4OAQA

Crystal structure of the r-specific carbonyl reductase from candida parapsilosis atcc 7330
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
KAVPDKFQGFAVSDPKNWNRPKLASYERKQINPHDVVLKNEVCGLCYSDIHTLSAGWQPLQRDNLVVGHEIIGEVIAVGDEVTEFKVGDRVGIGAASSSCRSCQRCDSDNEQYCKQGAATYNSKDVRSNNYVTQGGYSSHSIADEKFVFAIPEDLPSSYGAPLMCAGITVFSPLIRNLGLDARGKNVGIIGIGGLGHLALQFANAMGANVTAFSRSSSKKEQAMKLGAHDFVATGEDKTWYKNYDDHFDFILNCASGIDGLNLSEYLSTLKVDKKFVSVGLPPSEDKFEVSPFTFLQQGASFGSSLLGSKTEVKEMLNLAAKHNVRPMIEEVPISEENCAKALDRCHAGDVRYRFVFTDFDKAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the stereoselectivity of R-specific Carbonyl Reductase from Candida parapsilosis ATCC 7330: Biochemical Characterization and Crystal structure studies
rcsb
molecule keywords R-specific carbonyl reductase
molecule tags Oxidoreductase
source organism Candida parapsilosis
total genus 121
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4oaqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4oaqA01
4JN6B 2OHXA 1O95A 3Q11A 3SC6A 1DJQA 4GBJA 1EE9A 5A03A 3H9EO 1GQQA 3JQDA 3OETA 1A72A 2Z5LA 1ZNQO 3M6IA 2ZCUA 4D0RA 3RUHA 1O9BA 1BXZA 2Q1UA 1JTVA 1GADO 2O2YA 4ZN6A 3NGXA 3EUWA 3KLPX 3PWKA 4YEDA 2BELA 5JCXA 1VJTA 5F5LA 1P1HA 3B1FA 3SBOA 4WLFA 2EF1A 4UVDA 5ER9A 2W98A 1DHRA 4ZQBA 5I8ZA 1JKFA 1U7HA 1IZ0A 4DL9A 4E2ZA 3ZWXA 3QLJA 3AY6A 3SX2A 5JAMA 2D4AA 2AHRA 3LT2A 2J5KA 5LDGA 4EZBA 3ASVA 3F3SA 2NTJA 4U0JA 4RORA 3M2PA 1M75A 1E7RA 4CR8A 3AFMA 3JQBA 4AJKA 5TLSA 5LC1A 5IN4A 5KCZA 4D45A 2CVOA 2FN7A 4Z0HO 4NU5A 4RGBA 3DOJA 3QIVA 1PS8A 1Z7BA 1LSSA 2HLPA 2GZ3A 3AFNA 3ORFA 2DFVA 1E1NA 3CE6A 4LRSB 2B35A 4I9HA 4J7XA 4XRRA 4NDNE 1HYHA 2P4QA 4GLOA 3WQRA 4E5YA 1RM0A 3PXXA 5C7IO 3KBOA 3WOHA 1ZFNA 5G0SA 1PTJA 1ULSA 3GPDG 1FDWA 3WGHA 1UXKA 1WPQA 1ZO8A 2EJWA 4YQYA 3PGJA 4BO3A 3RCBA 3S2FA 1H0KA 1HYEA 1P77A 3GZ4A 1WMBA 2I66A 1GEEA 5L45A 1RKXA 2QRKA 1J4AA 3QV1A 1HEUA 1FDSA 3SLGA 3COSA 3HE3A 4XYBA 5GMOA 3UHAA 1DRWA 1V9LA 2X9NA 2CDBA 5EL0A 5IG2A 1ZK3A 2FSSA 1LUAA 4GSLA 4Z0PA 4CUJA 3B20A 4BNFA 4CMKA 3P5SA 4BQPA 2BGMA 1TT7A 5F5NA 4MDHA 4F46A 3PJFA 1AUPA 4RVHA 1WAMA 2IZ1A 3Q2IA 3ZWYA 4A10A 4BO0A 1T24A 3KOUA 2X0IA 2Q2VA 3P2OA 4WUVA 2B4QA 1R0LA 2DKNA 4ROSA 3HHPA 1YVEI 1Y8QB 3EZYA 4WLOA 2DTEA 2QRJA 2NU7A 1D1SA 2G1UA 1CIVA 1EUDA 4ND5A 3P19A 1U7TA 2V7PA 2E82A 4BNYA 5KJ1A 1PJBA 1Y8QA 1ZH8A 2GPTA 4EW6A 4UREA 5DULA 3VVCA 2JAHA 4R3NA 1K0UA 4EYEA 3ZZNA 1LU9A 2D59A 3GRKA 3HZZA 4AJHA 4W99A 1U2DA 1I32A 3GG2A 2EKQA 2ZTLA 2GASA 1UXIA 2P5UA 2JHFA 1M6HA 2IEDA 1LLQA 3I9KA 3JQ6A 2YFHA 1KYQA 1BXGB 1ML3A 2Q46A 3KYCB 2W8ZA 3I9OA 3VVBA 5EINA 3ZDFA 4RLSA 3ADOA 1T2DA 2FZWA 4P4GA 3DTYA 4Z9XA 4MO2A 1BXGA 4IJUA 1JVBA 2WWRA 3VZRA 5JFOA 4J4BA 5B1YA 5FWNA 5HA5A 1ZJZA 3H3FA 3WQSB 4BKRA 4K28A 4OKNA 3OM9A 2E4AA 4L8VA 5TT1A 3R1IA 6LDHA 4DRYA 2DPGA 1V8BA 4BNJA 5K1SA 3WFJA 5B4VA 3TFQA 4YWJA 1LRKA 1PJLA 2DC1A 3PVZA 4I9UA 1Z45A 4BO8A 1JN0A 1O6ZA 4HNGA 4ONEA 4XYMA 1T2EA 3VPXA 3AM3A 4EBFA 2OP1A 3OQ1A 3QWIA 3OA0A 1KS9A 1LDMA 4MVJP 3Q3CA 4IQGA 5G0TA 2YUTA 1A9YA 2HJRA 3SVTA 4KTVE 3OIFA 1A4UA 2X5JO 4LN1A 1YO6A 3L9XA 4GAEA 4N18A 3JD1A 3ZU3A 2ZK7A 4FJ1A 4FSHA 5L3ZA 3DZIA 2B4TO 3AWDA 4R1TA 1GU7A 1YL6A 5G0UA 1OMOA 3ITDA 1WZIA 3ONFA 1E7QA 4HWKA 4J4HA 3GG9A 1K5HA 3ZI0A 1YJQA 1I3LA 2OP0A 5A06A 5BSHA 5L7TA 3A9WA 2AQHA 2ZYAA 4YAEA 3ROPA 3WGZA 4BOYA 4NBRA 1MP0A 2YDXA 1AXEA 3MJSA 2VN8A 3GHHA 4Z6KA 4TZTA 4BIIA 2PV7A 2AXQA 3H9QA 3MJ4A 1NVMB 4UAGA 3U09A 1P33A 2EIHA 5ILOA 2ZKLA 2PZMA 1ONNA 2C20A 2G5CA 1IZ9A 3VOSA 2AE2A 3VPGA 4HY3A 3F5SA 4A26A 4CM8B 1LRJA 1EFKA 1LBEA 1R15A 4XQCA 1ENYA 5ILGA 3SC4A 3V2HA 3PQEA 2O3RA 2OZPA 3W8EA 1YL5A 3OQBA 4O0LA 2JD0A 4L4RA 3KYDA 4I08A 4CODB 3CMCO 4CM8A 3FNFA 3DQPA 3JTMA 2PGJA 4CM4B 2PFGA 3WGYA 3EAGA 1DDOA 1FMCA 1F8GA 5JNLA 3KM0A 3WDSA 3G3EA 1QLHA 2GUGA 1GPDG 4S3MA 4GI2A 4CM4A 2RH4A 4XRGA 1E6UA 4O63O 5I9MA 3HWRA 4HBGA 3RKUA 5IDWA 1IE3A 4IY1A 4L74A 5EERA 4DA9A 4DIOA 5HS4A 4GGOA 1X7DA 3GZNA 2OBNA 4Q3NA 1CDOA 4XR4A 4RF4A 4BS9A 3IAHA 3OBBA 3NRCA 5HS6A 4OSOA 3C24A 1PL6A 2GRAA 3RIHA 3G17A 4BGVA 2Y67A 3A06A 1R16A 1N92A 3WJAA 1I0ZA 1M6WA 2Z1MA 3OJLA 4A2CA 5CP8A 1E1KA 4BO6A 1I01A 2J5RA 3IIEA 4DIFA 3C7CB 5TF4A 1YGYA 2Z1NA 2TMDA 1LDNA 4MVJF 4NMHA 5IJZA 1K2WA 3ICCA 1YB5A 1Y5MA 1PIWA 2VYNA 2X4GA 3LK7A 2DBZA 3P7MA 1X7HA 1E0DA 4MIOA 1YOVA 3C1TA 2UV8A 4CLOB 1LLCA 4DQUA 3DZGA 4INAA 4OXYA 1I8TA 1YDWA 2NADA 4L4XA 5FI5A 3Q6IA 2DTDA 4CLOA 4GQAA 4O1MA 3LC7O 1KVSA 1MFPA 1YQDA 3DBLB 4J4TA 4QEDA 1DXYA 2DM6A 3QVTA 2Q1WA 1UZNA 4RL6A 4E12A 4J49A 1TT5B 3PRJA 4E3ZA 1YL7A 3CSDA 2VHZA 3EC7A 5CDYA 4RVFA 1E6WA 4E2WA 1TT5A 3ZU5A 3OICA 3GN2A 2X8LA 2HUNA 1LA2A 1PZEA 4IUYA 1YQXA 2AE1A 1VC2A 5TIIA 2V6BA 4L9RA 1ZKMA 5HRUA 2ZQZA 2GGSA 1GTMA 4K1LA 2CDAA 4MP3A 2CDCA 4GMGA 3O4RA 4J3FA 3AU9A 4EITA 5DF1A 1EDZA 3C3XA 4Q3DA 3MCVA 4NH4A 3TZ6A 4A27A 4RDIA 1IB6A 3TJRA 4OXKA 5ICMA 5K6AA 2AQKA 1HZZA 2EKLA 1ENOA 5B12A 3JQ7A 4BO7A 2VCYA 3CZMA 4J91A 1U3VA 3LC2O 1ZZEA 5F1PA 5H82A 2ZQYA 4YTEA 3LZ6A 3PFFA 2VRBA 5TX7A 4URFA 2C07A 2CY0A 1L1FA 2YV2A 5IF3A 4IQ8A 3AK4A 1E7SA 4D0SA 3GUYA 3OFSA 4ZQGA 4DXHA 5IDQA 1K89A 2C7GA 1R4MA 3H4VA 3R6DA 4YDRA 