 2W8ZA 2EG9A 5F1KA 3PYLA 4CMIB 1AUPA 4QEDA 1O6ZA 3K6JA 1UDBA 2V6MA 3M2TA 2CNBA 4QX6A 4D44A 2UDPA 4OL9A 2J3JA 4BVAA 5I8ZA 2C29D 2Q2QA 3U4DA 4DQUA 4YQYA 3JQDA 1NYTA 4KMSA 5IXYA 2Y68A 4YJFA 3Q1LA 2DVMA 1YS4A 2GZ2A 2H5LA 3PJGA 1P1IA 3QJ5A 4KQXA 3H9UA 3C7DB 3EGOA 1VKOA 4R1UA 2ZB3A 3ONDA 4DGSA 1SZJG 1V3VA 1JWBB 1Y5MA 3K73O 2Z1MA 1GFSA 3KLMX 1DJQA 4NK5A 4Y98A 3H5NA 4XR9A 2YHIB 4BO1A 5B1YA 4LSWA 5A9SA 3QIVA 3PHGA 2ET6A 2AQHA 4IDEA 4BKPA 1QYWA 3QHAA 3R1IA 1E3WA 1RM4A 2WEKA 2R6JA 3G0OA 1P74A 4GX0A 4DLBA 3NGXA 3S2GA 2HMVA 3MJEA 4BMNA 4ZN6A 4DC0A 4EJ6A 4PRLA 2EV9A 4IINA 4L0QA 4DQVA 4GX1A 4CV2A 5JY1A 1FF9A 4ALLA 4MVJP 2JHFA 7MDHA 1LLDA 3HZZA 4RCVA 4ROSA 2YHUA 5BR7A 1GEGA 4J16A 4UEOA 4TRNA 4UEJA 4CM7A 3BXXA 2VUTA 4E4YA 3RFVA 4JCOA 4D41A 3ZWWA 4J1QA 1YDWA 3M1LA 2WD8A 4R9SA 2EKLA 3WX0A 1L1FA 4EUHA 2E49A 1LDYA 2OUIA 3W8DA 2QRJA 3OA0A 5L4LA 5MDHA 3G17A 1CDOA 4A2CA 4FN4A 1MGOA 2RCYA 4WGGA 1M76A 3KSZO 4WKGA 3Q6IA 1XLTA 3VKVA 5IJZA 4EEXA 3WDSA 5B4TA 4AICA 1FDUA 1PJ3A 4KTVE 1XYGA 1GCOA 1HYHA 4E33A 3UCXA 3WGOA 4XB1A 2W2KA 1EUCA 4DLAA 2D1YA 2EGHA 5H82A 1T1RA 3DHEA 5B4UA 4W7IA 3ROQA 1V3TA 5KVCA 3NTRA 1N7GA 3RC9A 1R15A 1EEHA 4TROA 1A72A 2GRAA 1MXFA 4NQZA 4HFNA 1CRWG 3LT2A 3ZN2A 4TZTA 2OORA 1NWHA 4RPGA 2QYTA 2OMEA 2B37A 4CUJA 3E48A 1X7HA 4FDAA 1GADO 1XWFA 4BKRA 1U5CA 2VTDA 1NM5A 1U3UA 5JXWA 4Z0TA 4NU5A 4IZIA 1IPFA 4YJDA 4ESOA 3HN7A 2F00A 3OJFA 1UDCA 3IUPA 3SC6A 2V6FA 3H2ZA 5TRTA 2Y1OA 3WMWA 2DQ4A 3K96A 2HMUA 4FBGA 4PVDA 1NPDA 2B4QA 3NDIA 4XKJA 5A4DA 1HDXA 5I7EA 4XR4A 3P19A 3ENNA 1OAAA 3DZIA 1VL0A 4JK3A 3PVZA 5L7WA 3CZRA 1DIGA 2A35A 1B2LA 4PLYA 3HFGA 2I67A 1XU7A 4TKMA 5JDIA 2Y66A 4RLHA 5CEFA 4U5QA 3QW2A 1G0OA 2IEDA 3UCFA 1UP4A 1E7SA 5HS6A 3VVBA 2VRCA 4UUNA 4GWKA 3KZVA 4WASA 3BMQA 4NFHA 4WLUA 1VJ0A 2Y1FA 4D79A 4PLHA 1G0NA 2CDBA 3U3XA 1C0PA 1U2GA 4JLWA 3FNHA 5L51A 1XG5A 1F06A 2VRBA 1BHSA 4IS3A 1U3VA 1A9ZA 1F17A 1LDBA 2VNAA 2R2GA 2H9IA 2ZCVA 4NPCA 2X0JA 1IL0A 3PIDA 4AJ2A 1Q0LA 1PL6A 5G0SA 1U28A 3QA9A 3V1YA 4PG8A 1PR3A 3DZJA 3TL2A 4R68A 3I83A 3NT5A 4CLRA 2PV7A 1CJCA 1RKXA 4PZDA 4WPGA 1M75A 4ZVVA 1P1HA 4B3HA 4BO6A 1EVZA 2PTGA 5IDYA 2NM0A 1N9GA 1Y9AA 3BMNA 2QIOA 3L4BA 4OKNA 4L9RA 3RC2A 1I3LA 3UF0A 2J3IA 3UHAA 3DWFA 4PIVA 2IZ1A 4RF4A 3ZHBA 1A27A 1HE4A 3ETGA 3C8MA 1BVUA 1NPYA 1C1DA 2G17A 2NWQA 3WICA 2HCTA 1NR7A 2XAAA 2I76A 4FJ1A 4OIMA 3KOUA 2VWGA 1EFKA 3W8EA 5IN5A 3MJVA 5K6AA 4F46A 5G2OA 4MO2A 4KUHA 3IJPA 3I9NA 4K9DA 4Q3EA 5HM8A 3ZHZA 4DPKA 4FD3A 3D3WB 2ZTVA 4R1NA 1FK8A 2ZTMA 4J0EA 4NBVA 2XPCA 4TZKA 4X54A 2HDHA 3QLJA 1ONNA 4TRJA 1N8KA 3PZRA 4CLOA 3S2IA 1CWUA 4FOSA 1PJTA 4E2YA 2EF1A 1BXGB 4IQGA 1VC2A 3AM3A 3K5PA 4CPDA 5JO9A 1EE9A 5JY6A 2YV2A 4B8WA 5MGBA 1PGNA 4DPMA 2CY0A 4GVXA 1JN0A 3DBRA 1AHHA 4XCVA 1Q0HA 2GSDA 1KVUA 1ZJZA 2WDZA 3NTOA 3OJOA 4W9NC 3C1OA 3ZI0A 4B8ZA 2AG8A 3U09A 1T26A 1XIVA 3KYDB 4MIOA 1RJWA 3U0BA 5I9MA 1MP0A 4E0BA 3GVIA 3PJDA 4TMFA 2Z95A 1P1JA 3G79A 2H63A 3DXFA 4IJVA 1NHWA 4GVLA 1IOLA 3TZHA 1T2FA 2C54A 4TRRA 5CEJA 2CSUA 3O38A 2R00A 4QFDA 5TS3A 1YE3A 3EZYA 4ND2A 2JFFA 2I65A 3BMOA 4YEDA 4RDHA 1NQTA 5TSDA 3PWKA 3VPSA 1V9LA 3LZ6A 3A28A 3RCBA 3HFSA 4L76A 2PLAA 3FTNA 2WE8A 1YL5A 2O2YA 2F1KA 4FFNA 3DOOA 3PFWO 3I9OA 2G0TA 2HRZA 1XKQA 3IL2A 3F6YA 5KJEA 1T25A 4KQWA 2GN4A 1D8AA 5CAEA 3B6ZA 1ENPA 3BAZA 5GZ1A 3AY6A 5LCXA 2GUGA 3JYQA 3S1LA 2BHLA 3EY4A 2XF8A 3IQDB 2QW8A 4JBHA 4DMLA 4Q3AA 4L73A 5AXCA 1YKFA 2GO1A 5DCYA 4ITUA 3RQSA 1QV7A 2C7GA 3FPLA 1I2BA 1Q0QA 1Y8RB 1C14A 2C7VA 1NFFA 4JJFA 4KUGA 4RO0A 1IULA 2B5VA 2JAHA 4L75A 1YOVA 2X0IA 4GX2A 3JQ7A 3DFZA 4E5PA 1LEHA 3RFXA 4GMFA 3QWFA 2HO5A 3GH3A 4I8XA 3AOEA 1NXQA 4O5OA 1HETA 3QQPA 2PFGA 4D42A 4CMCA 4PLZA 5FWNA 2QX7A 2ZCUA 4KDEA 4QXMA 2DLDA 4CM8B 3HJAA 1QYCA 1E6EA 3JQBC 1X7GA 3JQAD 4YT5A 4XDYA 1T1SA 3UH1A 3V2HA 3PGJA 4NBRA 1ZK0A 1GUFA 5ER9A 3X2EA 4E3ZA 4BGUA 1IHYA 3TN7A 1R4MA 3TOXA 1B3BA 1H6CA 2DFDA 2Y67A 3NV9A 4GI2A 3T4EA 2HU2A 5JNLA 5L4NA 4CM6A 4ALMA 5KIAA 2VZ8A 1Y1PA 2VWHA 3PI7A 3JQ9A 4DREA 4E5NA 3HB5X 4FR5A 4W4TA 1ADCA 3P7MA 2EHDA 3ABIA 4GWGA 5H83A 5TIIA 4FB5A 2AG5A 3C85A 1P9LA 4DYVA 1HF3A 4EUEA 