4UEKA

Galactitol-1-phosphate 5-dehydrogenase from e. coli with tris within the active site.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
molecule tags Oxidoreductase
source organism Escherichia coli
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uekA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uekA01
1NBOA 1OAAA 4GSKA 5KOIA 3AJRA 5A02A 4KQXA 5G4KB 1ONPA 1DFGA 4JROA 1VKNA 4KQWA 3DMTC 5ENDA 3RBVA 3IJPA 4E2WA 2GUGA 4CLRA 1D1TA 3GA0A 3GN2A 1U4OA 1U7TA 4JQCA 3OJ0A 3GOHA 5FYDA 3OM9A 2XAAA 4ALMA 2JJYA 3MJTA 2A92A 4B7CA 3RBXA 3DMYA 2NLOA 4YRAA 5DBGA 3F3SA 3DC2A 1YS4A 4WCFC 4MP8A 1B14A 3MWEB 3H3JA 3GDOA 1JAYA 1D7OA 4OOEA 2JFGA 1TEHA 2HMSA 3MTJA 4N7RA 3RU9A 3WGOA 4E3ZA 3CH6A 1OOEA 3GH3A 4ND3A 5CEFA 3Q9NA 2ZQYA 3ZWWA 3K2BA 4IQ0A 4QECA 4J4BA 3VH4A 3U5TA 3GF4A 5JDIA 1J6UA 1UDCA 3O03A 1K6IA 2V6FA 1HDYA 1ZXLA 4XD2A 4BNZA 1T1RA 3PHGA 2CFCA 3ENNA 2A94A 1U8XX 4ND2A 4R54A 3QVXA 1M66A 3UCXA 4MINA 1YBAA 3DHNA 4ZN6A 3I9MA 5COBA 4Y98A 1LRJA 2BFAA 3AOEA 1E1KA 3MEQA 4YB8A 3PWZA 1I3NA 3AI3A 4Q3NA 3VH3A 1FXSA 3K31A 5FFFA 1CDOA 2Q2QA 4AJHA 5BQFA 4IXWA 2NU6A 4BKQA 4IY1A 4NU5A 4DC1A 1JKIA 3WXBA 4HUJA 1K6XA 1DRWA 2GCGA 3ZWMA 2OGUA 2YJZA 1MGOA 4O59O 3DAPA 2ZK7A 4YPOA 3QP9A 4DPLA 3P7MA 3GMSA 4K28A 2QQ5A 2V65A 4XDYA 5F1PA 2HRBA 3LF2A 1LJ8A 2DKNA 3AWDA 2NTJA 5DOVA 3ZWYA 2G17A 4BMVA 2GASA 2JCYA 3GRKA 1GR0A 3PLNA 5A9SB 1HDGO 2G5CA 3QWIA 5TC4A 6ADHA 2FOIA 1XU7A 1PR3A 3IDSA 4EJ0A 3VTFA 1V6AA 3JQCA 4IJVA 1WLYA 4ID9A 1Z7BA 1ULSA 3DAFA 3E48A 5F5NA 1ENZA 1HXHA 2VHVA 5GY7A 4CM8A 5CDGA 1E3WA 1X15A 5BR7A 3RROA 1EEHA 1PL7A 3EDMA 4CR8A 1VL8A 2BGMA 3LT2A 2J8ZA 4J7XA 5IN4A 1AUPA 5AQ1A 4DVJA 1I2ZA 4R51A 4A5OA 2FWMX 4RVSA 4CMEA 3DL2A 3ONFA 5JY6A 4HADA 4ZQBA 3GHHA 2DUUA 3IAHA 3FF4A 1PEDA 1Y9EA 4PFJA 4Y6PA 