2QHXA 4B79A 5CDTA 2DPHA 3F4BA 3H6KA 1QYWA 4BNHA 3ZHZA 1HLPA 2NVWA 2W2KB 4KUHA 1X0VA 5I8WA 3CXRA 4XB2A 3ZW8A 5EJ2A 2HRBA 4FIZA 1JW9B 3I23A 2YYYA 5BNFA 2G17A 2D5CA 2W2KA 4Y6RA 1FJHA 3GEMA 4CQMD 5BNIA 5JAZA 3L6DA 1I3MA 4FR5A 1ISFA 4E31A 3H2SA 3GGPA 5CAEA 4G81A 1IHXA 4AG3A 4CLRB 1Q1NA 3H5RA 1KEWA 4PLVA 3EVTA 3H8VA 4LK3A 4M87A 4K6FA 4IMRA 1P31A 4M49A 2UUPA 2V6FA 1KC1A 2IYOA 4NBVA 3CUKA 4WECA 4CLRA 1FF9A 3KYBA 2Q4EA 3EMKA 1XLTA 4LGVA 3E9MA 4IINA 5FEUA 2JHGA 5TGDA 3WJ7A 2V6GA 3PI7A 4N5NA 4TVBA 5K9ZA 4BNGA 2OL4A 2CMDA 3WYEA 2Y05A 4R1NA 4IM7A 4JBHA 5DNAA 4XJTA 1PX0A 2EJVA 2BFMA 3TZHA 5A5FA 2O3UA 2GSDA 1TB4A 1ZIDA 3OEYA 1FDVA 1SEPA 1U8XX 2EG9A 2ZJ0A 2VYVD 4YAGA 1MXFA 3E48A 1P9LA 1EE2A 1I5RA 4U7WA 1DIRA 5TS3A 3ZHBA 2X9VA 3LF2A 1GFSA 3H9JA 4D7AA 4L73A 1BVRA 2PNFA 2EV9A 1UR5A 4IDBA 3AUAA 2IDZA 3A14A 3BMNA 3MJVA 4Y8VA 4H15A 5DP1A 4JLWA 1J5PA 4BGIA 1Q0QA 4AJLA 5EESA 2H63A 2HSDA 5G4KB 4B7XA 1LTHR 3FNHA 4IDFA 4BKQA 5FI3A 1D3AA 3BTUA 5A02A 1JA9A 4OOFA 3UCEA 3LU1A 3INTA 1EVIA 5G4KA 3WMXA 4II3A 3BMOA 1ISHA 1NFQA 1ZXLA 5L95A 5CPBA 7ADHA 2JD1A 3JQFA 1WXDA 3B1KA 3N58A 2H1SA 3RKRA 1C14A 4PLWA 4XEHA 1H2HA 3W8FA 3HQ4O 3KRTA 4Q3BA 1EK6A 1K6IA 4EJMA 1IYZA 4GX0A 3ROMA 3IP3A 4ND2A 3ZGYA 2Y1OA 1A7KA 1ZK1A 3MOIA 2PKQO 1E7YA 3MTGA 1C0IA 4R01A 1GR0A 1YE3A 2G82A 1BRMA 3PLRA 2I5PO 3ZWPA 2C5AA 1BW9A 1ONOA 4JX8A 3M1LA 1W6UA 4RF3A 2X58A 2WEKA 3LF1A 4O5OA 3DZKA 1SOWA 1SPXA 3PIIA 3K2EA 3ONDA 4A7PA 4XKJA 2PZKA 1SB8A 3NJ8A 3PYXA 1W0CA 3GEDA 2VOJA 1N1GA 4GVXA 3JQEA 4Z9YA 4HV4A 4QSMA 4JJGA 5CDSA 3E9NA 4HKTA 1HRDA 4NK5A 1B14A 4KQWA 4IS3A 2ZB3A 3SLKA 3WWZA 4NZ9A 4I5FA 4E32A 3A1NA 3FF4A 2FSVA 1C0PA 1VJ0A 1PL8A 3UVEA 1XELA 3L77A 4CR6A 4WEQA 5I7EA 3RFXA 2PKQP 3QW2A 2VNAA 4DC1A 4J9UE 3FN4A 2B83A 1TVEA 1V3UA 2B0JA 2DBQA 2IE0A 2JFFA 4U6SA 4CM9A 5CDGA 3I9MA 5A9TA 4LW8A 4UUNA 3WTBA 1U5CA 4EI2A 1I2CA 2GR9A 1O5IA 3KZVA 4IIVA 4K6CA 2PH3A 4BO2A 4DLLA 4R9SA 5CHEA 1DJNA 3ETDA 2EGGA 3L07A 1XDWA 1SMKA 2WTBA 4BNIA 3ABIA 4N5MA 4CMIB 1H6BA 3FI9A 3F1LA 2HMTA 2W90A 4XGIA 1OBFO 2X0RA 5L4NA 1R4NB 1UDBA 1LRLA 1N8KA 1ORRA 1PQWA 3RROA 4CMIA 3GDOA 3WGTA 1ZK2A 4AJOA 3GC6A 3EYWA 3BYZA 3UOGA 1R4NA 1UXHA 1T2CA 1NAIA 1QG6A 2NWQA 5JBIA 4LVCA 1B2LA 2HK9A 3U4HA 1G0NA 2VTEA 1W8DA 2OO5A 3TSCA 4OL9A 5JYDA 2P9GA 4XIYA 4J0FA 3C85A 5G0WA 3O26A 3UKOA 2JCYA 1PJ3A 2YQ4A 3DHYA 1E7MA 1HE2A 4ZA2A 4M86A 1LDGA 3BIOA 3D4NA 1T1SA 2BGKA 2NLOA 2CVQA 3EZLA 4G5HA 4ZRNA 2X0JA 3ZNQA 3BZUA 4B8ZA 2PZLA 2EKPA 1H2BA 3IP1A 3W4JA 2JKVA 3WBBA 4DPLA 4BNZA 4GX2A 1XG5A 1VL6A 2XAAA 3JYNA 5LDHA 2FR1A 3AUUA 1CERA 4J16A 2YZ7A 1F8FA 2BD0A 3PYMA 3QHAA 5IDYA 3E6AA 3ZWAA 1D8AA 1ZMOA 4DPMA 4BV8A 3S55A 4XDZA 4YQZA 4LSWA 1D7OA 4AFNA 4QFDA 4UVHA 4E6PA 1C3VA 3ENKA 5DCWA 4RJTA 2R2GA 4OO3A 4J43A 1PJQA 4RO0A 4WOKA 4OQYA 4J2OA 5ICSA 4TWRA 4OH1A 2LDBA 2GDZA 3S1LA 1PGQA 5HWSA 1VSUA 2RBEA 3LT4A 3OIGA 2H5LA 4FW8A 2YV1A 5F1OA 1MX3A 5T8KA 2NU6A 3STHA 4Y6PA 2OORA 1ZVMA 2QG4A 3AM5A 4UUOA 1E3SA 4Z3KA 1Q7BA 1DOHA 1YONA 2UYYA 1P44A 2DT5A 1U5AA 2ZTVA 5DBFA 3ZCXA 4ALLA 3ZWCA 3NTOA 4RPGA 3PHJA 3H3JA 3IL2A 4JBIA 4ALNA 4NIMA 3ROKA 3QY9A 3QWHA 1QMGA 3OIDA 3GVIA 1KOLA 3K92A 3DZHA 1HE3A 3DZFA 2GLXA 1NHGA 4CLEA 3BA1A 3DBHB 3EGOA 4PLCA 4LCJA 3W6ZA 3K8ZA 3AY7A 4DBZA 1SAYA 1B8UA 2YDYA 1OOEA 1PQPA 4KUEA 4QTZA 1CQIA 1YB4A 2Y0CA 3EHEA 3DZBA 4MVJM 1DFHA 4DQVA 1RWBA 2VT3A 4M8SA 4PVDA 5A3JA 4YPOA 1QRRA 3DBHA 2ZJ1A 4OQZA 5G4LA 1LX6A 3GRPA 1ISIA 2QQ5A 1OC2A 1MUUA 1GZ6A 3ZWBA 3DBRB 5L53A 2C0CA 4HP8A 5L7YA 3RBVA 3SXPA 5A3VA 5TC4A 1NHWA 3FD8A 3JQGB 3CIFA 4LISA 3RAJA 1YBAA 2AMFA 3W6UA 3ANMA 2G0TA 1QXSA 3NT5A 1R37A 1NTOA 3JQGA 5AXDA 3H9UA 3ZHXA 3AOGA 1F0YA 1ARZA 1IPEA 2X7HA 2BFOA 3IKTA 4R51A 2VQ3A 3I9LA 5L7WA 5I7SA 4RQTA 3D5QA 3M2TA 4ALMA 4WCFB 3UXYA 3ZWNA 1CF2O 2Y1DA 1EUCA 4UUMA 4LVUA 2HMUA 5CEJA 3JYLA 4Q39A 1V3TA 1F17A 3N7UA 3ZN2A 4HNHA 2NTNA 1A71A 3HDQA 1EBFA 1JQBA 4QECA 4WCFA 5HTOA 2C5EA 4BKUA 1LC3A 4X54A 8LDHA 2C82A 1KC3A 1PWZA 1EVYA 2VZ0A 5BNTA 4B3HA 4WLUA 1KVUA 4WE3A 4WOJA 1EQUA 4WASA 1I3NA 3E82A 2P68A 2TMGA 1HDRA 1PR9A 2PKRA 2BI7A 4IZIA 3JQ8B 4Y9DA 4WCDA 5T64A 3TL3A 1JU9A 1X7GA 3E5RA 4ILKA 1MV8A 1V35A 1MFZA 3D3WB 3VTZA 5DOVA 5C37A 2EHDA 1EVJA 3JQ8A 1NPDA 5AYVA 3BTSA 4IIUA 3MJCA 4RVGA 1MG0A 4N54A 1H6AA 1P1KA 3D3WA 1LNQA 2PK3A 2QZ9A 4IGEA 4E5KA 1MG5A 2GF2A 3I1JA 3ZV5A 1E3LA 1SEVA 4WEOA 3ONEA 4CM3A 4PRKA 2YHUA 1M66A 4FFPA 3NTRA 3ZW9A 4B7UA 5MGBA 1GEGA 2BF7A 4IPTA 1XQ1A 2NU9A 1IHYA 2ET6A 4TSKA 1PS9A 4LCEA 3FWZA 3GNTA 5BQFA 3KYCA 4CMCA 2WM3A 1GD1O 3H5NA 4R1SA 4R41A 2RCYA 5T67A 4MKRA 5JAQA 1GY8A 3UF0A 3BMQB 4HFRA 3Q9UA 1KVQA 4PCVA 3VH1A 4W7IA 3NX4A 3RASA 3RUIA 2J8ZA 1RYEA 2O4CA 2D1YA 4JJIA 1W73A 3RUDA 3QA9A 5TJHA 2X5KO 3ICPA 2Q3EA 2XXJA 4NI5A 4BKOA 5IFLA 2AEMA 1U4OA 4FFNA 4B4WA 5F21A 2Q4BA 1B15A 4PIVA 4Z9FA 1LLDA 4CQLB 1XEAA 1XCBA 2ZB7A 1VI2A 4IZHA 3UICA 4AJJA 3HNPA 1NQOA 4IDDA 4BL5A 5T8KC 2JD2A 4D42A 1Y9EA 1QKIA 2J3IA 3DHNA 3MEQA 4CQLA 2HO5A 4KDEA 3RU9A 2WYUA 4EEXA 2EXXA 2I3AA 3GGOA 5IXSA 4WLEA 1DB3A 4XYEA 4CM1A 4M1QA 4Z3DA 4YA6A 1GYPA 2JL1A 4L75A 4BNLA 3ZWVA 4PLFA 4GVLA 5COAA 4TRRA 2E48A 3RJ9A 3D4OA 3T7EA 4DIBA 4KZPA 2CZCA 1QR6A 3G1UA 