3OF2A 5JYDA 3GA0A 1S7CA 4Z9YA 2BF7A 2BGLA 4CQLA 4UEKA 1E3LA 3QWBA 2JCVA 3E1KA 1NTOA 1ZO8A 2QRLA 2ZK7A 3DMYA 4HWKA 3ZWAA 4J90A 3UUWA 5BNIA 1T2EA 4IDGA 5CP8A 4H15A 3GNSA 3U4CA 5F1OA 2GYYA 1PJBA 3R0IA 3ZU3A 3FR8A 4WCFC 3K2EA 4XQ9A 5I9LA 3H9JA 3INTA 4MP6A 2YQ4A 3MWEB 4RVHA 1N1EA 4KTTE 1K0UA 3WOHA 4ZD6A 3I23A 2RHCA 3OJLA 1AN9A 4I08A 3VAZA 2YZ7A 1J49A 1HDRA 5G4KB 4U7WA 3C24A 3GVXA 4NFYA 1E0DA 2W2LD 2Q1UA 2V6BA 3VZQA 4YRBA 4AJKA 1T4DA 2D8AA 3VZRA 1DC5A 3NYWA 4WCFA 3VOSA 1JDJA 1P1KA 2EEZA 3GY0A 1VI2A 4M8SA 3V8BA 1A9YA 3GFBA 3RJ9A 1IZ0A 5CPFA 3ZZNA 3GPDG 3PJFA 1E3IA 5CEEA 4YRDA 4BO9A 5F3RA 3OHSX 1LU9A 4D7AA 3PWSA 1B15A 3MZ0A 3GEDA 3SLGA 3RBXA 2GDZA 5HBRA 4F45A 3BTVA 5IZCA 2EW8A 1ENYA 4E5YA 5A02A 4Q3DA 1TEHA 3UVEA 5IDQA 4S3MA 4ZQEA 4A5OA 1CQJA 4J4BA 4O63O 4NBUA 2JL1A 3LT0A 3DZGA 4XGIA 1GZ3A 3RI3A 4LVCA 4WLOA 2GD1O 3GDGA 2RH8A 3PQEA 3DMTC 3BMCA 5A1TA 1PGQA 4YCAA 3S2FA 3W4JA 3RBVA 3CEAA 4YJGB 2PD4A 2J3HA 1T4BA 3ASUA 5HTOA 3OH8A 1H6DA 4DPLA 2BD0A 8LDHA 3MOGA 2YW9A 4D43A 3I1JA 2ZKLA 1DAPA 3FCOA 1BW9A 3BA1A 2OP0A 1Y7TA 4QSMA 3PQFA 4R16A 1TB4A 2PGLA 5TF4A 2AHRA 4BOYA 4FW8A 3DBHB 1C1XA 2ZTLA 4OM8A 1HDOA 5HS4A 4XA8A 5A5FA 1SPXA 5DP1A 4DTIA 3H5AA 5CG2A 3IP1A 1WDLA 4BV9A 2PD3A 2WE7A 3HN2A 1SC6A 3PTZA 1PZEA 3KSUA 4XYBA 4HKTA 1E1MA 3WYCA 3H4VA 4YBZA 2X7HA 3PHHA 3X2FA 4U0JA 1DFGA 5JDCA 2X9GA 2ZJ0A 4R69A 2OBNA 2EWMA 1L7EA 3WGIA 4BO2A 4K28A 2C5EA 2EW2A 4CMHA 5TNXA 1LA2A 2QZ9A 5TGDA 4WLEA 1X13A 4RLSA 3UAGA 3WTCA 1JTVA 3F4LA 2XXBA 3OETA 3TL3A 5IZ4A 3W4IA 1GZ6A 1LSUA 1PJ2A 3E9NA 4GBJA 4R1SA 4XQGA 1LTHR 1LBEA 4DBVO 3PHLA 3QVXA 1LRLA 1U3WA 2VHZA 4PLGA 2EP5A 4ALNA 4B4OA 5KWEA 1T2DA 1KEPA 1VKNA 2Y0CA 3LYLA 3K8ZA 3WGHA 4BUCA 1NFQA 3SVTA 3C7CB 4WLFA 1PGOA 4WE3A 2NTVA 4J2OA 4RPHA 3FRJA 4L4RA 1DEHA 2TMDA 4EEZA 5C5IA 3H9GA 4LISA 1UXJA 3AY3A 1GQQA 4GGOA 4P4GA 1NPTO 1R4NB 4CMEA 1KEUA 2BFMA 3GVPA 1WMAA 1TXGA 1HZZA 3JSAA 3BHMA 2AQIA 1YWGO 2YHIA 1IHXA 1JAYA 5AOVA 2Q46A 1JQBA 4XWYA 3T7CA 4DXHA 2BFAA 2VYVD 1PU2A 1B8PA 1GL3A 3IDSA 4ZRNA 1HLPA 3ITDA 3DOJA 2BGMA 3F5SA 3HUDA 3EHEA 4R01A 3OM9A 4P4LA 5L3ZA 3W6ZA 2IZZA 4YXFA 2X6TA 1MXHA 4GQAA 1VLLA 3ETDA 4RDIA 5EESA 2PKQP 4IIUA 5AXBA 4YACA 5JPIA 3E5RA 3ZWMA 2HMSA 1LQUA 3FSRA 3JYLA 3K30A 3SJUA 2FPGA 3M1AA 1NAIA 2DFVA 2JAPA 4NJOA 1HRDA 5JAMA 3FBGA 2X8LA 5J23A 8ADHA 4Q3CA 4GH5A 3L6OO 1B3RA 4KWHA 1M2WA 2E6UX 4XDZA 3ROKA 1LDNA 1UZMA 2E4AA 4R3NA 4W99A 3GAZA 4YTEA 4WNCA 1I36A 2WYWA 5T64A 1ENOA 1Y6JA 4YYZA 2Y1DA 4D45A 1DDOA 4QQRA 3COSA 3L9XA 1N5DA 1I5RA 4OXKA 2VHYA 2YFQA 3RUCA 3W1VA 1GD1O 2AEMA 5ICMA 2NU8A 3IOYA 4B3IA 4YT2A 1KETA 5DT9A 4U6QA 4BGIA 4OHUA 4D0SA 1JAXA 1Z73A 1YO6A 1A71A 4A27A 2JCYA 4IDDA 3HDHA 1K6JA 4MVJE 5I7FA 1X15A 1K3TA 1VM6A 4FFLA 1R37A 1JU9A 3QVOA 4WEOA 3TDKA 2GPTA 2OP1A 3ZW8A 1U8FO 1KC1A 1YJ8A 5ICSA 3R3JA 5CPBA 2CVOA 4DWVA 1DIRA 3EC7A 5ITVA 2JJYA 2Q1WA 3ORFA 1SB8A 3WSVA 4CLHA 2JD0A 3JCZA 2Y1CA 3ULKA 1MC4A 3DAGA 1NQ5A 1UR5A 2PH5A 3EZLA 3F9IA 2PGDA 2BLLA 1EDOA 1P0FA 3AUUA 3BZUA 5T5QA 1BRMA 3EK2A 3I52A 3DC2A 1ORRA 3GZNA 1JVSA 2BFPA 3WB9A 5F1PA 3NGLA 5JC1A 5A9RA 3N58A 1QG6A 4YAJA 2HRBA 4D0RA 1E3SA 2FSSA 5JMWA 4BO5A 3AW9A 1E7QA 2B69A 1EQUA 1DXYA 1EVJA 3O9ZA 2Y1GA 3K9QO 3UXYA 1I10A 2P9GA 2Q2VA 4FSHA 1MV8A 2DBZA 3KVOA 1P1RA 2GNAA 3M2PA 4M87A 1HE3A 2UUPA 4R5HA 4CQMA 1RPNA 3CMMA 4PZEA 4MVJF 1T24A 3PPIA 4E5MA 4XYLA 5BSGA 3DDNA 3TZQA 5JAZA 2EERA 2PWZA 2OOSA 2FN7A 3KYBA 5A04A 4DBZA 3ZWOA 1LLUA 4MKZA 4BNHA 3QV1A 1BXZA 1IY8A 4J91A 3UW3A 5DN9A 3MJTA 3IS3A 3TWOA 3V1TC 3CSDA 4I5DA 4BNGA 4E30A 1NASA 4Z9XA 5L45A 2UYYA 2Y0DA 4Q3BA 5FYDA 2NTNA 4CR8A 1CQIA 2W4QA 4FFMA 5EINA 1PQPA 1HXHA 4WOKA 1E7WA 4ID9A 3U5TA 4WEQA 3R3SA 1WMBA 3ZWPA 1ISGA 4OKIA 5DCUA 1R0LA 2RBEA 4BO4A 3PRJA 3ZW9A 4TQGA 5T67A 1OBFO 1U8XX 4UUPA 3KTDA 2DU8A 1ZK3A 2O2SA 3JD3A 3OEWA 3EAGA 1R12A 1YDEA 5BNFA 1Z74A 3W6UA 4CM1A 3OECA 4IZHA 1N92A 4HV4A 1V3UA 3PYXA 5C3MA 4J1SA 1U7TA 1VJ1A 2UUOA 4W9NA 4AJOA 4RF5A 2WJPA 4HNHA 5H81A 2VOEA 1V8BA 2C0CA 3D3WA 3WFJA 3GR6A 3CE6A 5CG1A 2JFHA 4YVFA 4TWRA 5I8WA 3GNTA 4U6SA 3ZWXA 1LLCA 4DIFA 3VPHA 3ICPA 9LDBA 4BNXA 3K2BA 3LLVA 