3TWOA 1UJMA 3DR3A 5I9NA 5KJCA 1BW9B 1GV0A 4DPMA 5TT0A 4BGUA 4CM4A 1Y8QA 1YVEI 2X23A 5G4KA 2C0CA 2WEKA 3FN4A 4YAJA 4P8RA 3LSYA 2YHIA 1RM5A 2Y0EA 1B0AA 4RPLA 1D4FA 1CQJA 4HBGA 2EERA 4YJFA 5DOZA 1FDTA 5DCUA 4NG5A 4ZVVA 2Z1NA 5KJFA 1LDYA 1J49A 1YKFA 1NPYA 2HK9A 3H9GA 2Y0CA 4FJ0A 2Q50A 1EUCA 4M8SA 4TVBA 1T25A 4XIYA 3MWDB 2QYSA 5TLSA 2PH3A 2HKIA 1J0XO 3GLQA 1C3VA 3BAZA 1KS9A 1EVJA 1RM4A 4ITUA 3STHA 3W6UA 2O3UA 4BV8A 5JAZA 2JFHA 4CMJA 5DZSA 1UXKA 2GF2A 2QRKA 3VPXA 2EJWA 4RGBA 5ENVA 1LC3A 3H8VA 3FRJA 1SBYA 1PJLA 5EIOA 2NM0A 2IEDA 1ENYA 4BB6A 4B4OA 5A5FA 1T2EA 4BS9A 4A10A 3O38A 3I6QA 1JVBA 2VHZA 3DBHA 3PHJA 3Q9UA 5G0UA 1DB3A 1N7HA 2SCUA 4CLEA 2NTNA 2QZ9A 1LDBA 3M6IA 5KKAA 3ZWBA 3RASA 3QV1A 3F4LA 3IQDB 1DXYA 2Y66A 1CJCA 3KLPX 5JMWA 1VSUA 4BNWA 1I30A 1T26A 1HDXA 8LDHA 2X86A 3U09A 2AEFA 4IZHA 3WX0A 4B7UA 4R69A 3ZU4A 3PGXA 1CF2O 3MJEA 4D42A 3KZVA 4I08A 1N92A 1T4BA 1PZFA 1VI2A 3TQHA 2B5VA 1WDMA 3EK2A 1NX6A 5FI5A 3RJ9A 3KYCA 2OOSA 5T67A 2X9GA 2ILTA 3W8EA 5B4TA 1MX3A 2Z5LA 3OHSX 5A9SA 4Q3CA 1G6KA 2V6MA 4IINA 1K89A 2YUTA 3FWZA 1N5DA 3DHEA 2X9VA 4MVJD 1UXHA 2Y99A 4TVOA 2BGKA 5JDIC 2WE7A 1W73A 2EV9A 1UP4A 2DQ4A 3HG7A 4DBVO 4PG7A 2Q99A 3PYXA 3OFSA 3OIFA 4XIJA 3QW2A 1WDLA 2C29D 4UUOA 1TT5A 5THKA 4CM5A 5H81A 3C7AA 3AY6A 4OKNA 3AOEC 3OA0A 1NVTA 3Q2IA 1I3MA 3CZRA 4A73A 4ALKA 4IDGA 1N1GA 1WMBA 3UFXA 1FF9A 3VPHA 3UF0A 3LQFA 3AU9A 4PLZA 5IFLA 4BKPA 4WEOA 4BNLA 3PI7A 3PQEA 2HQ1A 1E7WA 4J0FA 1PS0A 1PJ2A 3C85A 3ZNQA 4OQZA 2P9GA 1V0JA 4FFOA 4ZRMA 4D46A 1QSGA 3B1KA 3NTRA 4DLLA 4MVJG 4HY3A 1SEPA 3JQFA 1EVYA 5G0WA 3C1OA 4WEQA 5CAEA 1QORA 5G0VA 1UP6A 4DQUA 3VHRA 2GN4A 3B20A 4MVJA 4P22A 2YV1A 3DZIA 4JJIA 3PYLA 5TQVA 4CUZA 2AE2A 3OF2A 1LQUA 3ZHYA 1U7HA 4DPKA 1GEGA 1ZK4A 5DT9A 3ZWOA 4BO2A 4IS3A 4GWKA 3QWHA 4JK3A 