3IS3A 4EJ0A 2CNBA 1U2GA 1KVRA 3NJ4A 4B4OA 4NFYA 3JQBC 5JDCA 3CTMA 3GF4A 4W7HA 2VWHA 4F6CA 2FMUA 3I4FA 5B4TA 3MJTA 1DC4A 2BMAA 3OH8A 4ITUA 3PJDA 2NVUB 2JFGA 3GVHA 1Z82A 4S1VA 4CMJA 1QYXA 3AOEA 1CYDA 2PGDA 3R0IA 1JWBB 4U5QA 5AXBA 1PL7A 1EEHA 4HFMA 2NVUA 1NQ5A 2HK7A 1L7EA 1A9ZA 5I7FA 4MINA 1JAXA 1U1IA 1KERA 2W2LA 2P4HX 3V1TC 2HKIA 1EUZA 1Y6JA 1QYDA 5HBRA 2Q2QA 2BGLA 4GX5A 3F5QA 1UXGA 3CH6A 3WX0A 1LSOA 4XZ3A 4PLTA 1PGJA 1U3UA 1AHHA 5IZ4A 2ZB4A 4I5EA 4JP3A 1HDOA 2CUKA 1P1RA 1VM6A 2F1KA 1NVGA 4E0BA 5KVQA 4XR9A 4D46A 5F3RA 1NR1A 2FY8A 5DBIA 3VZQA 4IJVA 3W4IA 4J7CA 4P4LA 3KTDA 1UXJA 2P5YA 2GN9A 3C1AA 4UEJA 3PEFA 3UCFA 4GMFA 3UH1A 2X23A 2Y99A 1KY4A 3I3OA 1BTOA 4WCFC 2D0IA 5T6BA 1FXSA 1LC0A 1B8VA 2WYVA 4NBWA 2E6UX 1N7GA 1Q0LA 1VL8A 1HE4A 2NVBA 3GNSA 4FFOA 2F00A 5COQA 4MPDA 5COBA 4NQZA 5JCJD 2PH5A 2PY6A 1XU9A 5MDHA 4OSPA 1HL3A 1ZK0A 3SEFA 4P22A 3ROQA 5CEFA 2D8AA 5FF9A 4ZGWA 4U6QA 4EGFA 3PQFA 3RJ5A 1BDBA 3U62A 2NV6A 3LQFA 1OC4A 4D79A 1ADCA 2BLLA 4WGGA 1KETA 3FBTA 4BO5A 2R00A 1GV1A 3TOXA 4CMAA 2PD3A 4II2A 2CD9A 9LDTA 2ILTA 2HMSA 3HDYA 4BNVA 1NBOA 2O23A 4IDEA 3DBLA 1XA0A 2Q2WA 3L0DA 4TRMA 5KIAA 3HN7A 3T4XA 2NQTA 4YXFA 4K26A 1DPGA 5KWEA 1B8PA 1HDGO 2C29D 4UEOA 4BO4A 3D5TA 1C1XB 2Q49A 2HRZA 1NXQA 4TRJA 5FFFA 1I30A 4OIMA 1BSVA 2Q1TA 4DMMA 4CQMB 1IOLA 3R3SA 1HDYA 4PZCA 2BI8A 3GVPA 1NWHA 1C1XA 1GV0A 3QP9A 4DBVO 1C0KA 4AICA 2B4RO 4FB5A 4XQ9A 2ZTMA 5L51A 4CQMA 4AJ1A 1ZMTA 2NSDA 2O50A 3CEAA 3JQ9A 2PZJA 4OKIA 1HTBA 1N2SA 1HDZA 2PA3A 3DC2A 3GLQA 1SBYA 4GGPA 1PJCA 1ZSNA 5I7VA 4BVAA 2V65A 4FC7A 1DBVO 1JDJA 3L4SO 5L4LA 4RVDA 1E1MA 4I5DA 4C4OA 4QFCA 1BGVA 2NACA 2O2SA 1Y9AA 4YJHB 1PU2A 4DWVA 1X1TA 3E8XA 4FFMA 3PDJA 5ADHA 4YAKA 1DHTA 3I6IA 1PZGA 3B6ZA 5ER6A 5CG1A 1QLJA 1T2AA 2DQ4A 1PJSA 4YJHA 1YQGA 4TRNA 1HKUA 5IZCA 2JAPA 4YYZA 3AW9A 1C0LA 2B69A 4ESOA 5AXCA 4HFNA 3FR8A 1CRWG 1GUZA 3NT4A 2VOEA 3JYOA 3OJ0A 2EW8A 1U9JA 1ZBQA 1WLYA 4I8XA 1HYGA 1E77A 2ZTUA 3WNQA 3BXXA 1IL0A 1GDHA 4J1TA 1BDMA 4BB6A 1GYRA 3PHLA 4RZIA 5JDCC 2Q1SA 3KSZO 2ZYDA 5U1PA 3BAZA 3ON5A 4I1IA 4YT5A 3T7CA 3TZCA 4ALKA 1KEVA 4YT4A 4YT2A 2ZB8A 4FQ8A 3RC2A 3HFSA 2FRDA 3B70A 3GMSA 5HM8A 1VLLA 1XYGA 2OXIA 3DL2A 2AEJA 4XIJA 5CEEA 5KVSA 3WGGA 4HX5A 3DHEA 3AOEC 1ZSYA 1HDXA 3PGXA 3V1UA 2W4QA 4OXNA 1ZSVA 3VDQA 4FGSA 2AQ8A 1ZEMA 4WNCA 2ZIZA 4FFLA 3U3XA 2QYSA 2VUSA 3E9QA 4O59O 4UVGA 2ZYGA 1H6CA 1DAPA 2D2IA 4NG5A 4YCAA 1ZJYA 1Q2XA 3CZRA 4NJMB 3WGQA 3HSKA 4CMEA 4P8RA 1QYCA 4KWIA 3WR5A 1TA4A 4FBGA 2J3KA 1NM5A 3V2GA 2Y0EA 4NJMA 5KKAA 4RQUA 4XB1A 1I10A 5GY7A 1NR7A 4WLNA 2YHIB 1GQYA 2IXAA 3VC7A 1J6UA 2IYPA 4W4TA 4MOWA 3GFBA 5JC8A 4KOAA 4D3FA 4RCVA 1LDEA 4PG5A 2I3GA 3H5AA 4J1QA 4NNJA 4MKZA 2VRCD 1Y8RB 2UDPA 4NBTA 3O03A 5C3MA 4JXKA 3PYLA 4AJNA 2P91A 3ZV3A 4PRLA 1O94A 4PLHA 3RFTA 4IXTA 2I76A 4BNUA 1Y8RA 3DR3A 4FGWA 4NJOA 5KTKA 4YRBA 1Q0HA 3BTOA 2BRUA 2GN6A 2UVDA 1NYTA 1GUFA 3WWYA 5A04A 4CM7A 3JSAA 4XDYA 1R12A 3R3JA 2D3TA 3VH3A 4ZU3A 1WZEA 2C2YA 1OFGA 4D3SA 4MVJH 3F46A 3U9LA 1WMAA 2R00C 4XGNA 5TQVA 2GZ1A 2Y1GA 4RF5A 4B4VA 1LI4A 1XU7A 3KEQA 4OJNA 4BNNA 1PZHA 4BKPA 3TF5A 5DBGA 2PD4A 1V3VA 1HSOA 2E37A 4NFHA 4MVJG 4YRDA 3ZU2A 1IPFA 3PIDA 4BO1A 1TXGA 4JQCA 2NQ8A 2JFHA 4CL8A 3HB4X 4IMPA 1GZ4A 1BXKA 4G2NA 2EERA 4GKBA 5KVVA 2WMDA 5DCUA 4PG6A 4BUCA 1P1IA 1KVTA 3I5MA 4GSKA 1NWCA 4Q9NA 1HT0A 4KDFA 5AXAA 3PLNA 3LYLA 3PJEA 2P2SA 2YY7A 1CEQA 2VHXA 4FJ0A 4NHEA 1H9BA 1YDEA 1Q7GA 1YS4A 3RUCA 4DREA 4YAIA 3EY4A 3I4CA 1PEDA 1SZJG 5K6AC 4CUKA 3FRJA 3K5PA 4NFSA 3TWOA 1QSGA 1KEUA 3AJRA 1PR3A 3S2IA 2CF5A 4OM8A 4EUHA 1CQJA 3WQQA 4MVJE 3LDHA 2DBVO 3U0BA 3I83A 3WNVA 4E5MA 1ZXBA 2Q45A 2YQ5A 3KLMX 3I9NA 4BNMA 4PLGA 1B0AA 3ZV6A 4Q3CA 1Y5RA 3C8MA 3PWZA 4LMRA 4PVCA 5C7LO 1U8FO 3ANNA 3GPIA 4F45A 3VH4A 4XWYA 4QXMA 4E30A 2Y1EA 4LSMA 2FPPA 4EEZA 3O8QB 5IXYA 3V1YA 2DLDA 1AE1A 1UH5A 2GCGA 5F1KA 1A7AA 5JW6A 2DBRA 4CMBA 4RPJA 3HG7A 3WGOA 4C7KA 2QYTA 1P1FA 3DB2A 4FOSA 4CV3A 3KB6A 1A4IA 2AG5A 1XKQA 4HUJA 3WLFA 1V0JA 3O8QA 4IDGA 4RDHA 4D43A 4ZQFA 1OI7A 2VWPA 3AU8A 1D1TA 2JJYA 1HZJA 2Z95A 5K0ZA 4UEKA 1YKFA 4U0KA 3GUCA 4DC0A 2H9IA 4XD2A 3OP4A 1CWUA 5T57A 5ITVA 3KHUA 1NFFA 4YJFB 2VZ8A 1X1EA 4DTIA 2G76A 5A9RA 2HDHA 3BHJA 3B1JA 5BSEA 5IAAA 1EQ2A 3VPFA 4BGEA 4YJFA 4JIGA 4WJZA 4EDFA 1E5LA 3LSYA 3VHRA 1IUKA 2DTXA 1XQ6A 2B36A 2HMVA 3JYQA 1JKJA 2EWMA 4UVEA 2EP5A 1UAGA 3P2YA 2VTDA 4GWGA 4XGKA 1N9GB 4Z0TA 5TT0A 5H83A 1YRLA 1NASA 3ZNNA 5BR7A 1T4BA 2NNLD 4OHUA 5T5QA 1E6EA 1N9GA 4CMEC 3GVCA 3IQDB 2B5VA 2PD6A 3VKVA 2NU8A 1UZMA 4GKVA 5JMPA 5GZ6A 3EVNA 4TMFA 3WYBA 1EBUA 2Q99A 3WG9A 2OBYA 3LLSA 4DVJA 3IUSA 4IDAA 4U8GA 3QWFA 4YRAA 4ZHSA 3G1TA 1VJ1A 2E49A 2VUUA 1WVGA 4J1NA 3WICA 1LEHA 4TKMA 4EJ6A 1P74A 3TPCA 1D4FA 5KJCA 1QYVA 3UFXA 1UP4A 1NPTO 1C1DB 1R0SA 5J23A 3GEGA 5KJFA 3NUGA 3I6QA 5A9SB 3S2GA 3L6EA 3MZ0A 1MGOA 3JQFC 3L9WA 4R16A 1C1DA 1H94A 3VH2A 3NGLA 1UP6A 3AY3A 1BMDA 2FPGA 3HDJA 4MVJD 2VUTA 1LLUA 1Z6ZA 2OFPA 4PLPA 3RFVA 4CLHA 4CM6A 5A9SA 2V6MA 2R6JA 3PTZA 3HUDA 3GDGA 4QQRA 1JWAB 4M54A 4BGUA 4CMHA 4F3YA 1SNYA 3TOZA 3JQAD 4BMNA 1R0KA 1J49A 1RYDA 4QT0A 2Y1FA 1B3RA 3TNLA 3VTFA 5ENVA 2OUIA 3OJFA 3OQ6A 3E03A 2O3QA 2O3TA 4IDCA 