3C3XA 3D4OA 1UXKA 1E6UA 3ANLA 3I9MA 1OC2A 2O7QA 3RUDA 3DONA 2CDCA 3KBOA 3E9QA 1I33A 1HWYA 4PLPA 4JJIA 1O5IA 4JN6B 1T2CA 4W7HA 4HX5A 1UDAA 4ND1A 3GMDA 2IDZA 1TI7A 2EJWA 1UP7A 3H3FA 4BQRA 4YJHA 1XQ1A 4E12A 5AVOA 2HMWA 3PWZA 2X5OA 3QWIA 3RWBA 3I3OA 1BGVA 1U9JA 3OJEA 4OQZA 2P5YA 3PFFA 1BSVA 2DPHA 4L74A 4J49A 4HFRA 4RVUA 3ASVA 3WGQA 4L4SA 3LF1A 2D5AA 4RPLA 3RC7A 2O50A 5IXSA 3KEQA 2E37A 3U4HA 3WXBA 4CM5A 3JD0A 1PJCA 4IY1A 3MOIA 3FHLA 3G3EA 2UV8A 1PGJA 1ISFA 3D5TA 1ZFNA 1EBFA 3HQ4O 1YL6A 4P22A 3MWDB 1E7YA 2ZB4A 1ISIA 2HKIA 3JQAB 3CKYA 4WCDA 4K6CA 2DUWA 4IGEA 1FDWA 4M55A 1E7RA 1I8TA 3VH1A 5A3JA 2B35A 2D4AA 5FF9A 4NG5A 4CM3A 3C7AA 4YJFB 5KTKA 4KZPA 5A05A 4BO7A 4BS9A 2HUNA 4BO0A 2I3GA 3DAFA 1GTMA 2FZEA 1G1AA 5COBA 5L7TA 2AA3A 2GR9A 4XJTA 3PLRA 2G5CA 1NP3A 3DTYA 1DLIA 1Y8RA 1DPGA 3F3SA 5JFOA 1DJNA 4LCJA 5HWSA 1DRWA 2I99A 5ITWA 2P9EA 1JWAB 5KNLA 5U9CA 2DT5A 4BNJA 1BTOA 2W98A 2PK3A 4ND5A 4ZQGA 4IQ0A 4E2XA 5A5EA 3CUKA 3WYEA 1SOVA 1O0SA 4W6ZA 2VNSA 4G81A 3ZGYA 5THKA 2VYNA 3G49A 3GAFA 4EI2A 4MIYA 2Z1NA 3OIFA 3VTZA 4OOEA 1XQ6A 3RC1A 1ZUD1 4CM8A 2YV1A 1ZJYA 4MVJD 1D7OA 2CF6A 2V7PA 4R9RA 4R51A 5AYVA 3TZCA 1DSSG 1HYGA 3LU1A 5I7SA 4QO8A 2DTEA 2V6GA 2XOXA 5B37A 2PZJA 3HG7A 2IXBA 1R66A 5EJ2A 3DBLA 3QRWA 3KB6A 1KBZA 4LSMA 3DL2A 1MX3A 1CERA 4MKRA 4M86A 1EUDA 3DAPA 4GSKA 4Y6RA 1U7HA 3V2UA 1WXDA 4CJXA 3ZNPA 2VCYA 4O0LA 4J4HA 2IYOA 2W2KB 4NJMB 3RUFA 1PEDA 2P91A 3QSGA 1R6DA 1LI4A 4EDFA 4Z6KA 1OOEA 4J1TA 2VTEA 5B4VA 3Q2KA 2B5WA 1TVEA 5JS6A 3B70A 1NAHA 1GUYA 1J0XO 3DB2A 4R4JA 3E8XA 3WFIA 3ZWVA 4C7JA 1DC4A 4UUMA 2NU6A 1XU9A 3DZHA 5L4SA 2I66A 1YQXA 4J7XA 1K89A 4P4NA 3I6IA 3L4SO 3NTQA 1PZHA 3ZHYA 5L9AA 1DBVO 2ZQYA 4J9VA 1O9BA 4BV8A 4JBGA 1Q1NA 4INAA 5AXAA 2EKQA 1XELA 5KKAA 5DBIA 4QO7A 2AE1A 2DBRA 3H6KA 1ZSYA 4FC6A 2D3TA 4I9NA 4B7CA 4IJKA 4DLLA 4ALKA 4OGWA 1Q7CA 1UAGA 4LGVA 1GR0A 3JQ8B 1H2HA 1ZXBA 2QRKA 1W8DA 3LDHA 4Z3DA 1P45A 4FC7A 4XIYA 1ZW1A 2AQKA 3PEFA 3V5NA 4RF2A 3ZV5A 4PVCA 4U0KA 4DVJA 1PS0A 1LX6A 2BFOA 1A4IA 4WLNA 5JMPA 3UFXA 4M1QA 4BKOA 4BNWA 3HWRA 1B7GO 3EYWA 4BNLA 1R0SA 3INRA 3Q3CA 5CDSA 2FR0A 4UVGA 3FNEA 2HQ1A 2AQ8A 3BMQB 4AJIA 4BNYA 2AMFA 1KIFA 4XYEA 1UUFA 2FRDA 3ITKA 3DQPA 3VZPA 1SOWA 1BWSA 1QR6A 2O3TA 4AJJA 2Q2WA 2J5KA 3GZ4A 3PZBA 4JJGA 5TT0A 1QORA 2Q1TA 1CYDA 1TA4A 2D2IA 4EGFA 4F3YA 1T2AA 5JCJD 3O8QB 3UICA 3V1UA 2X0RA 1F0YA 5JDIC 2J8ZA 1BG6A 1H9AA 3AI3A 3PYMA 4BNIA 5KJFA 4LRSB 3NAQA 4RPJA 4CLRB 1WDKA 5EL0A 4AJNA 3NRCA 3L9WA 3SC4A 3FNFA 5DOVA 3F46A 2PZKA 5F5NA 1TT5B 3E5MA 1W0CA 4B4UA 1N9GB 5G0TA 4XZ3A 3ZWYA 4XQCA 5EQDA 4P8RA 5CDYA 3WGZA 9LDTA 3PHJA 1LRJA 4K1LA 1ZXLA 1YRLA 5HA5A 1O95A 4OQYA 4NU6A 3D5QA 3FR7A 1E3JA 1CETA 1PJ4A 3FPCA 4LCEA 4MJLA 4J43A 4ND4A 5FFFA 4LN1A 5IFLA 2OFPA 4BB6A 2IZ0A 3O26A 4LMPA 4KDFA 5GMOA 1KVSA 3KHUA 3GFGA 4CQMD 4DMMA 3CH6A 3LLSA 3N7UA 1JKIA 1YONA 5EMHA 1MLDA 3LK7A 4BQPA 1XGKA 1IUKA 2UAGA 1E1LA 3JQGA 3JQ6A 4CLOB 2EJVA 3L4BC 4IQ8A 1EVIA 4A03A 5TC4A 3A9WA 1GQYA 4IDCA 4AVYA 5BSEA 2GN6A 5JLAA 3PDJA 2X9NA 3LT1A 1I0ZA 1MFPA 2O3SA 1H5QA 2YYYA 1UXHA 3K92A 3NJ4A 3NT4A 3OICA 3SX2A 4CM4B 5K6AC 2VN8A 3RU9A 1XDWA 2LDXA 2IXAA 3MTGA 5DF1A 4I5GA 2OXIA 4XIJA 4OMUA 5COAA 4HNGA 3ZCXA 1DHRA 4RORA 4OSPA 1CIVA 2PKRA 1R4NA 3D4NA 4ZA2A 3GF4A 1JKFA 3TNLA 2AEFA 4JXKA 5B12A 1DHTA 3AM5A 3S2EA 3MEQA 2YUTA 1XCBA 2EXXA 1EZ4A 3GHHA 1KY4A 3ZV6A 2WD7B 2DAPA 4AG3A 1QRRA 2B83A 3EW7A 2DKNA 4FQ8A 3OA2A 3G1TA 3OQ1A 2QYSA 1RM5A 4UUOA 1NVTA 1EE2A 1LC3A 4OH1A 1ZZEA 1JA9A 4KUEA 4OAQA 4ZGWA 2BMAA 4FPXA 3JYPA 1ISJA 2B36A 1U4SA 2X1HA 3VH2A 3GOHA 5T8KA 4CV1A 7ADHA 3FWNA 2D5CA 3OBBA 1E1NA 2AE2A 3RKUA 2ZQZA 4D3DA 2R00C 4FS3A 2YFHA 3W8FA 5DBGA 3L77A 1P33A 1ZEJA 2Y05A 4RZIA 2EIHA 3Q0EA 4BGVA 1ONOA 4XQEA 5ES3A 4BHTA 1Y9EA 3DR3A 3WGYA 1JVBA 1YGYA 5L40A 3MJSA 1WLYA 1QSGA 3DHYA 1PWZA 4RVDA 1ADFA 2RH4A 3JQFA 2P2SA 3AI1A 3VC7A 5C7OO 1E5LA 4BB5A 1I32A 2FR8A 2CUKA 4BNNA 4JIGA 5C37A 3DZKA 2C2XA 1DAOA 1I3KA 2PZLA 1EUZA 3JQ7B 1X0XA 3WQSB 1V6AA 3GN2A 3ON5A 1DIHA 1J5PA 2YDXA 4ILKA 2IODA 3IIEA 5A03A 2GZ1A 5IF3A 1C0IA 4XRRA 4ALJA 3OQBA 1SEPA 4MIEA 4E6PA 1A4UA 2HAEA 2VRCD 