1KVQA 3VDQA 4PN3A 1YWGO 4BV9A 4KZPA 1YB4A 2BI7A 3K5PA 4ND5A 2B5WA 4Y6RA 1YOVB 4L8VA 1GD1O 1Q0HA 2A4KA 3R3SA 4W9NC 2NV6A 3UICA 2OBYA 1DJNA 4JLWA 4KWHA 5B4VA 5U1PA 3A28A 1HTBA 1EMDA 2HLPA 2JFFA 2D0IA 3PVZA 4UVHA 4E31A 3TL3A 5B12A 5ILGA 2WYVA 4JCOA 2X7HA 3O8QA 5THQA 1BWSA 3DBRA 5AOVA 3D4NA 3OQBA 1E5LA 3BIOA 4JBGA 2W90A 1A4UA 4RF3A 1XYGA 3L6DA 4BNIA 3WB9A 4X54A 4BNNA 2YFQA 4HKTA 3T4EA 4DREA 3OEYA 3WWZA 4AJEA 2GYYA 5H83A 3Q0EA 1X1EA 1EK6A 4Y8VA 3TZKA 1DDOA 2YHUA 1EZ4A 4CLHA 2YZ7A 1HYEA 3A14A 5MGBA 1ADBA 4OL9A 3WIDA 1DLJA 4W7HA 3R3JA 1FMCA 1LBEA 1WZIA 1R0SA 1YL6A 3U4IA 3WJAA 4RVHA 1ARZA 4NBWA 3S2GA 4CMCA 1NWCA 2ZKLA 1X13A 3MOIA 4PVCA 4E2ZA 3LZ6A 2TMGA 1J5PA 3E9MA 1ISFA 3I3OA 5K6AA 4S1VA 3K6JA 4GX1A 2X5JO 1ZFNA 1K0UA 4R4JA 3NT5A 3PIIA 2OHXA 4Y9DA 2CF5A 1E7YA 1KY5A 4EJ6A 2Y05A 4CMHA 3AW9A 1EK5A 1L7DA 3I9NA 4QFDA 4OSOA 3Q2KA 4D3FA 3KM0A 2HJSA 1P44A 1V9LA 3FNHA 3H9UA 1H6BA 4R1TA 4QFCA 4KUGA 3V1TC 1EE9A 4B8ZA 3GC6A 3WMWA 2Q2WA 4FFNA 2PNFA 3KBOA 1X0VA 4PG6A 3IIEA 3ZU3A 3OEWA 1J4AA 1PL6A 1XR3A 1YBMA 2DPHA 4GGPA 3OIDA 5T8KA 5KJ6A 1U4SA 2GGSA 3WTBA 1RYDA 1H2HA 3WQQA 3KVOA 1HDRA 4D0RA 5JS6A 2NACA 1EBFA 3SC6A 1OMOA 1HT0A 1GZ6A 3KEQA 4ZQGA 4RCVA 1M67A 4IDEA 2YW9A 4R3WA 4IGEA 4E12A 3JCZA 3LC2O 3GGPA 4JNKA 3MZ0A 2I99A 1NHWA 4MVJP 4IIUA 4U0JA 2EJVA 2ET6A 8ADHA 4W7IA 4XX0A 3BMCA 4CMKA 5HWSA 1P0FA 1M75A 1YGYA 3GVHA 1E7SA 2VN8A 3W8FA 1NM5A 1MUUA 1LDNA 3ADOA 1EFKA 4RF4A 1G1AA 2EXXA 5CDUA 1CQIA 1C0LA 2VWGA 3QSGA 5IXSA 3K96A 4PVDA 1Q1NA 5CG2A 1K2WA 3EY4A 4XQGA 3HN7A 4H16A 4J9UE 1SZJG 3QVSA 4FBGA 4CLXA 4TQGA 2E6UX 1QP8A 2HK8A 3CTMA 3K2EA 2FZEA 5AXAA 1HEUA 4AJPA 2JD0A 2YFHA 2GZ3A 2VNAA 4CM1A 3CIFA 1PS9A 2ZCVA 2OBNA 5DN9A 1LLQA 3WFIA 2PZMA 5F5LA 3HDQA 3PGJA 1PGPA 3VDRA 5IZCA 4OM8A 2QIOA 1M6WA 4MP6A 4RPJA 