3RUFA 4IXWA 1DC6A 1JLLA 3UCXA 1DIGA 4R1UA 4HFJA 1X0XA 3ETGA 3DBRA 3K73O 5DZSA 1PWXA 4IJKA 1HXHA 3UGKA 1T2FA 3QVXA 4J9VA 7MDHA 1HWYA 1P0CA 4DQXA 2Y68A 3OEWA 4MVJI 3LT1A 2A92A 5JO0A 4QO8A 5JS6A 1Y81A 2WD7B 3GGGA 3BTVA 3UN1A 2LDXA 2VZ9A 1I33A 3TRIA 1KY5A 3NDJA 1Z7EA 2FP4A 3JD3A 1DLJA 3DXFA 2WD7A 3NT2A 4OMUA 1EK5A 5EQFA 1AHIA 3VPSA 1L7DA 1KIFA 4EUEA 1ID1A 5B37A 2POQX 4XCVA 1NFRA 5TSDA 1I3KA 1RM5A 2DFDA 4OAQA 1GAEO 4H7PA 5JAIA 2J5QA 3D7LA 3C7AA 4WK6A 2FR8A 2PWZA 1EDOA 3WSWA 3EW7A 3PZRA 1WWKA 4J90A 1G6KA 2Y66A 3DWFA 1GL3A 1SO8A 2VWQA 5ENDA 1UDCA 1UZLA 3MOGA 1N7HA 3V8BA 1HSZA 3JD2A 4N7RA 4PGFA 2GNAA 2PTGA 1TI7A 4PFJA 2HAEA 2SCUA 1GCUA 2HMWA 5AOVA 3GA0A 1E3EA 3L4BA 3W8DA 4ZICA 2RIRA 3K30A 4BMSA 4XX0A 2BFAA 3RBXA 2WJPA 4CM5A 1LQTA 4B3IA 1DIHA 2BFPA 4GWKA 1VE9A 1G0OA 2X1HA 1E92A 5FYDA 3PPIA 4NR0A 3T4EA 3KSUA 4JP2A 3MWEB 1M76A 1P0FA 3LT0A 1Z74A 3OJOA 3TQHA 4ZJUA 3PWSA 4CV0A 2UAGA 3PJGA 3IMFA 4D3DA 4BV9A 3V2UA 1DAOA 2FWMX 4FD3A 3GFGA 5A4DA 3ZNOA 3M1AA 5A5EA 3Q0EA 3H2ZA 3O38A 3F9IA 3JD0A 5I9LA 1LJ8A 1PZFA 1M2WA 1Q7CA 1ULUA 1YBMA 2DVMA 1I24A 5JDIA 3DO5A 3BMQA 1YJ8A 3C7DB 3IC5A 2OOSA 3GNQA 3A4VA 4MP6A 4GH5A 4IBOA 1F06A 1KEPA 4JK3A 4AJ4A 3F1KA 2WE8A 4YJDA 4LRTB 3GAZA 2XPCA 4BQRA 1Y1PA 5THQA 1DC3A 3VPHA 5KJ6A 3WS7A 2C2XA 2DU8A 4L4SA 3TZKA 3EDMA 5C7OO 3ST7A 4ALJA 3A28A 3PDUA 3V5NA 3GY0A 3WSVA 2O4UX 2BKAA 4MIEA 3N74A 4YJGB 4PG7A 5DP2A 1N1EA 2JCXA 3CINA 2PR2A 5TNXA 4W6ZA 1GPJA 4YJGA 4ZQHA 4YB8A 1U3TA 3DAFA 2ZCVA 3KO8A 1K6XA 4FOOA 5JPIA 3TDKA 2Y1CA 4CV2A 1K3TA 3U4DA 1MLDA 5C5IA 3SJ7A 1T26A 1S6YA 2FR0A 3JYPA 4Y6SA 1X15A 2X86A 3WFIA 5JC1A 3IOYA 4RV9A 2X0NA 4CMGA 3AI1A 5JY1A 1BWSA 3E5MA 4AJPA 5JY6A 3GK3A 3K9QO 1E5QA 3G0OA 3FWNA 4OOEA 1GZ3A 3PHGA 1PS0A 4JJFA 4JBGA 1WDLA 2QZZA 4BNTA 4M89A 3GQVA 3NTQA 3H65A 4XJSA 3WTCA 2QW8A 1XGKA 1R6DA 3GHYA 5JCJA 4R3WA 3JQCA 2C7VA 2A35A 1UJMA 4E21A 3RC7A 4RZHA 5IDXA 1DC5A 1T1RA 3ZV4A 3WIEA 2AG8A 1V6AA 3FBGA 3NDIA 4DLAA 3IUPA 2RAFA 1G1AA 5CFZA 3KYDB 5A05A 3TZQA 1E1LA 2YV3A 2FOIA 2JCVA 3VDRA 1Z73A 4UULA 3FNEA 2CF6A 2I65A 5EMHA 4ND4A 2O48X 1Z75A 1VL0A 2BH9A 3H7AA 3OSUA 1XIVA 2A4KA 4FDAA 3CMMA 4EUFA 3OECA 1DFIA 4ZD6A 1DRVA 3PK0A 5DT9A 2IZZA 3GZNB 5BSFA 2EW2A 3GDFA 1QV6A 1MC5A 1RM3A 4CJXA 4AVYA 1HDCA 5EIOA 5TJ9A 1GUYA 2I67A 2RHRA 2XOXA 1B3BA 3AUTA 3FSRA 3RSHA 1WNTA 3ETEA 5L40A 2VHVA 3ZWOA 2P9CA 1HE5A 1OZAA 4J0EA 1M67A 3FPCA 1DSSG 2VNSA 3PHIA 4E2YA 3WMWA 3OA2A 4RPLA 4PZEA 4B7CA 3IKVA 3RBZA 3MJEA 3HADA 2Y0DA 1ZW1A 1E3JA 4I9NA 9LDBA 1XWFA 4E4YA 5BT9A 2AA3A 4FPXA 3SJUA 4BMVA 5TRTA 4Q3EA 2AEFA 3JV7A 4RLHA 1FK8A 3QE3A 3DFZA 3L4BC 3DDNA 4HXYA 5ITWA 3HN2A 4FN4A 4DYDA 5EN4A 1YOVB 2P9EA 4JGBA 1OAAA 5L4SA 1DLIA 1SC6A 2DUUA 4MP8A 4A73A 3WGIA 4R4JA 4Y67A 4A0SA 2W2LD 4C7JA 3AI3A 3DMYA 4CLXA 2B5WA 2X9GA 1O0SA 4IGFA 2J3HA 1LSUA 1DFGA 2UUOA 3WBFA 3VZSA 3OMLA 3DOOA 3QVWA 1ISMA 3INGA 1P3DA 5JYEA 4DUPA 4AJ2A 3W1VA 4TKLA 5JMWA 3DEYX 3INRA 1E7WA 2GERA 4E13A 4XYLA 1VKNA 5KJEA 5IN5A 4PG4A 1HETA 3NV9A 2Q50A 1LQUA 3DTTA 4OGWA 3AUSA 4GX1A 4DMLA 3ANLA 3VZPA 4J2HA 3NAQA 2C59A 5JDIC 1ADGA 4A5OA 5DDIP 2WE7A 3FHLA 2J3JA 5DOZA 1YWGO 4CR7A 3NEPX 3QQPA 4JROA 3TL2A 4H3VA 1LDBA 1ISGA 2O7SA 3RU7A 1O8CA 3FTPA 4P38A 8ADHA 3BHMA 2IXBA 2YW9A 4KQXA 2FZEA 4E5PA 4YBZA 4BNKA 3IJPA 3HB5X 1MA0A 3EK2A 2PGLA 4YACA 3LLVA 3RC9A 5THKA 5I9NA 2VYND 3PQDA 5U4QA 1VSVA 2RHCA 3CPSA 5G0VA 1CJCA 4KUGA 3VKUA 3RI3A 2H6EA 4KWHA 4MKXA 4UVIA 1BVUA 3JQ7B 1ENPA 1S7CA 3FPLA 1YH3A 4YVFA 3I52A 4TROA 4W9NA 3WIDA 1U28A 5KNLA 4DYVA 4AL4A 2GZ2A 3GVXA 3S8MA 3U5TA 3QSGA 2OMEA 2VYVA 1YXMA 3H9GA 4JNKA 4KP7A 1K6JA 4UUPA 1QV7A 3GT0A 2O7QA 2BHLA 5KVCA 3FNGA 2HCTA 2I9PA 1SB9A 1UAYA 4RF2A 4W82A 4E5NA 1R4MB 1DIAA 3ITKA 3DBVO 3OF2A 3PFWO 3D0OA 1U4SA 3G49A 3WLEA 3WXBA 3C1OA 3GH3A 4E2XA 3D1LA 4OYRA 1H93A 1J0XO 5DN9A 2VRCA 1MC4A 4NBUA 1I36A 3D3EA 4RVSA 1ZEJA 4KMSA 4LMPA 3ZU4A 1HF3A 2XF8A 4ZVVA 3RC1A 1VPDA 4ZQEA 4AJIA 1P1JA 3DZJA 2HU2A 3CKYA 3DFUA 2I99A 5CDUA 1A27A 3U49A 3Q1LA 4NPCA 3DMTA 4CV1A 1EMDA 1NNUA 1NQTA 1EZ4A 2A94A 1PGOA 1BHSA 4BB5A 4DLBA 1F14A 2FHSA 1ISJA 1JKIA 2GD1O 3D4PA 3VAZA 4WNIA 2J6IA 2O3SA 2EGHA 4R5MA 2CFCA 5CG2A 2WD8A 1R66A 1PJ2A 4E33A 4BHTA 2EP7A 3G79A 1A5ZA 1QP8A 5EPOA 3U4CA 1GYQA 3GMDA 4XQEA 4NK4A 2XXBA 3QRWA 4R9RA 2HQ1A 5GZ3A 3X2EA 5DCYA 3RWBA 2X6TA 3ZWMA 3U4IA 3Q9NA 3KV3O 1IY8A 1GQ2A 2RH8A 3HDHA 5GZ1A 2NUAA 1I2ZA 2YFQA 3D64A 3K6JA 4G65A 1ADBA 4GLLA 1PGPA 2YHIA 4B3JA 4FJ2A 4Y98A 4BO9A 1NVTA 4D44A 3BMNB 1DEHA 1I2BA 1O89A 5JSFA 1FDTA 1DIBA 1VKOA 4GPD1 3RQSA 4PN3A 3QVSA 4FCCA 5L9AA 1YBVA 2O3JA 4AJEA 5KOIA 1NAHA 1QORA 1UUFA 4MJLA 4IJWA 5KKCA 5U9CA 4MIYA 2AW5A 3GOHA 3IJRA 3NKLA 1B26A 3BMOB 3QJ5A 1U3WA 1W4ZA 3GR6A 3TN7A 3OHSX 4J1SA 1CETA 1E3WB 4J7UA 1Y7TA 3QVOA 4ID9A 1IULA 1X13A 4HADA 1JVSA 5LCXA 4ND3A 3KEOA 1NQAO 3PP8A 2QIOA 3FR7A 4GL4A 4I5GA 2DAPA 5JE8A 4CL3A 1E3WA 1MXHA 1PJ4A 1XSEA 5B4UA 2QX7A 1FDUA 5AVOA 3LC1O 5JO9A 2HJSA 3NYWA 4YAJA 1WP4A 1B7GO 2CSUA 1NP3A 1TEHA 3JD4A 3ADPA 1SOVA 1BW9B 1JAYA 2GN4A 3K31A 2GN8A 3DAGA 3KETA 1DO8A 3LVFO 1NPYA 1YB1A 3DONA 3HFGA 3KSDO 2FPIA 3ASUA 1EVZA 3DAPA 3ZH2A 4J6FA 1MB4A 4H16A 6ADHA 1DRUA 3MTJA 2WYWA 1XR3A 