2Q45A 1PIWA 2FPIA 3OIDA 3PGXA 1FDTA 1HKUA 2HK8A 1P1FA 4O1MA 4FFPA 1WW8A 1KVQA 2HLPA 4UULA 1EK6A 2BGKA 4PN3A 4M49A 4QUKA 2IE0A 4FCCA 3OP4A 4IXWA 3VH3A 4PLFA 2AXQA 2VWQA 4CMIA 4YT8A 1W4ZA 2UVDA 2NNLD 2PZMA 4NFSA 4PLTA 1Z6ZA 3AFNA 1DC3A 4E32A 3OIGA 2GCGA 3AOEC 2B0JA 3GGGA 1QLJA 4R5MA 4FOOA 1VL6A 5ADHA 3TQHA 1YXMA 1XEAA 4YAIA 3GUYA 4OOFA 3DEYX 2VZ9A 4HUJA 3AUSA 4Y9DA 4RQUA 5DZSA 4NH4A 3FWZA 1NNUA 2DTDA 1P44A 1HT0A 1M66A 6ADHA 1QYVA 3HE3A 3NEPX 3WBBA 2FY8A 3VTFA 2E82A 4UAGA 2H6EA 3ROMA 2J3KA 4YRAA 1GV1A 1DB3A 4JNKA 1IE3A 2VYND 2WMDA 3B1JA 3GN1A 3JQ9C 2HSDA 2GN8A 4II3A 4RGBA 3GVCA 3DBVO 4YDRA 5BNTA 2Y0EA 5K1SA 1KYQA 3WG9A 3SJ7A 3TSCA 2OL4A 1HLDA 3H5RA 1NVMB 4CMJA 5IAAA 3QVSA 2BI8A 2CMDA 3AOGA 4QTZA 5G4LA 3WGGA 3FN4A 3KXDA 3PJEA 4CMGA 1Z7BA 3BTOA 2O23A 3PK0A 2NU9A 1SB9A 4I1IA 3GEGA 3R6DA 1WAMA 3GEMA 1BDMA 5EN4A 5AQ1A 3JQEA 4WCFB 2NVWA 5L95A 1RM0A 3N74A 3OFSA 4EZBA 3S8MA 4N5LA 1Y8QB 3E9MA 1HDYA 3I5MA 2ZB8A 2O3RA 1KC3A 1X1TA 4G65A 1E6WA 5K9ZA 4CMAA 4HFJA 2A92A 4G5HA 4K26A 4BMSA 3U4IA 3KLPX 1X0VA 1X7DA 4Y6SA 4AL4A 2NVUB 3ANMA 2WM3A 2Y93A 4DC1A 3KUXA 1KEWA 1YB1A 1AXGA 4MVJG 1PX0A 1K5HA 4CL3A 2GGSA 5IN4A 2HMTA 3H9QA 3KSDO 1XA0A 3SLKA 1H6BA 2VHXA 3MCVA 1Z82A 2W90A 1KVRA 4JBIA
chains in the Genus database with same CATH superfamily
1C3XA 4ZVSA 4ZT3A 4OI0A 2K4MA 3GB9A 2GF0A 3BMCB 3FPBA 1WHTA 4DLVA 2HNBA 1PL0A 2J5BA 4X84A 4EJMA 1QJCA 3EFOB 3VOBA 3NIGB 6PFKA 3FPGA 1A2BA 1N1MA 1UEIA 4OQLA 3U7JA 2EFCB 1VCNA 2D1SA 4MQEA 2PKWA 2FU5C 2ZUEA 5EP2A 2P79A 3KEOA 1OROA 1V48A 4LZOA 5UKDA 4CTOA 1KK2A 1UOPA 2PX8A 1XJ5A 2DHRA 2I1QA 1KEVA 1NZFA 4AN4A 5TV2A 2I6TA 2WIDA 3H4IA 2G5GX 1BA3A 2XHEA 1GGVA 4IX1A 4C0KA 4DCTA 1H1LA 1XU4A 3TLEA 4RL6A 1NN1A 2RKOA 1MQ9A 4MUEA 4BMPB 2OUKA 3AVVA 4A92A 2ZYGA 2VZEA 4DA4A 1NY6A 2GCPA 1TCBA 3D7SA 2JKYA 4MULA 2Q6IA 4OHXA 1ZH8A 3OSZA 3EE6A 2AMLA 2OHIA 4OJTA 4RPKA 4ZHSA 4K05A 4FWTA 1E4VA 2J1LA 1TNDA 5DLEA 3ZJ5A 4QL3A 1ICIA 1XDGA 1ZHHA 2ZR8A 4ZAVA 3TPZA 1W5FA 1Z6YA 1Z07A 1PN3A 3DNPA 4FJ2A 4Y3UA 5EYPB 3C3MA 4OFWA 3DUWA 2X3UA 4RK6A 1X1BA 2NTEA 5SY6A 2X9VA 3LGAA 3F73A 1YQWA 2HF8A 4HEQA 1XHLA 1QFYA 2PGOA 3PSAA 4M54A 2H59A 2QTAA 4M0PA 4QQFA 3U4GA 4Z7OB 1R50A 1ZP6A 1NBOA 2FUCA 2HJWA 2Q9UA 2QD5A 2C96A 1P3DA 2B25A 3E0XA 3GQVA 1Y81A 3K8QA 1JQKA 1ZWKA 1NKSA 2YBEA 1F60A 3K05A 4FFBA 4A0SA 1YBVA 2FHSA 4J9UE 2EP8A 2A4KA 3RASA 4YCBA 1LWOA 4ARVA 4AW9A 2R7LA 3ANXA 2JJQA 4U9HS 1BDBA 2W5UA 3NLLA 3PL1A 4MV4A 1AN0A 1Z4KA 2CLIB 3OO0A 3RRBA 1ZH2A 4ZVMA 4M8NE 3RROA 1ORDA 2MMCA 2IYFA 1HDCA 4AJHA 3MMSA 5I5GA 1MO2A 1Q3HA 1OAOC 2KLBA 3O82A 2JJ2A 2VJYA 3TLGA 5LDHA 2QG9A 2CKMA 1V0JA 1R27A 3UMFA 1WKCA 5FI0B 5LQMA 1ZUNB 5I5EA 1VI6A 1WVGA 1P77A 3JALB 3U19A 2FVXA 3R9XB 2VF4X 1V2HE 1UBGA 1XNHA 2Q3MA 3UJBA 2AH5A 2DHQA 2BEVB 3QTTA 3KWLA 1VSUA 2CEAA 4ZJZA 1KEEA 2OBMA 3FKJA 4E5SA 2WT4A 1E3MA 2R7AA 2UZ1A 3B9BA 5JZMA 5EMKA 3GJQA 3E22B 5HJEA 2GERA 4GC9A 1UJCA 2AOUA 2ZI3A 3FJYA 3L0IB 5FI3A 5YASA 5LMNB 2X15A 1MTZA 3EVTA 3LM8A 3G9QA 1HT2E 2FP4B 1RQXA 5K8UA 1XRPA 4DHEA 1UKAA 2GTHA 1KIAA 1LC0A 3NPMA 3ZLBA 3IIJA 1BU8A 2C82A 3AYZB 2Y77A 4RYLA 1JX6A 1T6XA 4Q01A 3LDFA 4G9GA 5KNDA 4L6IA 4A6DA 4MUXA 1GNQA 2OSVA 2QAIA 2DULA 3A4MA 4UFNA 3TMYA 5B3KA 4UM8B 2QS9A 1MA0A 3LUPA 2IHJA 4GIBA 3PC8C 4N49A 3HHPA 4B3RB 4F5DA 1A7AA 3TOZA 4XUCA 4TV8A 2X42A 3SE0A 1BD4A 1EP1B 3CPSA 1Z35A 3DKKA 3NIBA 5AW6A 4H16A 3TJMA 4RPIA 1E94E 1ATIA 4Y18A 1HDGO 1OYOA 4NNJA 4AN1A 5JW6A 3WSTA 3FI9A 3IPYA 2H48A 3ONVA 5IHXA 1E9CA 2ID8A 4N7JA 2XQFA 2R97A 4H1TA 3PE6A 1EBUA 1T36B 5C5EA 1WPQA 1KMIY 4PANA 5KKCA 2EP7A 1F6WA 4C6SA 1G21A 1FDSA 4EI9A 4N3BA 4N47A 1F20A 1QP8A 4INPA 4MX8A 2ZUVA 4OHWA 5D87A 4EJ2A 4Z9FA 4G5SA 4AG5A 5KZMB 1CF4A 3STVA 1M0SA 1WL8A 1O87A 1KYIA 2GD2A 2QSZA 5FXMA 3U39A 1GJRA 3VO2A 3OQIB 2C59A 2B99A 1CP3A 1RYZA 2VHWA 2Z43A 2Q5QA 2G88A 4MICA 5AM3A 1F1BA 4GLOA 3DPUA 3OWOA 1AUVA 1XK6A 1GQ2A 4A7PA 2YQ5A 1TU3A 1QLHA 1TF2A 5JE8A 3G2MA 1E92A 3GDOA 1DIOB 1FFGA 3MFQA 3CTMA 5K8TA 3L6RA 3E3AA 3UW1A 2Q5IA 1OLOA 3E7WA 3JW8A 3WRXA 4XYMA 4BX3A 1HQYE 2BP7B 3AUAA 4IV0A 4MEBA 3DZFA 2IV7A 2FSPA 2ZXFA 3WQRA 1JFSA 