1X7GA 3C7CB 3KETA 3I9KA 2NSDA 4D3SA 3JQFC 5A3JA 3RD5A 4RQTA 3VH1A 5FI3A 1A72A 4DLAA 1UZLA 1B16A 3E18A 3IUPA 2EP7A 3ETEA 3KTDA 2B4TO 2WD8A 2UDPA 5G4LA 3WNQA 3I9LA 5EPOA 1QYVA 3DBVO 4E5NA 2DBQA 3DQPA 4BO4A 1HSZA 4H15A 3AK4A 2W4QA 1VJ0A 5ADHA 2VYND 3T7EA 4XJTA 2GSDA 4TRNA 9LDTA 5A9TA 4LGVA 1MV8A 1YH3A 3HN2A 1MG5A 4QQRA 1Z74A 2ZTMA 2ZB3A 3C8MA 3GY0A 4LSMA 4J7CA 1P1KA 2DC1A 2DTXA 2E82A 2VOJA 1E1NA 5G2OA 4WLNA 3MCVA 3WG9A 3HNPA 1VSVA 3C1TA 2DU8A 3FCOA 4CV1A 3UOGA 5L4NA 3CZMA 5IZ4A 3JD4A 3ICPA 4IM7A 4AJ4A 4QX6A 5AVOA 1NQOA 3F5QA 1E7QA 1V8BA 1V3UA 2C7GA 5JYDA 4YRDA 3GVXA 1OI7A 1NFFA 3C24A 2O3RA 1U2GA 2D1YA 4N5LA 5T64A 4EUEA 2AG8A 3BHIA 1B26A 2NUAA 1ISMA 3PPIA 4FR5A 3UAGA 3VPFA 4LCJA 2QRJA 4BNHA 3ANMA 3E03A 3DZBA 3NT2A 3M2TA 3PZBA 4I1IA 3ROQA 4DGSA 4F6CA 1E3IA 1R4NB 1YJ8A 1LLCA 3WMXA 4IQ8A 4BNTA 4KTTE 1PS8A 1XGKA 5KWEA 4YXFA 1LNQA 1G0OA 5GMOA 1WP4A 4RLHA 1P3DA 4YJGB 2CDCA 3GPIA 3LT0A 3N74A 3D0OA 2C82A 2PV7A 3H2ZA 3HWRA 3LYLA 1XQ1A 2DTEA 4YA6A 3S2FA 5I7VA 1E1MA 1DIBA 3AY3A 3V2HA 3KSUA 2ZCUA 2R2GA 1JKFA 1AXEA 2Q1TA 1I10A 3RFXA 4NBTA 3JD2A 4YAGA 1TI7A 1DFIA 6LDHA 1RYEA 1CYDA 5JC1A 1BVRA 1XEAA 2VCYA 1GL3A 3H6KA 5DP1A 3W4IA 4LVCA 2D5AA 4A27A 2NQTA 4TZTA 2J3IA 3IL2A 3QIVA 5L7WA 3PLRA 2WMDA 4IDFA 1UDBA 4RF2A 3RUDA 4CMIA 4R3NA 2AG5A 1M2WA 1ISHA 4LMRA 3IKVA 4XZ3A 1MC5A 5IXYA 4NBRA 4TZKA 1N9GB 3EC7A 4DRYA 2VHYA 1QRRA 1OC2A 3OJOA 4J91A 3BA1A 1PWXA 3GZNA 1KYQA 4M89A 1FDUA 1OZAA 1H5QA 3U3XA 2Y93A 4DA9A 3FI9A 1F12A 1LA2A 3I23A 1QKIA 4F3YA 1NNUA 3GAZA 1DPGA 2GLXA 3WNVA 4G81A 1T1SA 2IYPA 5CFZA 1ZIDA 2PH5A 1H6CA 1LRKA 2PKQO 3LU1A 1DFHA 1N1EA 4YJHB 3PZRA 4H3VA 4DXHA 2J6IA 2A35A 2O48X 2XPCA 1YQXA 4NJOA 4Y6SA 3I83A 1KY4A 3KSZO 4IDAA 3FHLA 2EGGA 2EG9A 3UN1A 5EL0A 5L51A 3FTNA 1KBZA 1UR5A 2I66A 4JXKA 2JHGA 