4XA8A 4DGSA 2CVZA 4WPGA 3E1KA 1RM4A 3X2FA 5A1TA 2IODA 4YR9A 4IQ0A 2HK8A 3JCZA 4D41A 3JQ9C 3IDSA 1P45A 2NM0A 3GAFA 4N5LA 4R5HA 4BNWA 4JCOA 2GO1A 3UW3A 1EFLA 3DOCA 1UDAA 2VHYA 4K9DA 4R54A 5AQ1A 4M55A 1ENZA 4B8WA 4CPDA 3Q2KA 5CPFA 3F4LA 2I6TA 1ZUD1 4ND1A 2VHWA 4R68A 5EQDA 1WDMA 4Q3AA 4PZDA 3L6OO 1E3IA 1LSJA 3PHHA 3ZHYA 3PZBA 4KTTE 1F12A 3F47A 3ZNPA 4CUZA 2DUWA 1X14A 3ENNA 5IZCC 1T25A 3RUEA 1UP7A 4IS2A 4TZKA 4W9NC 4PG8A 2VWGA 4ZRMA 3MWDB 1H9AA 1RPNA 3TFOA 1LXCA 1NX6A 2C54A 4PLZA 2NTVA 3GN1A 4FFRA 4ALIA 4RPHA 4TQGA 4TVOA 3RD5A 2VT2A 4BNXA 3S2EA 4FC6A 4XYGA 1KBZA 2IZ0A 2ZATA 5JLAA 3QWAA 4QO7A 4FS3A 4YT8A 3UAGA 3WYCA 3AM4A 1PJTA 2GYYA 3KUXA 3KVOA 4QUKA 4RVUA 5G2OA 4RPKA 1HLDA 2Y93A 2OGUA 3AI2A 2AQIA 2EEZA 3KXDA 3QWBA 4O6VA 4P4NA 4WKGA 1ZCJA 2WDZA 2X22A 4NU6A 1T4DA 2D5AA 3FTNA 3ULKA 4B4UA 2B37A 3K96A 3FCOA 1SCUA 3K2BA 1AGNA 4QX6A 3OJEA 4L0QA 4CM9D 3BMCB 4L76A 1H6DA 3F6YA 1N5DA 3RVDA 1WDKA 3BHIA 4XQGA 1PGNA 2YJZA 2PLAA 3ZWWA 1PSDA 3JQAB 3O9ZA 1BG6A 2WSBA 4MVJA 1AN9A 5ES3A 3BMCA 4CLDA 4PLYA 3DMTC 2QRLA 5JXWA 1ADFA 4WLVA 1TLTA 3UUWA 5BSGA 1RJWA 1WW8A 4R69A 3W4KA 3E18A 3JQAA 4A03A 1LDYA 4F6LA 1XHLA 2A9FA 3HJAA 3RUAA 3WB9A 4DPKA 1PQUA 1ONPA 2IRWA 1ZK4A 1AXGA 2X5OA 1H5QA 1B16A 1GCOA 5H81A 1VRWA 3NDRA 3I9JA 2IEBA
chains in the Genus database with same CATH superfamily
1RP7A 3MHPA 1G9SA 2GHIA 1X70A 4E51A 4EK9A 4ZDIA 3Q11A 3LY7A 1Q0ZA 1ZHHA 2CLIB 1QIFA 1Z62A 1IN8A 2GXUA 4Q21A 1GQQA 2H5JA 1U2QA 1R0ZA 2UXBB 1S2IA 4MWEA 4YJ3A 1J20A 4P3PA 3AG6A 4D0RA 4AWAA 4F3TA 4UHBA 4MROA 5IVDA 3CB2A 3RYIA 4I4TB 4GR9A 2O2YA 1R0RE 3SR3A 4ZN6A 2IYEA 4I46A 4AY3A 1U6KA 1KQOA 1O94C 3KLPX 4F96A 2BELA 5JCXA 2Q5OA 1E0KA 3L0PA 1ODKA 3PUVA 3LHSA 2LV8A 1NJSA 4ZQBA 3ZY4A 4C88A 1MJ5A 3A2MA 3IPRA 4CTKA 4EI8A 5KUTA 1POXA 2NUBA 3DGEC 1WD5A 1KMCA 1NLZA 2FPXA 4II7A 2EW1A 3B6IA 2OILA 2J0UB 2D4AA 1NYRA 2AHRA 2OB1A 5K5EA 4EW3A 2IVFA 3F6PA 4BC0A 3F3SA 2C77A 3TI7A 2PX3A 2NTJA 2RHJA 1DEXA 4A0HA 3IMGA 2PNJA 1W0JD 4J29A 4BMXA 1ZQ9A 4CR8A 1O0CA 1V1MA 4AXBA 4JY7A 3JQBA 5TLSA 3TDNA 1VXOA 4Z1MD 1ISRA 5I9IA 3K6SB 2F1IA 4HLCA 4F4FA 5CA0B 2FMXA 1EB8A 1NJ2A 1QO0A 5FIUA 5KCZA 2CVOA 2D06A 3IOCA 3LL7A 4EYQA 2FN7A 4B48A 1VA4A 2H59A 3BERA 3QIVA 4RGBA 1LPNA 5GJVC 2WIJA 3FMPB 1SZPA 1XZHA 2E4ZA 3VR4H 2HLPA 4U7JA 4YUVA 3OPXA 5AWFC 4U5XA 4D0GA 1KEEB 5LOVF 3NO4A 3MIZA 4XRRA 2W6QA 4Y6LA 1HYHA 2ZWOA 1QKKA 3GB9A 2B9VA 3H8SA 3HABA 5CBPA 1N8TA 3A3PA 4G0MA 1SHUX 3KBOA 1P2SA 5A3RA 1ZFNA 5G0SA 4JV5B 1PTJA 3B2QA 3GPDG 3OKPA 3ZVLA 2JFNA 4AZ3A 1S01A 1YOBA 3U7RA 3AEQB 2HA4A 2BP7B 3UJAA 2NZUG 1CQXA 1J97A 2VSYA 5ALZA 3S2FA 1GRRA 2DR0A 4G8CA 1P77A 2WJGA 3NANA 2I66A 2WUEA 4B2PA 1QWSA 1GEEA 5K45A 4JL8A 4UQOA 1RKXA 1GR1A 2OY0A 1C50A 2Q6LA 3H2GA 3ZQUA 4WKPA 5L45A 3RC8A 4PC3A 1FCJA 1EUCB 1UMBA 3QV1A 1AQLA 3PICA 4H08A 2VYQA 4TWAA 4UTOA 3HYTA 1NE2A 3HE3A 5GMOA 5IAJA 3TXXA 4ZI7F 4CETA 1GDTA 1PR2A 5DHPA 1L1EA 1V9LA 2X9NA 5F33A 1Z5UA 1P62B 1RBYA 2R8XA 3E53A 4Y1RB 5FTMA 1QTIA 4DV2B 1P6UA 4Q0MA 4LJ4A 4KYIB 4MV5A 4CMKA 3RGWS 3STXA 1JEEA 1NVVQ 4BQPA 1TT7A 4DZTA 2KWIA 5EWLA 4CEHA 1ECCA 2JARA 3JASB 4Q15A 4XH9B 1RKBA 4X6UA 4CCSA 1T8SA 1YRAA 2NZ2A 4F46A 3HS3A 4KODA 5FPTA 1KYXA 2XADA 4KL8S 3P2OA 4AZ0B 1JFLA 3ETJA 2KBEA 1U99A 4C4XA 2JIBA 1FTYA 1STOA 2FX3A 2ORVA 3FE2A 4LSGA 1OX5A 1F2UB 3EZYA 4E4RA 4CDRA 1GTL1 1R9GA 1XZGA 2G1UA 3DOHA 3GZTB 1EUDA 3IQWA 4RZUA 2XB6A 5B6JA 3EZ2A 4WZAB 2V7PA 4RTJA 2XQGA 2E82A 4QBHA 1Z6YA 4BNYA 4CTOA 4I55B 4RIHA 1ZH8A 1Y8QA 3DUFB 1Y4AE 3GUZA 4ANFA 5BW6B 5DULA 1N78A 4R3NA 5G3ZA 1EFHA 1Q11A 3PDIB 2XBMA 2R44A 1AZWA 4M9CA 1MW9X 1EJ6A 1GKKA 1VG9B 2QM7A 3MWEA 1ND5A 4FYPA 1IU9A 4AJHA 4WBSA 3GPLA 4I0WB 1U2DA 4LYYA 2BTEA 3R74A 1Y7PA 1Z0AA 2ZTLA 1UXIA 2J9FB 2Z9BA 3TNDA 4V0RA 4NBKA 1M6HA 4RXMA 1LLQA 1XV5A 4AS2A 3JQ6A 2YFHA 2BZ0A 4CE6A 2IXGA 4QHTA 3QXGA 1ML3A 5TR9A 2WTEA 1CIPA 3KP1A 4ZT3A 3HO8A 2XQKA 3ZD6A 3FJ1A 2JF0A 1UEIA 3I39X 4HYYA 2FZWA 4P4GA 4M6WA 1JJFA 3DMFA 1U1GA 1R4AA 5DSZA 2MINA 3T0FA 2JAWA 4F4UA 1QRDA 2ODAA 5JFOA 2R4TA 1UKBA 2ANBA 4OQ4A 5FWNA 5HA5A 3CVOA 3H3FA 3ETCA 3WQSB 4BKRA 4K28A 1OXBB 5HKBA 3K70D 4DV4B 3R1IA 1HT1E 2GBLC 1H0RA 5F12A 4W5RA 3B51X 1VHLA 3AUKA 4DRYA 2CXUA 5C3UA 2G1AA 1FUIA 1WY5A 3G23A 5B4VA 2X42A 3A1VA 4V0KA 4YWJA 3TFQA 5CX4A 3LX8A 1LRKA 2J09A 5HIMA 3TBHA 1O6ZA 4HNGA 1TYAE 3VPXA 1B41A 1E4VA 3OQ1A 3MFQA 3A0RB 1QIJA 1Z3IX 3S8YA 1BD4A 1NRIA 1EXNA 3A9SA 4IQGA 4LHWA 1Z4MA 5G0TA 1A9YA 1GUDA 1N6KA 5DTIA 2HJRA 2XVAA 3QVLA 2JJQA 2QS9A 2X5JO 3EARA 3I64A 2HA7A 2VS1A 3JD1A 4P08A 5JXHA 4MUXA 3M49A 2YBEA 1P2UA 1YMQA 4FSHA 2PO7A 3KYIB 3V33A 1GU7A 3VR5H 3O74A 3W6NA 4P34A 5LIRA 2GM4A 1G64A 4RTMA 3P20A 4F5ZA 2JH3A 4LC9A 1CZKA 1W5TA 3A3YA 4RL4A 1K5HA 3O6VA 1R6VA 1YJQA 2XY4A 4K88A 4NL4H 2AQHA 1K5DA 2W4MA 2ZYAA 4MZXA 3TYXA 4I1SA 4MA0A 1AZLA 2X3YA 1E0JA 4AUMA 2YDXA 3QKUA 1WQ4A 5E1MA 4QDKA 3MJSA 1CLUA 1OAKA 4TZTA 3L1IA 3ESBA 1E2JA 3MOSA 3TW0A 1M6VA 1VIAA 5HNKA 4YIKA 3IMEA 4UAGA 5LLSA 2WQ6A 4OA8A 3UJBA 3U09A 4GKKB 2HQOA 4MAFA 2EIHA 5F3WB 1S5PA 1ZNZA 2PZMA 2YMQA 3HGQA 4MYTA 3N0XA 3QX3A 2GBPA 1UBLS 4N65A 4D57A 8ABPA 3VOSA 4DDWA 4HY3A 4XQCA 2B8EA 4OHFA 1QDUA 1QHIA 3SYKA 4ZYZA 