4HFMA 4JOCA 3FNGA 2B3TA 1GM5A 2H2WA 1E1QA 2X77A 4J1NA 1ADJA 1OFUA 4OAOA 1ZJJA 1EE1A 5D6NA 4B8YA 2FWJA 3R8FA 3WYBA 1AJEA 2YWXA 1QHXA 3B20A 3BGVA 3L6DA 1GCUA 2B78A 3B8EA 4MPJA 4P82A 2DPMA 4BQSA 4Y6LA 1KVTA 1QOPB 2Q3BA 4LJ4A 5EGNA 1XTUA 5CT8A 5DXFA 4Y2YA 2JLAA 1C41A 5I4BA 3ZY2A 1R8YA 1E7MA 1YB5A 3MMNA 2QLLA 1W73A 1NVUQ 1Z08A 2CHFA 2HC9A 4A2WA 2C0QA 4FLEA 4PGFA 3Q3EA 3OZRA 4ND8B 2Z8YA 3CCBA 3OCJA 3MPUA 5D3MA 3TO5A 1OFGA 3Q5GA 3WJAA 3OQMA 3DZBA 1E9SA 4RULA 3IULA 3O2NA 4ZOLA 2ATVA 4ER7A 3KZNA 4B82A 2DECA 3VDMA 3I2IA 4WUTA 2ZB7A 3EVZA 3K8YA 4RY9A 3JQBA 5A9SB 2C83A 3DF9A 1CLEA 2ZSFA 1U0RA 4LMRA 1W36C 3IUYA 3GGPA 2D0IA 1CQZA 1JR4A 4NV3A 4QEZA 3OT1A 3G02A 3K0AA 1GGMA 1LV7A 2P2YA 1NX6A 3TLAA 2RD2A 2YRWA 2M6KA 5J43A 4ZPXA 4LMBA 3TM4A 3EEBA 3GDFA 3ZIDA 4JQCA 3RAJA 4C7OB 3NWJA 1CRLA 4PG6A 1N57A 4AJ4A 1EVEA 1DP4A 5CJPA 3B5IA 2LTAA 3VV3A 3WQBA 1VBMA 1D5WA 4EUSA 4JI2B 2J9GA 3B1KA 4L22A 4O2RA 2JEOA 4TUYF 1TEZA 1VA4A 1G5FA 4EVSA 2OKGA 5EKXA 2PEYA 3GRCA 3JZFA 3L07A 5EP3A 1KJZA 5AKEA 3HADA 2CNLA 3KPYA 5BSFA 2JA1A 4B80A 2PXAA 3KQYA 2HTEA 1QNLA 1Y98A 2XSZD 4Q4AA 4OJYA 2ZATA 2XDAA 2VDJA 2IPOA 3BGSA 1VMIA 2Z98A 3AX6A 3C39A 2VPTA 4CKEB 2QTFA 4MAAA 3I8XA 1H0KA 3HVHA 1U31A 1FYWA 2PL9A 4PXAA 4BXOA 3D1LA 3GG9A 2QVLA 4D3SA 2CB0A 2PMDA 2MSEB 1FFWA 1YUMA 3VYVA 5LUAA 3AU9A 5JROA 3TFOA 2YNMC 2FDRA 4DF3A 1XKXA 4J7UA 5LDDC 2FWIA 2JIPA 3WMXA 3S8EA 2GM3A 4O2BA 3QOFA 4Z0PA 1TTPB 5FEUA 4UDYX 3A06A 3KE8A 2UKDA 1XDUA 4YXWD 1L5WA 2R8ZA 3A6KA 3JY6A 4NZ9A 1A95A 3O8OA 2WAXA 5TE9A 1ILWA 3KS9A 4REQB 1KBOA 2FP3A 1M1XB 1W94A 2PRIA 3ZDEA 4JX8A 4LMAA 2P2GA 3NT2A 1GDHA 2R6DA 4IXTA 1I2CA 4WZBE 1DAIA 4N3AA 3ONFA 3KSMA 3SZLA 2C5SA 4DNQA 1FUEA 3E7XA 1V95A 3HJHA 4ARCA 4TXNA 4F8EA 7MHTA 1GRNA 2NSDA 2QTWB 4DVGA 3E53A 5F77A 3BWVA 3GK3A 1T1GA 2YV4A 2OZLA 1HYQA 4CM4A 1NJ8A 5GWXA 3WGMA 3C5HA 5FRDA 4H59A 2OFFA 1PJLA 1Q6ZA 1XD2B 2H4HA 5JWRA 5FYQA 2XGMA 1U0JA 1WXWA 3OPYA 3FBTA 2FOIA 1DARA 4KYIB 5B6JA 2Z3VA 4BNVA 2PJZA 5A4AA 5I51A 4NV0A 2Q29A 3WMGA 1UWKA 3OFKA 5ICCA 2AWNA 4EEKA 3G13A 4Z1MA 2QE7D 3P9ZA 1KP2A 2Y92A 1NF8A 3ZS9A 2ZJ1A 3DMTA 2B4RO 3FFTA 4L0DA 1N7JA 2QIPA 2RHRA 3SIWA 4Q66C 2SNIE 2KWIA 2PO7A 4N82A 2GF2A 1DKPA 2JJ1D 1E1RA 1IXSB 1TLFA 2GX6A 2PRYA 3NHSA 4P4TA 4WKOA 4CGYA 4WACA 2H4FA 4IS2A 2JS7A 5CNKA 1IYZA 1QCZA 4DCSA 2RHTA 1QVRA 1Z7EA 3F47A 1C81A 4CGZA 1YBMA 1T0PA 1M1NB 2A1IA 2V0NA 2XMRA 3B8HA 4JT9A 5HUQA 2PXCA 4E4RA 4DIUA 1AKQA 1ORIA 3RF6A 4JL8A 2I91A 5KQLA 4KLNA 1CZHA 2BUBA 3DW1X 1DFHA 1HZJA 3OD1A 4UNSA 5WRFA 1SHTX 1PO7A 1Q7BA 3AB7A 2Q99A 2QPAA 4TQ9A 4XSVA 4ZZ1A 1JALA 1ACLA 1QUFA 1TC2A 4Q3LA 5EZ6B 2R60A 3DS8A 2HIAA 3PA6A 2XOKD 1U98A 4MP3A 1IJFA 2C5FA 1DAHA 2CXRA 3LCCA 4KFSA 3H5OA 1NFRA 3EXIB 1UP6A 3WGJA 1OZAA 1W19A 3R0QA 1PDOA 1PR6A 3CZ4A 2XCLA 2WT9A 1M2KA 2M98A 5DM2A 2GRUA 1D2CA 2A2ZA 1QQTA 4XLLA 5JNSA 4YRFA 5JVDB 2YZKA 1Q7RA 3DLTA 2DG2A 1XHFA 2RHBA 3OHPA 1TDJA 2V7QD 5EE9A 2YFYA 1AXEA 2WG0A 2BOVA 5IWAB 4FFWA 2PPLA 1ZMXA 1GPNA 4B79A 4DA6A 5JO0A 1V16B 2IYVA 4KN6A 4WK6A 4QDOA 3CINA 3UJAA 4BNKA 5DTRA 3TW8A 3BMNB 3EQ6A 3I28A 4UMFA 3TRDA 5BR1A 4YMTA 2XA9A 4TS9A 5GADl 3FMGA 1JDPA 4YC7A 2X4DA 2BONA 4FW9A 4Q16A 4C3UA 4D6XA 2GZMA 1KI4A 1TKRA 4QFBA 2HEGA 1E0AA 1L6IA 2C2YA 2CXOA 3TZ6A 2PR7A 1D8TA 1E1YA 3RUHA 5I7OA 1YIDA 3SYMA 2BBWA 1OD6A 3AF1A 3OPXA 2X6QA 5LA6A 1B26A 1QYXA 4CT0A 4XB2A 3NX4A 4Q1BA 2FW6A 3GNLA 1YI0A 3A6JA 1PLKA 2XMGA 2GASA 3LY7A 4IV5A 4AF8A 4B4VA 1ISMA 4WVFA 3S8YA 1U0HC 4DR3B 3C2QA 2VP6A 1QWSA 3ENKA 5IBPA 1YK1A 3HVRA 3TUJC 5DULA 1YL7A 3EUEA 2CL7X 3AONB 4PNZA 4TL9A 1OFTA 1BVRA 4V39A 3OESA 3BSWA 4R3UC 1J8MF 5ISMA 4V03A 3RVNA 5TVGA 4FSXA 3N75A 1KHTA 1XJ0A 3MQFA 4M99A 4Y67A 3VSCA 3WY9A 4D5GA 4J75A 3CVUA 4KREA 4UCWA 2C95A 4RVCA 4B6SA 2VUHB 1F5SA 4HL6A 4MR9B 2OM2A 3RVLA 4L1KA 3ZDBA 4OATA 1JFFB 2K87A 3VUEA 3C3CA 3WNQA 1X94A 1RJDA 3DBRB 4OHMA 3O75A 3ZNOA 1R64A 4KG7A 5BSUA 5EIOA 1H22A 2EGGA 3DT6A 2I9KA 4LDRA 2AX4A 3BWCA 3WBFA 2HHHB 3A1NA 3B3JA 1G7SA 3TPFA 2NO0A 2WSSA 1N25A 2QHXA 4KITB 1GN9A 8ABPA 2C00A 5G0UA 4TV9F 1CUUA 4PONA 4N6NA 1WD7A 3A3YA 1SURA 2FPSA 3H5WA 4QQ8A 1HT1E 