2OUIA 1SAYA 3RCBA 3HJAA 4GWGA 4Z6KA 4HX5A 4WLUA 4BIIA 3OP4A 2TMDA 3ZWCA 2R00A 4OIMA 4D3DA 2HJRA 4LK3A 4OGWA 4NU6A 3U49A 1MXHA 1X0XA 2H5LA 4ZRNA 1UUFA 4C7KA 4UREA 3G49A 3S55A 5C3MA 2C07A 5IZCC 3ZHXA 3NJ4A 2H63A 4HV4A 2IXBA 3D1LA 3E1KA 3M2PA 3GRPA 4OQYA 2O3JA 1ADGA 3GEMA 4Z3KA 1T2CA 1ZBQA 3BMQB 1U3UA 3V5NA 1T2AA 1KC3A 4OXKA 5JO0A 3ZHZA 3GDGA 3WS7A 4K1LA 4BUCA 1GV1A 1PGOA 1PJBA 4QUKA 4PLFA 2P91A 4E2YA 5C7OO 2V7PA 2DBRA 5EQDA 1MFPA 3E5MA 3GK3A 4CL3A 5IF3A 4E5PA 2POQX 5JAIA 1GPDG 1DO8A 1PQUA 1TLTA 3NYWA 4FFRA 3UW3A 1LUAA 1U3WA 2Y1OA 3AUUA 1NFQA 3PDJA 4CV2A 1U8FO 3D5TA 4RF5A 3GN1A 1LI4A 1SB8A 3WOHA 2ZQZA 1ML3A 1ZJYA 3FPLA 3QWFA 1VJ1A 2WYUA 3L6OO 5JYEA 1PGQA 3VPSA 4IGFA 2V6BA 1SOWA 1P1RA 2DVMA 1P1FA 2FZWA 1NWHA 2VYVD 3IS3A 1P1JA 1Y6JA 1QYXA 4NBVA 2FPGA 3SXPA 3JD0A 3PHIA 1Y5RA 4H7PA 3GR6A 4UEOA 3S2EA 4J43A 4CMAA 1GUZA 3KOUA 4RPHA 3WDSA 5HA5A 2WJPA 5JBIA 3F6YA 1N9GA 4FGSA 5JDCC 3ASVA 1MP0A 4BO0A 2Y1DA 3JQAB 4NIMA 5L40A 3C3XA 3EZLA 3EMKA 4NJMB 4R1UA 2VTEA 4OYRA 3PHLA 1B8VA 4CLDA 1LDGA 3DB2A 1ZK1A 2WM3A 1GYRA 4W82A 4BMSA 4CQLB 1R4MA 3TPCA 3PJGA 4RO0A 2Y1EA 5A06A 3RSHA 2WDZA 1V35A 2RCYA 4PLTA 4KDEA 1GY8A 4GLLA 1PGJA 4XYGA 3KV3O 2AQKA 2AEMA 2P4QA 1RJWA 1T2DA 2CVQA 2HMVA 4LRTB 1CETA 2X6TA 5CG1A 2O4UX 1JWAB 1XA0A 2FR0A 3F4BA 3VOSA 3ZCXA 4KMSA 4DMLA 1B2LA 1KVTA 2AHRA 2ZATA 3FNFA 2EF1A 1TT7A 4EGFA 3CMMA 1DHTA 1LRLA 4YAEA 2PD3A 2VYVA 3QWAA 4XKJA 3VTZA 3OETA 3CKYA 2PGJA 4EW6A 4E32A 1VC2A 1U9JA 5T6BA 2VNSA 2YY7A 2C7VA 2IODA 3C7DB 2D8AA 3NX4A 4WOKA 1CWUA 3WBBA 3RBZA 2XXBA 1C1XB 1NASA 2E48A 3MTGA 5HRUA 2PA3A 5DBIA 1U5AA 3TJRA 1DLIA 3NUGA 1O94A 1FJHA 2UV8A 1XG5A 3OICA 3TSCA 2I6TA 2VWQA 3F9IA 1C0KA 4MVJM 4FC6A 4GLOA 1IYZA 3ZN2A 3PFWO 4MJLA 1L7EA 4MKXA 1UH5A 4YYZA 1SO8A 2JKVA 3JQAD 4ZA2A 5IJZA 5I7FA 