3GDWA 4RTLA 4HUQB 2O3RA 2OZPA 5JBNA 5DNYB 4FCTA 4I08A 4CODB 1O57A 3OHPA 1D2GA 1MEOA 1XKXA 2P4UA 4MK4A 1GAJA 3SS8A 4QLOA 1KMQA 3JTMA 4RANA 5FDFA 2IGBA 2PFGA 3EAGA 5IMBA 2MSNA 3WGYA 4YALA 2FDXA 3KM0A 3IV7A 5REQA 1WV0A 1JLSA 4M1MA 3KCQA 2GHQA 3RF7A 2GUGA 1GPDG 2GEVA 4AG6A 1GTVA 1HC7A 2ZSUA 1GL7A 4H7EA 5EHIA 2BGNA 2Y1XA 3LP5A 3NTXA 2VXCA 1FLAA 2IT1A 4GNRA 1E3TA 4H31A 4MPTA 1IE3A 4LXUA 3LQ1A 4DIOA 1SFRA 4Q34A 4OXXA 2HQBA 2ID7A 3ZZTA 1EWYA 3TLJA 4G1CA 2CXHA 2LR0A 2XXAB 3OBBA 5LMCA 4MS1B 5HJEA 4AROA 2A33A 1PL6A 2AK2A 4IYJA 1WA5A 3QYAA 2B98A 2Y67A 1QZZA 3CF4A 3H2JA 5CYOA 4JHLA 3O1IC 1N92A 3OTQA 2ENWA 3WJAA 1I0ZA 1FS6A 1X87A 4LV8B 1NI5A 4A2CA 3IP9A 4BO6A 5ALPA 5BPHA 3DMDA 2J5RA 2J87A 4P3YA 3C7CB 4OX9B 1PSWA 3ACBA 4GP6A 3D7KA 2A8YA 5C34B 5JSZB 2IS1A 5IJZA 3ORYA 5ETJA 4EI9A 4ENUA 1L3CA 1DEOA 2FSFA 3Q87B 4TTPA 4UQPA 1QB8A 3UG6A 2WA2A 5DTEA 2H2GA 3HJGA 4KRFA 1C7IA 1Z08A 1Z5VA 1BYUA 2PGNA 2VYNA 5I5GA 1NMZA 1YOVA 4AF8A 5CD9A 1NSTA 4C2AA 1JFFB 4HDRA 1E1CA 2UV8A 4KQEA 1E94E 2IHZA 2X5XA 2ZIXA 2ZUSA 5GV7A 4DA8A 2CLMB 3WNCA 1U9IA 1E9SA 1A2BA 3I5AA 4QUJA 4OXYA 1I8TA 1Z38A 2NADA 3MINA 4L4XA 5H02A 3ROXA 3DL4A 2QTGA 3Q6IA 1N6LA 2QV7A 3GJRA 3HV2A 4JOBA 2CMKA 4D0LB 4CLOA 5LZ4A 3HYNA 3FIJA 4ERNA 1WUIS 2CNNA 3BRWA 3P5BA 3HFJA 4M0UA 1KVSA 1XQYA 4ASUA 1DC7A 3NM4A 4D8TA 3OG9A 1O5OA 2DECA 3DEFA 1R3UA 4LWZA 4M83A 3QVTA 4QEDA 2Q1WA 3L6BA 2FEOA 3N87A 4CDMA 3GP8A 4Q47A 3L84A 4PC7A 5I7UA 1B6GA 1TT5B 4Q00A 3AM1A 3WADA 1EAMA 4KQ9A 3EC7A 4Q02A 3T7DA 4QM7A 5DMXA 1DELA 2I3BA 5HUQA 3ZKAA 2QN9A 4BTLA 2VP5A 2W6IA 4V0QA 1KMMA 4Q4DA 4E2WA 1QCDA 4G4GA 5A3SA 4ZO9A 2WD9A 3D6NB 2WYOA 3GN2A 5BO5A 2ZZNA 2HUNA 1LA2A 4BRUA 2AMJA 3C8DA 1PZEA 3ELBA 4IUYA 5DM1A 1JQEA 3N2IA 3N28A 1MOSA 2FCAA 1Z2EA 1IQRA 2V6BA 3FM9A 3MAGA 3WAGA 1OBCA 4IVQA 5HRUA 2ONYA 4DB2A 4M0CA 4IQ4A 2CDAA 1T3ZA 2VJQA 4ZO4A 3B9QA 4NBNA 2RBKA 1H66A 1Q3HA 5FEMA 5AI9A 5DF1A 1Z28A 2XDAA 1H4TA 1LF5A 2JPDA 4HAVA 1FU4A 1U7PA 3UNXA 1FNMA 1IB6A 1NXPA 2UVQA 3AFOA 3IODA 4FEGA 3FTEA 3H6HA 4PCAA 4B3BA 1QZTA 1NXXA 3LTEA 2EKLA 5B12A 1VMKA 4MQFB 4PZAA 1LPBB 4KAJA 1IM8A 4ZC8A 3DEZA 3SE0A 2JFOA 2Q3FA 1ZZEA 2A9QA 3KALA 4DADA 5H82A 1VRCA 2EJUA 4ZI2A 4KQ2A 4MVWA 1GGFA 1JR3A 4D9BA 3VR5D 1TJNA 4YGXB 4BATA 3U3KA 1AQYA 1QQ6A 3WL4A 4RZQA 3AK4A 1GN8A 4Q01A 5BOSB 2K6GA 2XUIA 3GUYA 4FYXA 2GEUA 3NM6B 1K89A 3H4VA 3R6DA 1FNNA 1Y1RA 2QHXA 3NH6A 2XKJE 4LRYA 2WMYA 1AO3A 1C2TA 1ZUWA 3LUKA 1BS2A 4KUHA 3G0HA 2H11A 3QUSA 4K6OA 4XB2A 3ZW8A 4CHTA 4B85A 3HKCB 2B3TA 4FIZA 4NCHA 2XI4A 3I23A 4PZYA 1BWQA 1H2EA 2W2KA 3HCWA 4DTCA 4JJAA 2OO3A 3TQCA 16PKA 1BKSB 1E9DA 4RKRA 1C4WA 1PHRA 2IK8A 3ZIAA 3I0NA 5HHTA 5JAZA 1H3FA 1ODFA 3L6DA 4FR5A 1UFOA 1GSOA 4XEUA 1ISFA 1KK2A 3C6KA 4GLBA 4WWHA 5C7YA 2C7OA 2KI5A 2ZAOA 5BMVA 3F9CA 3TGLA 4MQEA 1BX3A 4B0OA 1N4DA 1KORA 2YRWA 4G81A 4C0LA 3GLFA 3LUGA 5AW0A 2CC2A 4ARAA 1Q1NA 3H5RA 4BWGA 4PLVA 3IAUA 1OTYA 3EVTA 3KWLA 3I8SA 1R6TA 4LK3A 5MFZA 4K6FA 4IMRA 4LHXA 1U8YA 2XMPA 3HXTA 4B5KA 2OLEA 4CHGA 2WKWA 1ZP6A 2IYOA 4NBVA 1U02A 3CUKA 1J00A 3HFRA 3RG8A 4CLRA 1E1QA 3E9MA 4IINA 3WISA 1UBEA 4L22A 5TGDA 3PI7A 3GT4A 1B43A 1TRKA 2BUAA 4QELA 4TVBA 2WVAA 3FFXA 1Q95A 3WYEA 4B7ZA 3PI6A 5DNAA 5IJ9B 4I6JA 5B3AA 2H18A 4P2BA 3I6ZA 1D0SA 1PX0A 5E2BA 3TZHA 2O3UA 5LP6C 3GA7A 3NAZA 1SEPA 2QPLA 1RLOA 2EG9A 3BVPA 4IDPA 4OXIA 5H9WA 4D80A 1MXFA 2QVLA 3GLIE 4F2GA 3PFBA 3T61A 1C81A 3SF8B 4BQEA 1DAEA 2MR6A 4YV7A 3FJOA 2YCBA 1P9LA 1EE2A 2C8KA 4JD5A 4M1SA 1DIRA 4C1BA 4ZQIA 3C16C 5P8WA 1ESZA 5TS3A 2B2XA 4ICIA 1GL6A 1ZUNA 1Y3DE 2HF2A 4EHKA 4L73A 2PNFA 1UR5A 2AKAB 3L8YA 3HUFA 3WIOA 1W48A 4Y9RA 2Q8QA 1J5PA 1JR6A 2A7XA 3IHWA 2H63A 2HSDA 1C3XA 3GFRA 3IVCA 5KYWB 5B30A 1EP1B 4BKQA 1SIOA 4HNQA 2PH7A 1RZUA 3BTUA 5E7MA 5M29A 3G2MA 4URUR 4REMA 3FXAA 4D9GA 2YJTD 3LA8A 1OXSC 4CCYB 2QU8A 2PZGA 4AN1A 3UYLA 2ZSDA 3HB7A 1G20B 1Z2CA 4II3A 4UBJA 4AZTA 4CKBA 4DNFA 5L95A 5CPBA 3HCAA 3PFIA 3QPVA 1ZL0A 2C3MA 1WXDA 2B7LA 3B1KA 4FZ5A 2H1SA 3K9CA 4LDJA 3RKRA 2REQB 1CJMA 1D5WA 1T4MA 1TRHA 2Q5CA 4D98A 3C3MA 4OK3A 2D0PB 5DTJA 1W36D 2GN2A 1NXVA 3PFNA 3RV3A 1VCIA 4YDQA 2ES4A 5LSAA 5HFJA 1G59A 5CVDA 2PIDA 5B7PA 2PKQO 1KI9A 2AJTA 4IYRA 2H1VA 3LY8A 4XPZA 3NEYA 3ZWPA 4AZVA 1ZD8A 2C5AA 1LW7A 3U7QB 2ZM6B 5FAKA 1BW9A 5IWCA 1ONOA 2O1WA 1KSHA 2R96A 3IIKA 2H1LA 4JX8A 5AKHA 4LPSA 4LOHA 2Q4RA 2WEKA 3LF1A 1NI4B 3DZKA 1XPRA 1I3OA 1T6XA 3UXHA 4PO1A 5FTJA 4O2AF 2ZWVA 1HNZB 3W5IA 1TJ3A 2EZ4A 1Z4IA 4XKJA 4C3VA 4GVXA 1J0AA 1CD5A 3P2KA 4JJGA 3RYTC 3T3GA 1FX0B 2VAWA 3MT7A 3UUEA 1PG2A 2J3QA 4A0GA 3ND5A 4HKTA 3N53A 1UFQA 1OXTA 4NMMA 4NK5A 4L9WA 1RHUA 2EKZA 1RKUA 1V8FA 2B6NA 2Q1XA 3LDUA 4K8RB 3WWZA 4JEUA 4I5FA 2A5YB 2Z2JA 3FYTA 4QJIA 1J8QA 4PYJA 3AEUB 1O94D 1C0PA 2QN6A 1J07A 1PL8A 2EATA 2FF5A 2J6HA 1ZC3A 3G9TA 3SG0A 1DAHA 4GXRA 3UVEA 5C4MA 5I7EA 3H19A 2ZJYA 4Y9TA 1FU8A 1HG0A 1GPH1 2JFFA 3I1YA 2DBQA 3EEFA 5ALUA 5A9TA 2H00A 4DWJA 3GJZA 1YHZA 4FYIA 1I2CA 4O25A 5KO2A 1TGYA 2VTVA 3KZVA 1Y7IA 2PH3A 3UK1A 4DLLA 2HSWA 2CMHA 5CHEA 1GA1A 1G16A 1HZZC 1EIZA 1U5BB 3DCNA 3HO1A 2JIZA 1XDWA 4HS4A 2WTBA 1P8AA 1XXHB 4BNIA 1NBAA 3EJWA 3G2PA 3QW4B 2JGNA 3FI9A 4EHBA 4OVKA 2YZNA 4XGIA 4KG7A 