1L5NA 1U0BB 3RSOA 5HE8A 2FSUA 2UVPB 1RJEA 2DC1A 2OQRA 2O7SA 4X00A 3SJCA 1CUWA 2TMGA 4FNAA 4LWOA 2C2HA 2WB2A 1GZUA 2LNDA 3A6EA 1G38A 2QZ4A 3NGMA 5ALZA 3EPLA 4JOBA 3RYCA 2AJCA 1OPXA 4ITVA 4M21A 3Q10A 1DIAA 4CIYA 3G0GA 4FOTA 4I9UA 4PLVA 1WF6A 2XB8A 2HK9A 2P1RA 4C3OB 3ZDRA 1VB5A 1J9EA 2H4JA 4GW3A 4PNHA 4RA9B 3ZJTA 4IRUB 2WWRA 5DH9A 1E8DA 2QJOA 5MFZA 2I3AA 4MW1A 3SK0A 3RD5A 1Q1EA 4E2FA 3FCAA 3LPDA 1HE8B 1F2UB 1UKEA 1J2YA 2ZM5A 1W4BA 2CFCA 2GZAA 3I30X 3GLIB 3A8TA 1AQ6A 4IOJA 1EM8A 5CX4A 1IUNA 4I1SA 1QIGA 1FP2A 1QZ3A 5CURA 5EMJA 2ZYDA 1PR5A 1NQAO 4NEGA 3WKBA 1ODTC 4JBYA 1AO3A 1N2OA 2FUKA 2V7VA 1LDEA 3HNPA 3NOOA 3V7YA 2QQ0A 2E48A 1KZ1A 2J9FB 4DCPA 4E7OA 4X6XA 2AZXA 2I6GA 4UM7A 4ARUA 2WYVA 2L0XA 5ESXA 3RREA 4JUDX 2DXIA 3DOFA 4GWLA 4LV8B 3FLEA 3MD9A 1JI3A 2EL7A 5BWLA 2X0EA 2Q0XA 4XVCA 3T9EA 1PSDA 1L1EA 3PNKA 4FE7A 4F06A 1LXCA 1T35A 3DEIA 5LIRA 3R3YA 1KTIA 3GRPA 3L02A 4FJ0A 5TQVA 4MVJI 1KS9A 4AJLA 4FZRA 2NQTA 1PFKA 2FZWA 4LDQA 4QECA 3ZD8A 4CUZA 4CV3A 4RV9A 1K2WA 1LBIA 1GDDA 4CG3A 1YOVB 1M2OA 3LKBA 4OG2A 4I50A 2GAFA 1WBBA 4O02B 1GZVA 4WJZA 1B76A 1CF2O 2VUSA 1K4MA 4PO1A 3REQA 2YYAA 2R79A 4N54A 1H4VB 2Z56A 3B60A 4D3FA 3TR5A 3VKWA 4O6VA 1GRCA 4XEHA 1KI3A 2I2CA 4JQYA 4RVNA 2A7XA 3UK2A 5JYEA 1EWTA 1MEOA 2Y9MB 5LOVF 1T1IA 3WK5A 2IXTA 4BV3A 3IA7A 2HHCA 1AUQA 1SMKA 2E2WA 3FD8A 3MTAA 3O4IA 3OZDA 4O25A 3L0DA 1FVXA 3QXJA 3B13B 4LDZA 5BV2P 5K20A 5K3OA 5LYJB 1I30A 4HR7A 3PQ2A 5K6TA 2BGIA 4NDAA 1UPXA 3HGTA 2G9NA 1HSZA 3TSOA 5EERA 2CK3D 1XP8A 3GGOA 3D6FA 2C5GA 1O3YA 2G9RA 4EGCB 2VDVE 3NHKA 1EHCA 4Y6QA 4CR6A 3I4CA 2DHEA 4LE1A 3LHDA 2ZE7A 4QPCA 2JLYA 1YFLA 4UHDA 4AXXA 4LXGA 3JZIA 1T5DX 3OIVA 5IYZA 2WIKA 3ROGA 1GDTA 1R4ZA 1M34E 3WC4A 2H1RA 3A6HA 3EWSA 5EMNA 2X76A 5CIQA 3KLNA 3WHPA 1HE2A 3H16A 3IEVA 2HK7A 1FNCA 1JQDA 4I55F 3UGJA 5EJAA 2DKOA 4Z4HA 3GNQA 4U8GA 1L8AA 3EVNA 2IUFA 4EAQA 1G41A 2EFGA 3E82A 1QXSA 5E9QA 4NWIA 1O95C 3P2OA 4LF8B 2FW7A 4EHDA 2N46A 2O19A 3EQZA 3UB2A 1Z2OX 1YVUA 1KEZA 2GWRA 5DX0A 4RDXA 1J5EB 4CEHB 3L8EA 5GY7A 2YS7A 1ZMOA 3MRTA 2P2CA 3RUIA 3R7WA 4FD2A 3FNBA 3PQDA 1U0LA 2J5RA 2ODEA 1Z75A 2VPWA 4DIOA 1WD5A 4ZZ2A 1OPRA 4WZZA 1K97A 1YAJA 4FR2A 3SEQA 3I9KA 4B44A 4QLOA 1HH4A 4W6QA 4HN4B 2JLQA 2IVZA 5ALLA 3IEXA 3M3DA 3NR2A 3GJ8A 2D54A 5AMXA 2EATA 1PR2A 4R05A 5COQA 4MQLA 1RYFA 2FLKA 3I6ZA 4BRWA 4KRYA 1XAJA 2JIBA 3KDPA 1VKRA 1JTEA 4HVAA 2JDIA 1XZDA 5G1PA 3PNYA 4X61A 1UF9A 2Y1XA 1X38A 3D8BA 3TQOA 3DE3X 1JIKA 1WP4A 3HTXA 1GIAA 1JAIA 1FFAA 2QLJA 3ELBA 3W2EA 3QU7A 3RUAA 3EAQA 4V1CB 3ZHXA 4KMRA 1EXVA 1TIKA 4EW2A 1A8IA 1O96A 1PEAA 1GAWA 1E59A 2GPBA 3B5EA 3RJ5A 1C9YA 1LPPA 2PS1A 1DC6A 3TDNA 3CX4A 3CLRD 4KXQA 2ZIUB 4HGZA 1SEVA 4IKOA 4G8DA 4GRAA 2FFBA 3BIOA 5HK8A 2I8LA 2R85A 1PWEA 3M6AA 4JCCA 2HF9A 4NHEA 4ASUD 1XJWA 821PA 2O0LA 4KBGA 3HCEA 3H8VA 1D09A 3NC1C 5KYNA 3FDIA 2FJ0A 5KC9A 3TZKA 3STHA 3UZUA 1KI2A 3HVIA 5LYYA 4ARZA 2QP9X 4OCZA 1K7EB 3K4QA 2PY6A 1VLVA 2ATCA 1TVKB 4LJ5A 1QCCA 2VDWA 4BNMA 5LP6F 4B7UA 2O3JA 1TJYA 4MB0A 5J9FA 3IAUA 3O8NA 2YHAA 4Q19A 5FUWA 1Z7YA 2QR3A 3MTQA 5DP2A 5EZQA 2C4VA 3MRSA 3IQXA 4QDXA 1ZUWA 4XLZA 3FYDA 4YCNA 3KOYA 4QASA 3U9LA 1MD9A 3DAYA 3OTWA 3V7WA 4H7JA 5T8KC 1ENZA 4LV5B 1R0KA 1RHUA 3R5HA 4LHVA 3UB4A 3HKDB 3PXEA 1ZD9A 2YDYA 4R0VA 3GXBA 4AXBA 4C7KA 2VK4A 4ZZ3A 3OPQA 3FPHA 4PF1A 4H7DA 3D0OA 4UNQA 3GLFA 3QY9A 3MTBA 2P7HA 1DIBA 1E2NA 2AGVA 2BMVA 2O8NA 5GVSA 3STWA 3IGFA 2X8JB 1Q0ZA 3H7AA 1FE8A 3FWYA 4R1QA 1GVNB 1MOPA 4I2VA 1GGHA 4X6LA 2NTYC 4DUPA 1G8SA 1KZ6A 5KWSA 4A6EA 1A88A 3SX4A 3W2TA 1QKIA 3JQFC 4PFKA 3P9XA 1YJQA 2C94A 1JSLA 2VHVA 5JV5A 3U44A 2NACA 1HEYA 4D8TA 5IDXA 4HLUC 3NC0C 1KY5A 1ZI6A 5TJHA 3STYA 3TH5A 1GOTA 4I4CA 4CM9D 2G82A 2OE2A 1IQ0A 2QVGA 3EEQA 4IJQA 2XI4A 5FI5A 4ZV9A 5A9TA 4B6FA 5K0BA 5JADA 3COWA 3MD0A 4ZDWA 3IE0A 4CIXA 4CMIB 1OI2A 3X1MA 5ALOA 3K6JA 4OYHA 5JZ9A 2O59A 2ISQA 2KPOA 2ZRFA 3I04M 2BWJA 1CD5A 5B30A 3RTBA 1XTRA 1LPNA 2MSKA 3MWDA 2YC2C 4QX6A 3PS9A 3LNCA 3FCUB 5D85A 1TYCA 1X1QA 2C2ZA 3H4MA 4ER0A 1G19A 4NZPA 1VPWA 3V4ZA 1P1BA 1H2YA 2Q2QA 2ZBGA 1SQ0A 4YQYA 3QMVA 1YHYA 3HJRA 4LOIA 4QVIA 4MUHA 1PUJA 5JD5A 1Y0BA 3HFRA 3K0BA 4OFXA 1QZTA 2XUHA 3CZAA 3HCRA 3LJKA 5HEKA 4DMHA 1AB6A 5FWDA 4KQXA 4XWKA 5HIAA 4OA8A 1LX7A 3H9UA 2G4VA 4BEVA 3C7DB 1P5FA 3GQBA 4G0UA 2ZB3A 3ONDA 3LYAA 2GEFA 3QVGB 3KLMX 1GFSA 3AHIA 1DJQA 4Y98A 3H5NA 4XR9A 4IFBA 2OK7A 3N53A 2B9EA 1VGRA 1LZLA 1IEQA 3MGBA 2Z2IA 2WIAA 3AIKA 2CBXA 3PHGA 4WOPA 3SAJA 1V7PC 1RAHA 4DSNA 4R71A 5DXAA 1TM3E 4QTTB 4WWHA 3QJYA 3VVLA 4GKJB 2YVKA 1SBZA 2BL4A 1Z13A 2P0EA 3EVCA 1W93A 3R1IA 3ACBA 1E3WA 2REQB 3G0OA 4GYWA 3KYJB 1P74A 2GFHA 2PWAA 4BLRA 1VPLA 3QPWA 1W1WA 2HMVA 3HM2A 4RS4A 2G8NA 1Q0RA 1WJGA 4UHEA 2Z2XA 4PRLA 4UUBA 5E8JA 3TJZA 4DQVA 2IYNA 4GX1A 4XFKA 2JPDA 2NT3A 3G9XA 3IMKA 3JWGA 2N0SA 3MT9A 4GOJA 4TGLA 5JY1A 2RCNA 4XM1A 3VFDA 4P86A 3Q0TA 4RCVA 4Z99A 5BUQA 2QTTA 2YHUA 4KAAA 3MYRA 2PH7A 1RHJA 4TRNA 4C6TA 2VUTA 4YMGA 2Q8QA 2V7TA 3EXEA 2ZI9A 3HKBA 4JCOA 5JS8A 5LQRA 1Z6AA 1TO1E 5HG0A 3ZWWA 2GFQA 721PA 1SXGA 1N6IA 2CMKA 3N2ZB 1RR6A 5C8YB 2WP8J 3PNPA 1L1FA 4BBZA 1LDYA 4EUHA 1FQWA 1G55A 1P4RA 3KR0A 3OY7A 1R10A 3TQFA 2I54A 3ISVA 4FN4A 2JKZA 4V24A 2G9UA 5JSKA 1G3MA 1J7JA 1B23P 5EPUA 3VMFA 3WXMA 5GONF 1PUIA 2BGTA 2R66A 1FDUA 3DYBA 3HWX1 4EG8A 4RFSB 2RK4A 3E2PA 4Y7CA 4EB6A 3UMSA 4U3JA 1IQPA 1Z0FA 5BRAA 1NW5A 2E87A 3PR3A 4D9NA 3MQ4A 3IXLA 5JZBA 2XRZA 1NBME 3QMPA 2J3MA 3NEJA 1M2JA 4YUZA 4TROA 2GI4A 1ZM3A 3HB0A 1A72A 5EE3A 3GXOA 3IRUA 1MXFA 2K5UA 4NQZA 3ND8A 4C0JA 1ZOSA 1VG0B 3VPAA 4EATA 4YMIA 2B37A 3DCYA 1JHYA 3G8DA 3DT9A 1XXHB 2I4LA 5GINE 1SXJD 3HO8A 3H84A 3GLHB 3VZBA 1U3UA 4OJQA 5AVYA 3D1JA 5C53B 1TCAA 2YTZA 4I6JA 4DT1B 5F64A 4CKWA 3CKKA 2NV2B 2ZJ5A 4OUDA 2F00A 4OREX 2D2XA 3IUPA 5IH7A 1JT2A 3ETLA 2ACWA 3QLUA 3L18A 3OEED 3T1NA 3IBTA 2LGJA 1G60A 3Q85A 2M32A 4HEA6 4IEIA 4BE4A 4EHKA 3THXB 2SCUB 3BE5A 1HO3A 2ZRDA 2Y1OA 3WB1A 2NYVA 2FZVA 1G6OA 3K72B 4B0OA 4ML3A 5ALJA 1F2TA 3TTSA 3ZQJA 3OAAA 2O2DA 1MIOB 3L05A 4ZMSA 4KR2A 3WIOA 1DELA 4KVZA 4WSOA 3B5JA 4ARSA 1DIGA 1RI5A 3UO8B 3L4KA 2UZIR 4YJ3A 3P4YA 4PLYA 2EKBA 1GPYA 1RRPA 3MUNA 1SBIA 1UC4B 2DGDA 2Q5FA 3EGCA 1FJXA 3Q8XB 3IE1A 4IIJA 1G5IA 3H1TA 1N3LA 4RLHA 5CEFA 5JDIA 3QW2A 2IEDA 3DF7A 3M8KA 5I9BA 1E7SA 2WICA 1RVV1 4URXR 2VRCA 1K8ZB 3DO8A 4JLAA 2QORA 3C6ZA 3HVUA 2VPXA 3B1YA 3CC8A 3ET4A 3KZVA 5ELLA 2XMSA 1K92A 2VCEA 4U5XA 2Y71A 5J2UA 3FTQA 3X2SA 3A9UA 4WLUA 4MQ6A 2QV0A 4FNOA 1FUUA 4FZVA 4KSCA 5KHLB 4MV3A 5M34A 1WEKA 3QNMA 3R5KA 4C87A 2XT9A 3U3XA 1O5TA 3B1WA 1SC1A 4W1QA 3HY6A 2GHTA 4IS3A 1BHSA 1JLMA 1U3VA 2L42A 4MITA 4O0MA 3TEMA 5KS2A 3R7LA 3CLUD 5CW2A 3L43A 5BSRA 2VNAA 1VKHA 4NPCA 5EHZA 3HO6A 1UMDB 3BPSA 2WA1A 1Q0LA 3HA5A 3G7NA 3PDIB 1COZA 4KRGA 4X66B 3V1YA 5JBNA 1IVSA 3IESA 2G07A 3IR5A 4V0RA 4PG8A 1ISRA 1XJCA 4R68A 3MRVA 3I83A 3WQHA 3NT5A 2Q4RA 1CJCA 1P9RA 3PC7A 2YIDA 1M75A 4PZDA 4WPGA 1W4AA 4OI1A 1EVZA 5FOTA 2QMQA 5M3BA 1T2UA 3M6LA 2OXFA 1N9GA 1UFRA 1Y9AA 1AK2A 1R0RE 4OKNA 4HTFB 4L9RA 3RC2A 2J3IA 4E94A 4L8YA 2IZ1A 1BGXT 3CNNA 4BUJA 4D9IA 4B3CA 2JW5A 1M1YA 1DCTA 4U1RA 1BVUA 1NPYA 1GGFA 1C1DA 2WF7A 3PHCA 5F4ZA 3UJ8A 1TUEA 5IUJC 1UKCA 1KY3A 2AFHE 2QUAA 3PUHA 1N77A 5KVAA 2VWGA 2AZDA 4FHCA 5DFAA 5IN5A 1DG9A 4YROA 1O08A 5FR2A 5G2OA 3ZE9A 3IJPA 1RFGE 3UAXA 4KQHA 1U8EA 4J0IA 4DYHA 5D5QA 4DPKA 1NRIA 3E05A 1IWPB 1MVLA 2XLBA 3D3WB 4FD3A 2RGRA 2GYVA 1O03A 2P9QA 4W5JA 1I0IA 3P1JA 2JFUA 2YHBA 1GPBA 4H6VA 4X54A 5HPYB 4TRJA 3PZRA 4HRXA 1TUBA 3G82C 3TUIC 1QK5A 2PVSA 4FOSA 3FVRA 1PJTA 3CNHA 4E2YA 4YUXA 3OZIA 4K8OA 3T3NA 5JY6A 4CPDA 1EE9A 4NXMB 1AKUA 1JSRA 4QUBA 2AFIE 2CY0A 4DPMA 1JN0A 3AERB 2WYIA 4BGDA 1E3TA 2HFJA 1BA2A 3UPTA 3THRA 1ORHA 1ZD2P 4FYYA 3CEJA 4B8ZA 4LF4B 3OT4A 4H4DA 2P9HA 5CXSA 3ZDQA 3OJXA 5FTNA 1TZJA 4Y0AA 3LYUA 4O2AB 4TV9A 1MP0A 3PJDA 3H19A 3ZS8A 1P1JA 5FOVA 2A1UB 2H63A 2XWSA 3ZLTA 1NHWA 5DK4A 5SV2A 5T4HA 4GVLA 2F59A 1T2FA 2SKCA 1XB2A 3RYTC 2CSUA 3TCKA 1NN3A 3B2QA 4QFDA 3U1TA 6Q21A 3NHAA 5GOZA 3BMOA 1ZCBA 2AYZA 2YIMA 4U7TB 4LOHA 3UOWA 4Z51A 3D3NA 4KI7A 4IV8A 1V9LA 1XL1A 2OBXA 1X7XB 1I7LA 2QTRA 1JR3A 1YIAA 3ZG6A 4DG9A 2D3WA 2WE8A 2WHRA 1F4LA 2POCA 3LBFA 4BMYA 1OJ7A 2F1KA 2R96A 2F7SA 3MOSA 4X97A 1XQXA 5TMBA 2OC4A 3MUEA 3SHQA 1W47A 3VNBA 5FTLA 