3U39A 2Z1DA 3NFRA 1X80A 3TLGA 2QAIA 1FQKA 1N8KA 1Q1BA 1DP4A 4IOJA 4OGGA 3BH0A 1G2OA 3TJMA 1OGYA 2FPPB 4JI8B 2O8NA 4FNAA 4G5XA 2YVKA 2R1UA 3GC6A 3FWHA 4NE7A 4YP0A 1IY1A 5M04A 1YZHA 2ICAA 4IRUB 1NAIA 1QG6A 1EJBA 3QBVA 5JBIA 1ICIA 2JBAB 5A4IS 2WFZA 1A8PA 2V7BA 3R9IA 3HYSA 2B5OA 3H7IA 4BP3A 2W7TA 1NW4A 1RRKA 1W8DA 2NVOA 4FGZA 1YASA 3NBXX 5HS4A 2QMOA 3OTWA 4RC9A 1SVSA 1D4OA 4EBBA 2OXCA 2ZE6A 4NTZA 3LQKA 4CIBA 3IH5A 1ORTA 3L18A 3C74A 3GRAA 3DHYA 1PJ3A 3MN1A 3O26A 4UU0A 2GHTA 4X71A 3K53A 3ISVA 3EUEA 5AM5A 2HNAA 5ERYA 5FX2A 1HA3A 4JYAB 3WOVA 1LDGA 1F8YA 4KKVA 2XMRA 4PEVA 3UAYA 1RQXA 2XHZA 4C30A 4G5HA 3DZDA 2CHUA 3VNBA 4C76A 1X86B 2QIPA 2FWJA 2XTJA 1H2BA 3MGBA 5LQDA 2R48A 3WBBA 2FZLA 3ICOA 3U2QA 3SD7A 1NV9A 2XUKA 5FPKA 2XAAA 4C08A 1C9JA 1K8RA 2C2WA 2ZETA 3AUUA 3QXJA 3DFIA 4J16A 4IUCS 5I48A 2YZ7A 1F8FA 3QHAA 1IC6A 2VJLA 3PYMA 4Q9IA 5IDYA 3E6AA 4R1OA 5KTMA 3ZWAA 1D8AA 2G71A 4MR7B 2IU3A 3SHQA 4DPMA 5I4CA 1KQFA 4XDZA 1FFYA 1WUKS 2ZRPA 3X1ZA 1YR6A 4RPIA 2BJHA 3JARB 3SYNA 5JJCA 3L5KA 4KN8A 2R6HA 5G3YA 5I47A 3ENKA 4PQRA 3VNSA 1MO3A 5DCWA 1QGOA 5IAGA 4JOQA 1OXUA 2QB5A 1BGWA 3QV2A 5FI0B 4F8JA 5ICSA 1WZ2A 2QVZX 3OKFA 1HM5A 3ITEA 1GILA 4GR4A 2X0DA 1KEZA 4N6GA 2A5LA 1X38A 2REBA 3WLAA 4BWYA 4HX2A 3EPLA 2PM8A 2ZR8A 2OECA 4L1KA 5KQSA 2CCKA 2X5NA 2ODNA 2ZUTA 1YONA 4KR6A 1TMGE 2G4LA 4PRYA 2ZRQA 2IPLA 4HRVA 4Q3OA 5DBFA 4HD8A 4ZEOA 3IEIA 4RPGA 3WAKA 2Q5JA 2XCSB 4YT5A 4ZODA 3D54D 1BDJA 1TCAA 2GLXA 3CUTA 1VKZA 4B6OA 2RCNA 1TUEA 1FRNA 3EGOA 821PA 1GGKA 2C2HA 3K8ZA 4ZZ0A 4DBZA 1SAYA 2G07A 4DN6A 1UZUA 2YDYA 3OQJA 3QI2A 1LLFA 4I99A 1YB4A 2EDCA 2Y0CA 4X3PA 3DZBA 4U7TB 1DFHA 1RVDA 2AF3C 3AUXA 4P83A 4PVDA 3TL6A 4D25A 2XLBA 4YPOA 3DBHA 1IJBA 1I0LA 3ONWA 1LX6A 3WLOA 1M1UA 1ISIA 1MNQA 1Z2NX 4GPAA 4HDAA 3W2TA 3SS7X 5BR8B 5CFRA 1MUUA 1XNHA 3HXLA 1J7JA 1YZNA 1N57A 4JS0A 3LS2A 3CKKA 4Y2YA 3DBRB 1W52X 2HWYA 3LXXA 4HP8A 2ZULA 4JASB 4OL0A 4K87A 3L1UA 3P0EA 4RFSA 1NHWA 3U9TA 3CGWA 1R6AA 1TFRA 3FD8A 4ARIA 1VYHA 1WY7A 4HJXA 4R2JA 1ZITA 2IU0A 1YBAA 1L5HB 1VZ2A 3KTAA 1M8KA 1R37A 2A5FA 2PRZA 5A04A 3HCOA 3L6CA 5HWSA 1U8ZA 3AOGA 3UAOA 4IEEA 2BP7A 4F9GA 4YP1A 2X7HA 2AG0A 1QIDA 1E3DA 3E2MA 4OJTA 4MYDA 5BR4A 5CNKA 4XSVA 2VQ3A 4QM6A 2VPWA 3ZJUA 5L7WA 4QDJA 4BQSA 2FSVC 2Q5LA 1SN7A 3A3KA 2JLQA 4JZKA 3THSA 1CF2O 2DWPA 1EUCA 2YJ6A 2SHKA 2CJPA 1PRYA 2ZAIA 1NP7A 2O8VA 3LGAA 3SF0A 3VV3A 3W05A 2R5FA 4A8JC 1XD2A 4UHFA 1WW3A 1MB3A 2NTNA 1Z9BA 3F9RA 2Z30A 1EBFA 4QECA 2WU1A 5HTOA 2VRWA 1RW4A 5LZ8A 4PNPA 1ILEA 4TTVA 4Y1RA 4BQOA 4BKUA 2HPAA 2CB9A 3LP6A 1T6ZA 3E9RA 4HSEA 3QYJA 2PUTA 4L4ZA 2B0CA 3OURA 4LBZA 8LDHA 5BNTA 2F3RA 4WY5A 3Q40A 2WFMA 4WLUA 2L19A 1CY7A 1PWEA 1KH2A 5JBQA 1EHIA 1SXHA 2SCUB 2ZRKA 4Q1VA 1G3IA 1VJRA 2ZYSA 1M6EX 2PKRA 2BI7A 1KJIA 1CUEA 2DX7A 3VDXA 5MF6A 4WCDA 5AVVA 5T64A 4LZOA 4ESEA 4XX0B 2QD1A 3KQWA 4K6HA 4EECA 1JHRA 1FRZA 2JGJA 3COWA 3INYA 3E5RA 3OWXA 4DRZA 3NC4A 1A8UA 1MV8A 1QFSA 2VPTA 4JSTA 1QLWA 4WXRA 5DOVA 3X1MA 5GINE 3D6HA 3Q3JB 4G9EA 4KR3A 1M3SA 4JUIA 1IHOA 4WZAA 3FOCA 2R6GA 3MQ2A 4G3XA 4I55A 4S1TA 3HCRA 2ZJ4A 3V80A 3D3WA 2B4AA 2FQXA 3TKYA 3GRRA 2FRXA 3A6JA 3QMMA 4IGEA 5EKTA 1MG5A 2GF2A 3ET5A 3ED5A 1T9DA 4O4HB 4A23A 1SEVA 4WEOA 5KMGA 2ZXUA 4CM3A 2FWRA 2NU9B 1R88A 1P4RA 1I6MA 1ZX1A 2JDID 2XZPA 3L0IB 4I1YA 1TO6A 2YVQA 4KO1S 4R7GA 1ZXXA 1AHNA 1MPTA 1OW3B 2EFDB 3DV0A 4I1RA 5LQUA 2ZROA 3GLGB 5MGBA 1GEGA 2ORED 4IPTA 2WQ7A 4ZCPA 5BW5A 2IPNA 4FMDF 4TSKA 4BU1A 1PS9A 1OF1A 1ZRHA 2PPVA 3FWZA 2BM8A 1PP4A 2GCOA 3AF3A 2ENUA 4ZKEA 3AKCA 3IP6A 2CHQA 1GD1O 2WM3A 4OHBA 5EIWA 4OX9Y 3SM3A 4R1SA 2CCJA 1A9SA 4L0DA 2VH2A 4R41A 5JAQA 5T67A 5IM4A 2IOFA 1WVIA 3ZXUB 2YINC 3E3OA 4HFRA 3ZJTA 5AHRA 3IT1A 4CL2A 2WWFA 1RRVA 3RASA 5MN4A 1E5VA 2D1RA 2HPVA 4BQIA 5ESWA 1JJ7A 1IWBB 1WO8A 3NTLA 3RK4A 1SZDA 4KHPB 5A4KA 5B7QA 3RUDA 1N0HA 1CY0A 3FZQA 3F5FA 4FW9A 3K0HA 1OKKD 3GLVA 2ZAYA 2SICE 2XXJA 2ID8A 4BQQA 1SOAA 3W8NA 1XBTA 5KYYB 2DQZA 2AEMA 2BE7A 1DVRA 4EUSA 4C6TB 3EFOB 2QAGA 1DTWB 3NYIA 1TVMA 1TZ2A 5F21A 4PHCA 3U3DA 1TVCA 4ZTUB 1IAQA 3L06A 1G8KA 4CTNA 4DSAA 5K6TA 2FZVA 2ZB7A 2HLNA 1XPJA 1N8SA 2ORWA 4IZHA 4P7BA 5HF5A 4ZPXA 1H8EA 3CRQA 3UICA 4AJJA 2FDRA 4B2LA 2C4TA 2YJ4A 5CT6A 3TBKA 2J0VA 3SE7A 3DHNA 4CQLA 3WLLA 1TDJA 3R5JA 3IEXA 1XUOA 1XZFA 4N12A 3KDPA 4XJXA 1IBRA 1Q1QA 5IP5A 4HN9A 1G60A 2WVJA 1A1SA 4WN9A 1QJ4A 4BPRA 1T5LA 2H5IA 4PLFA 4GVLA 2D1TA 1OH7A 2QMQA 3WGLA 1HYBA 4FKMA 1YKGA 4KZPA 2CZCA 4O4JA 4CGYA 4AQ7A 3G1UA 3BDAA 2PANA 3RSSA 4BZPA 4WT7A 1AC5A 3NJ4A 1CE8B 3FYSA 4NFYA 3JQBC 2WZBA 3TMYA 3CTMA 3U40A 2V7TA 1GFZA 1KU6A 5EMMA 4ZAWA 1ZN2A 1ZOSA 2I6QA 2TRSB 3I4FA 1UDRA 1WZNA 3IALA 3BORA 5B4TA 3LGXA 2XNCA 4BBZA 2BMAA 3FCSB 2VHTA 1RAAA 4BMOB 3PJDA 1NL3A 2NVUB 4KPFC 1WHTB 3WK8A 2G8NA 3FDFA 3NFYA 3QTBA 3RB8A 4QJ3A 4S1VA 3BIXA 4ITVA 5D51S 3TLMA 3AOEA 3NIBA 3OP1A 4KLRA 2XVZA 1L7EA 2O14A 4DA7A 1Y63A 4KR7A 1O4VA 3MTAA 1EVEA 5I7FA 4L6AA 4MINA 2JANA 1ZNXA 1U1IA 1KERA 3GBSA 2QW0X 2P4HX 3F6CA 3WWPA 5JWHA 3VR3D 3CVXA 1JEOA 4FR2A 4OH7A 2P65A 2QRQA 4EKGA 4GVPA 5DHRA 1QYDA 1I2MA 4LHVA 1D07A 1MMFB 4MCIA 2QGNA 3KNZA 1KK1A 4UCXA 1Q21A 2WJZB 5JEDA 4JYMA 4OGLA 2OM6A 1T34A 4OP3A 