2G0TA 2HRZA 1YBHA 3AR5A 1KQ3A 1BFKA 1XKQA 3OZEA 3QYAA 4O4LA 1TKBA 1SD2A 4D1YA 4KQWA 3EPHA 2GN4A 4FYWA 3IEPA 3ZCQA 1T9BA 3NHBA 4CHTA 1ENPA 2ZRNA 3PRKE 1VMKA 4OX9Y 3QUQA 5GZ1A 4BC1A 2DWOA 4B40A 1KSFX 5HGJA 5AVJA 5AKGA 1VJRA 1W5SA 2V8OA 3FX2A 3IURA 4TMVA 4BLQA 4OGFA 1IOVA 2QGFA 1DXOA 2XF8A 2HSZA 2QW8A 2R7NA 3IVMA 4JT4A 3RIGA 4F93B 4KSYA 3WRYC 3VPCA 3GI1A 4D9HA 1YKFA 4FFDA 2BFCA 3R6GA 4ITUA 3AH8A 4M0KA 5J2TF 3FPLA 3QPDA 5A4IS 1I2BA 1PYGA 3BSYA 1IG3A 4P1ZA 3SJZA 2RI6A 5B7NA 4JZKA 1TJ5A 3KD3A 4JJFA 4RO0A 5FAXA 3FTDA 5KB3A 4GOXA 1NUUA 2XB6A 4Y9RA 1TADA 3JARB 1Z2DA 4DLWA 4NE7A 5CA0F 1IZZA 1NOJA 3DFZA 5F51A 2X4LA 2YWGA 2CHQA 2CNDA 4P0TA 4TT3A 4WIAA 3K0SA 2FQXA 2HO5A 2OCDA 4N0MA 3TGPA 4I5IA 3AOEA 3L7JA 4X7MA 1HETA 1LJUA 2DKFA 3KPVA 3RFFA 4R2WA 2D0OB 4UBLA 3VX3A 3ZKWA 5EHIA 3K1ZA 2JHCA 4QXMA 1WUJS 4RE5A 4V38A 4EI8A 5EKUA 1X80A 3EWAA 3IO3A 2VJPA 1T8UA 4O4IB 1SR8A 2V9CA 5IUKC 3D8HA 3SFVA 4WNYA 4AU1A 3AP2A 4XFDA 1IRXA 1LFAA 2Q8NA 4EJFA 4MS3B 5FKJA 4Q4LA 3R8CA 1XCGB 3TOXA 2JJ2D 5FWYB 5LLSA 3O8LA 4ZT2A 4LZPA 1OBOA 2PVPA 5JNLA 2XEXA 5KIAA 2WWGA 4KE6A 5EXEA 2OV2A 1T9AA 1EUDB 4DA8A 4HWSA 1U8UA 5A3QA 2OENG 2EYQA 2RGBA 2XT6A 3KELA 3P7MA 3T9FA 4TKVA 1D03A 2V7XA 5G53C 3ESXA 4P5DA 5ERXA 5H83A 4BZXA 5JARA 1QTIA 5EJEA 2HDNB 3SFZA 2FX3A 5B58C 1HF3A 3VJRA 4EUEA 5JYDA 3BXZA 2PUEA 3BF7A 2DWCA 1Z3CA 2WJHA 4UEKA 3UV6A 4PIPA 3QWBA 2JCVA 4K9RA 3DMYA 1CZNA 1B43A 4GG1A 4HWKA 2ZDHA 3PHBE 3C98A 1P8AA 1UIRA 3H2GA 4J90A 3UUWA 4IDGA 1U0EA 2R11A 2V3VA 4UU7A 4UASA 5KNDD 1W52X 3U4CA 3TECE 3G8YA 1DWQA 1U3FA 4JC5A 3FR8A 1NP6A 3ZU3A 4EHIA 3UJNA 3H9JA 3TNJA 1OH8A 2BTQB 3K9CA 4ZTZB 1U9IA 2YQ4A 3Q12A 2PPVA 4FYVA 4A0HA 5LXTF 4DJDC 4TS3A 2OGSA 4M76B 2G1AA 1BQ3A 4IOMA 5EQTA 4EM6A 3SEZA 2YZ7A 1QNFA 2GVDC 3C24A 1QQBA 2VXBA 1JFVA 2YWHA 3MCUA 4NFYA 4RL4A 5BNWA 4OFBA 4GC5A 3HXKA 3LRPA 2V6BA 3SC2A 3VZQA 2PX2A 4YRBA 4AJKA 5T4BA 1RRVA 2XCUA 3OE1A 5C52B 1PLLA 1CYEA 2D8AA 4MROA 1R6TA 3NYWA 2QRMA 4HGPA 1JDJA 1EJ6A 1P1KA 2EEZA 3GY0A 3QITA 4JIMA 3V8BA 5JNVA 2KBFA 2PN1A 5IVIA 2J07A 5CRIA 3D5EA 2HZ7A 3FCYA 2REOA 4BP8A 1E8NA 2I4MA 3HGMA 3PJFA 1HA3A 4XJXA 3KALA 4IJ6A 3EQ9A 1G2IA 5F3RA 2FWNA 1MIHA 2FKNA 5EHGA 4BBAA 4DWJA 3GAMA 2CL6X 2I4RA 3G85A 2PT6A 1MENA 3L7NA 4JJ8A 4ZT6A 4HNUA 1VJDA 5J58A 4F45A 1TJ3A 2EW8A 4E5YA 4Q3DA 5JQGA 1WXHA 2AD5A 3NW9A 4RXMA 4ZVUA 3IT1A 1GL9B 4J4BA 2AOXA 5BT8A 4DZTA 4UHHA 2JL1A 2WHQA 2FFRA 3HRKA 1A8HA 1CNFA 3DZGA 3E9CA 4ISBA 4CDMA 1YS1X 5I8PA 1KXZA 1T8SA 1V1RB 3EF0A 3HL4A 3BT7A 4LVCA 2JVKA 4NS4A 1T5IA 4W5NA 4KYTA 5K0LA 3R20A 5A1TA 1PGQA 1HNWB 4AUNA 2XUKA 5C51B 5FPPA 3W4JA 1NVVR 3EG9B 4OMFG 3RBVA 2PD4A 2XWBF 3L0CA 4TKUB 1THZA 4DPLA 4A82A 4LNHA 3ISJA 4LRXA 4ZK6A 8LDHA 3MOGA 1E1QD 3CX8A 3ZHRA 3I1JA 4GE0A 2ADMA 2ZKLA 1DAPA 3FCOA 3BA1A 4QSMA 3MXTA 5IK2D 1KARA 1JHOA 1RBMA 1SIBE 2OESA 4PSKA 2PKEA 5TF4A 1V8OA 2GWHA 2AHRA 1Y8CA 3WLIA 4B84A 4S1WA 2ZJ3A 3DBHB 3KZKA 2AJDA 2P6PA 2ZTLA 3OTQA 1PG0A 3QPCA 4GZ5A 4UTVA 5HS4A 1AV6A 1SPXA 1K86A 1W4CA 1TM1E 3H5AA 5CG2A 3TLYA 1WDLA 1TUGA 2CXHA 4G0QA 2D5LA 5J4HA 1KZGB 1X19A 3PTZA 4XYBA 3SVLA 2NAFA 1SBNE 2G4CA 3ZBPA 1Y1QA 3PFGA 2C7RA 3PUWA 4QGSA 3KOZA 2X7HA 3KNZA 1K5DA 4MARA 1N1DA 1ZM2A 1RWMA 2C4HA 4ZDJA 3O95A 3GUUA 1OAOA 2X9GA 4R69A 2C58A 1TZKA 2OBNA 2QP3A 2OCGA 3WGIA 2DQZA 1EVQA 3THYB 1F2DA 2M6RA 2NYAA 2HSWA 1IEXA 1KPIA 1UC9A 4CMHA 1Y9DA 1TMKA 2WIGA 2IHNA 2QZ9A 5TGDA 4WLEA 2Y76A 2NZUG 3BG5A 5LQAA 2XNDA 2G28A 2XXBA 3H1AA 3W05A 1SD5A 3OETA 5IZ4A 3ZDDA 1XZLA 1GZ6A 1LSUA 1VKJA 1PJ2A 4RIIA 4GBJA 1YMVA 3EBOA 4IAOA 2GXAA 3K0EA 2C5HA 3A11A 2XYVA 4H0NA 1LBEA 3B6KA 3DMRA 3QVXA 1LRLA 1II8B 2WSMA 5KWEA 5LQKA 4B4OA 4UZFA 2BFFA 1ZX1A 2ZP1A 1T2DA 4EY5A 3I2YX 3LYLA 1JLHA 2QVXX 3QXSA 1N0VC 5L3VA 3TNYA 4WLFA 4WE3A 2YCLA 5IT4A 2UZ4A 4LXTA 3FRJA 1O4VA 1WUKS 3E58A 4WFJA 3JTEA 2HSEA 1QV9A 2XY4A 4RA6B 4HVTA 4CFZA 4ZVLA 1D4AA 1MABB 1UQRA 1NPTO 2VJMA 1JILA 1WY5A 1IPHA 1E6MA 1KEUA 2NO6A 1E9RA 1Z62A 4NH0A 2ZVDA 3IXQA 3GVPA 1FSSA 1WMAA 3PC8A 4JLPA 3V4OA 1IUPA 2B2XA 3JSAA 2XE6A 3DB1A 4TM7A 3IQIX 1ZMBA 1CNEA 1IHXA 4MQUA 2QJFA 3L6CA 3E3NA 3BB1A 5AOVA 1VL1A