5FBQB 1TMKA 1U3UA 1KMHB 2EF0A 4EHJA 2ZB4A 3GWZA 5KINB 2CUKA 1P1RA 3AINA 2O2HA 2DG2A 5KVQA 5F3RA 1WG8A 1Y3FE 2FY8A 2ZS7A 1CRLA 1WIWA 5EZQA 1SIBE 1F38A 3R40A 4IJVA 4R2LA 3W4IA 1ZI9A 1U7UA 1QX3A 3QU2A 4O1IA 2CBGA 4CKEA 3C1AA 4I1OA 1NG1A 1XA3A 4P5PA 3UCFA 2HCFA 2QROA 2VF8A 4KIGA 5H80A 3UH1A 1CZHA 2A9OA 1IVSA 1VJGA 1W19A 4MUMA 1DG9A 1BTOA 1TZCA 3SDZA 5T6BA 3OZBA 1FXSA 1G4AE 3RSOA 5IJ0B 1NQWA 4NBWA 1QPZA 5T41A 1N7GA 1FFXB 2NVBA 2AOXA 5CGQB 5JAPA 1CVIA 1N2CE 2B6HA 2FKNA 5ESRA 1TMOA 4RGQA 4YNBA 3OZUA 4MPDA 2Y8EA 1IHDA 3HHEA 5ELXA 1XEWY 5JCJD 2FMFA 2J0SA 2P5TB 1EFVA 3AB7A 4X1YA 1VHTA 3C6QA 1RXEA 3GLHA 3IKMB 4DLUA 1NVFA 3M3HA 4UBLA 1TLFA 5BV8A 1P18A 1IEQA 2CZQA 4P22A 2UYCA 3FUXA 4LMBA 4BP1A 1Y34E 1Z4QA 1CUAA 3N3BC 3O1JC 4V0ME 4ZGWA 2V45A 3PQFA 1WULS 1ZRMA 4DV3B 1Z83A 4MV4A 2NV6A 3EG5A 4GPBA 1JFFA 1OC4A 5EHZA 5JROA 4RULA 2X6RA 4WGGA 5LQMA 1NBMD 5EIFA 3QU4A 3JRNA 1KKMA 1N1DA 1V4NA 3TOXA 4P3OA 5LL6P 5DMHA 4MDFA 3SHOA 1X9IA 1RXVA 2CD9A 3SOPA 1CUSA 2ILTA 5HCIA 4QXAA 1JF8A 3BL6A 3HR4A 1KYWA 3SYLA 1YVPA 4KVFA 2O23A 3F6BX 5FYQA 1UEXC 2QE7A 3L0DA 2Q2WA 4L6CA 5CFNA 2WF8A 4F2WA 1JDBC 1XJCA 4GNKA 3T4XA 1KYIA 2BGUA 3LX6A 3SZRA 4YXFA 4EMSA 1IONA 2ZRDA 1DPGA 5KWEA 1ZVVA 5F9FA 1V47A 4RNCA 2DFKB 1QCZA 4HGNA 4TV8F 1B8PA 1HDGO 2A9JA 3A9TA 1CUHA 3D5TA 3GGSA 5KEIA 3KUCA 3M4YA 3D4LA 4JITA 1TZJA 1NXQA 4TRJA 1PWYE 1SKAA 2GJKA 4DMMA 1B2RA 1CY6A 3W5BA 3TW4A 1E3QA 5F2NA 1UFVA 3V4OA 3M1YA 2FRVA 1HDYA 4KQFA 2JVJA 2Y1WA 3F8SA 2BI8A 4HLDA 4DCUA 4L5CA 4ZVRA 3QP9A 1DL5A 4EH1A 1C0KA 3RNOA 3VNAA 4HDOB 3C14C 5EE9A 2B4RO 5AM3A 1XPOA 3ESAA 4PBSA 3WIVA 1QV9A 4AJ1A 4KFSA 2OCPA 4CQMA 2O50A 3JQ9A 3DG9A 1VB5A 3EVDA 1Z6XA 3DC2A 3SMQA 1HDZA 5A62A 3MLEA 1SBYA 3K20A 4GGPA 1FMTA 1PJCA 3G8CA 1NA5A 3TIFA 2MCFA 2JRLA 4BCCA 3OU7A 2BKEA 1GQOA 3WP1B 2HX1A 2HRDA 3FGOA 4KHZA 2WYHA 2V1XA 2ZPTX 4RVDA 2MSKA 1TGVA 2NACA 1KRHA 3I04M 1HG1A 4YJHB 2OKCA 3IEKA 3P9QA 1U9CA 3R0QA 3U3RA 2YHSA 5ERXA 1DHTA 4WZBA 4Y1GA 3NNDA 5CG1A 5I4KA 1AY0A 1SRRA 1YDFA 1MT0A 2NX2A 4QA9A 5HPYB 3OQOA 3L04A 1RFGE 1MQAA 1GGNA 3OY2A 3ZDYB 3RPEA 2CYBA 2N46A 4L15A 3MXTA 2WJWA 2YH2A 1Z0UA 5E4YA 1EPUA 4Q7EA 1K8XB 3LFUA 3JYOA 3OJ0A 4OJQA 1GA4A 2I6UA 2EW8A 1N3LA 2WAOA 4OD0A 2GLUA 4I8XA 3QLUC 3FMFA 1RKVA 3NOOA 3KQOA 2WAAA 4FYMA 1K1EA 4HAIA 4KQIA 1RWOA 5JSYA 4P7GA 1IL0A 1GDHA 2O2IA 3BQ9A 2YXEA 1P4HA 1TAQA 3PBKA 4UUQA 4KGZA 4BB6A 2V54A 4UUAA 4JYZA 1L4UA 5I5EA 4BUJA 1ANKA 3O5AA 5EZYA 2CXPA 4RZIA 4EARA 2GD2A 5JDCC 5KWJA 2Q1SA 1XVTA 2XE6A 2ZYWX 2A84A 3F7TA 4QAJA 3TZCA 2ERXA 2O06A 4ZGBA 2I7XA 3PC2A 3CW9A 5DWVA 5FRDA 3HFSA 3PITA 3EPJA 5L3SB 4HWOA 5CITA 1XYGA 2JH8A 2ZOSA 3EIOA 1XRQA 2AEJA 3L82B 2ZLBA 5CEEA 5KVSA 4ZMBA 4C78A 5ARBA 2JGAA 2ZI7A 4LV5B 4P80A 4KAAA 3RVPA 3LPAA 2JAUA 3ETHA 2CXXA 3EGXA 1HDXA 3F67A 4KR0A 4PAGA 5ALSA 4ZT7A 1E58A 3V1UA 4CV3A 5KHLB 4ZDKA 4GT1A 4EG4A 1U0TA 3ZGVA 2NO9A 1UK6A 1W6RA 4OXNA 1ZSVA 4RMNA 1NBEA 4GUDA 1ZEMA 1HLFA 5EPUA 1E2HA 1MIHA 2ZIZA 4LYFA 2XLCA 1JJVA 4DDMA 2P0AA 1VP9A 1JQLB 2QYSA 1TE2A 2VUSA 2BJVA 4ENQA 1N6NA 4ADSG 1GNLA 3QF4A 1QQ5A 2ZYGA 1PK9A 1H6CA 4JQZA 1DAPA 3IULA 1BH6A 3E9EA 1UWKA 1ECFA 1ZJYA 1BE8A 3DYVA 2JLYA 3LUHA 2QBYB 3KHTA 3HSKA 3B48A 3RK1A 5CCBA 1LPSA 1FTNA 3OIYA 4IF6A 3SZLA 1CJTC 3R7WA 1OY1A 1W5SA 3OQHA 2RAUA 4LQDA 5TMBA 3CF6R 2GCPA 4JH0A 2QI9C 4JI4B 3PKJA 1NW8A 4Q3KA 2YHIB 5TY0A 1N2GA 4W4TA 1LJLA 2Q9UA 4RCVA 1LDEA 2W71A 2I3GA 3FWKA 5DGDA 3G5TA 2QLMA 2JH9A 2ZSAA 4TMXA 1Y8RB 2CJYA 3AVPA 3NBUA 4LY6A 4QHSA 5C3MA 1TU4A 4JXKA 4LVOA 5FHRA 2P91A 2WU3A 4OJKA 2PXCA 3ZV3A 5F7ZA 2X3FA 2W11A 2XX3A 4IXTA 2ZCJA 1NX9A 3CO5A 3TKLA 1RLUA 4DQDA 1FP4A 1YDGA 3CT4A 2EL7A 2RBGA 3II6X 2X0FA 3LCMA 4YRBA 3BTOA 1ABBA 4L2IA 2UVDA 3WWYA 1T15A 2QYHA 4ZQCB 3PNKA 1IBKB 1B0PA 2VSQA 4LBVA 1W59A 3J7AC 4K9KA 3UA4A 3VC1A 3VH3A 4ZU3A 1NBWB 2J9RA 4C06A 1F4PA 3EZFA 3HA7A 3K5WA 4B73A 4C0KA 1L5WA 1YNSA 4MVJH 3KSRA 3PPXA 3WJ1A 4XGNA 5FBKA 1JNYA 5K3AA 5TQVA 1ZVJA 5HIAA 3C6BA 1UFRA 2BEWA 2ZUUA 4DAOA 3KEQA 2CMFA 2YJNA 4BFVA 5A4JA 4OJNA 2DHRA 4FYKA 1FFEA 3WYAA 3NTVA 4YREA 2N42A 4BNNA 1PZHA 4BKPA 4CU5A 3TF5A 4A91A 1C8VB 3FTQA 1V6CA 2PD4A 1HSOA 1K7EB 1KQPA 2XR1A 3R7AA 5LQAA 1IPFA 4JJZA 4KO8A 1FE8A 5CCEA 1A76A 4BO1A 4LYDA 3ITNA 1R8YA 3N07A 4BMZA 2QVBA 3MIIA 4A2PA 3PC8A 3HB4X 4BTEA 3CY6A 1YQQA 2X7XA 1BXKA 1XMXA 3OQIB 2VTBB 4G5RA 4GKBA 4L57A 1UM9B 2R6CA 3UK0A 2C0QA 5DCUA 3U7GA 1M0EA 1KVTA 1WUYA 2C58A 2YRFA 4O3FA 2WFAA 3U3MA 1ZESA 5JALA 3T1TA 4CU2A 4NYJQ 1N6HA 1U65A 4FINA 1UQRA 3AVXA 3AR8A 1T3HA 4DR1B 2H1OA 2AMVA 2WP0A 3V7WA 1KQGA 3QPUA 1ECGA 3T5GA 2VHXA 3ZOZA 4DT1B 3KVNA 1J8MF 2PN1A 2QN7A 3WLPA 3VYTB 3RBAA 1K6MA 1VHDA 4DREA 3IJ5A 1RLJA 1TU0A 4ENWA 4IOMA 4ZOLB 3P96A 1W30A 1PT6A 1JG7A 5LU8A 4AKGA 3EA0A 4HWGA 4AYTA 1U7WA 2BEUA 1YFKA 3UWSA 1RWWA 2DR3A 3S27A 1CQJA 4EEKA 1OHHD 1G9XA 3D6AA 3LDHA 1G5PA 4M1WA 1U5BA 2OC4A 3VO9A 4NZZA 2YYZA 1XXHA 3D0RA 1NVDA 3ESQA 3I9NA 3SDSA 2PTHA 3ZV6A 4KB5A 2GZRA 2XZDA 1AS3A 1NQVA 3ZWQA 3ZCPA 4LMRA 7REQA 4URZR 1J2TA 2LKDA 1SC4A 4F45A 3AQ4A 1DNPA 2H7XA 4QOHA 2PAFA 4QXMA 3DOUA 4XWYA 4E30A 3CJQA 2FPPA 3O8QB 5IXYA 2RB5A 3D1VA 3MWYW 4YAOA 3F6RA 2DBRA 1XN4A 4CMBA 2IEYA 4RPJA