3X2FA 3NGXA 1SCUA 1PR9A 1H9BA 2PD4A 1XSEA 2WE8A 2VRBA 4GGOA 1HDCA 4B79A 1E6UA 4II3A 3BTUA 1U3TA 4R5MA 3QVOA 5EINA 3AY7A 1I33A 3EUWA 4Z0TA 3QY9A 2PGDA 1QYCA 1BRMA 2YDYA 5C37A 4CL8A 2X5KO 4O6VA 2HDHA 4KWIA 2H1SA 3D3WB 5F1KA 1XELA 3GNTA 1ZK3A 3INTA 3P5SA 4OH1A 4NQZA 4A7PA 2P5YA 4IZIA 1E7MA 1PZGA 4PRLA 5TX7A 4DTIA 3MOGA 5CPBA 4FJ2A 1KEWA 3L4BA 4OKIA 1C1DB 3JQ9A 2CNBA 4OSPA 3IJRA 4EEXA 3JTMA 3KHUA 4L76A 4N18A 1P74A 1NQ5A 1UAYA 1KEUA 3IP1A 5KJEA 5BSHA 2FP4A 4XWYA 5KVVA 2BELA 3JQAA 3B6ZA 3DBLB 4IIVA 4ROSA 2XF8A 4NJMA 5A4DA 1LSUA 3MJ4A 3NAQA 2D5CA 4GKBA 1C0PA 2Z1MA 3CMCO 5KIAA 3EZYA 2B83A 4EJMA 3FBGA 1YB5A 2FSVA 4O5OA 4BKUA 5K0ZA 2GD1O 1DIGA 1XCBA 1QLJA 1IY8A 2WTBA 2RAFA 3INGA 4AFNA 4N5MA 3WQRA 5A1TA 4TRMA 4R16A 1WMAA 1O6ZA 4EDFA 1PTJA 2H9IA 3GDFA 4PLWA 3OBBA 4IMRA 4TKMA 1P33A 4P38A 3OH8A 1U2DA 3TF5A 1BW9A 3DZGA 3L6EA 3QHAA 3KEOA 4XRRA 3RFTA 4DWVA 1IUKA 4NDNE 1GFSA 3OQ1A 2Y68A 1EQ2A 2B4RO 4OHUA 1GYPA 5COAA 1YJQA 1LLDA 3DONA 3AOGA 3WJ7A 1NR1A 1ZK2A 4PLPA 1LSJA 4IDBA 3ZNNA 4AJKA 4D7AA 2O3TA 3IMFA 1UZNA 1C1XA 3HADA 3CPSA 3L77A 2HMWA 1IL0A 3NTOA 3JQ8B 3HE3A 3UH1A 3WGQA 3MJCA 4FD3A 2Y67A 3ZNPA 1RKXA 3CEAA 3WGTA 1A9YA 5IDQA 1JLLA 4BHTA 4XRGA 1V3TA 2AA3A 2UVDA 1E3EA 1F8GA 3RUHA 5JCJD 4P4NA 5L4LA 2J3KA 2D4AA 1YRLA 4BGEA 2IZZA 4IJUA 4LW8A 1YO6A 3PJFA 4NH4A 1R12A 3ZGYA 5TJ9A 3DTTA 3M1AA 3R1IA 1O0SA 1X1TA 3RWBA 3T7CA 2GN8A 1IE3A 1P1HA 3U62A 4EEZA 4WNIA 4CMEC 3BMNB 5LC1A 2ZTVA 2D3TA 4HFJA 4BO1A 2Q49A 2P5UA 3RUIA 3BMOB 1SMKA 2B69A 3JQBA 1DHRA 2OL4A 5L53A 1ZUD1 1EFLA 4OXNA 2EKQA 3TFQA 4QTZA 2P68A 4DMMA 1O95A 4FGWA 3LLVA 3RAJA 2NVWA 2AMFA 1PIWA 3H65A 1ENPA 3K73O 1ZH8A 3JQ7B 1M76A 7ADHA 1DC4A 4WE3A 4F45A 1E0DA 1YQGA 2XXJA 2A9FA 2C59A 5BNFA 2W98A 5JNLA 3SLKA 4AJNA 1W6UA 2I67A 1W8DA 4WCFB 3ZU5A 4ALJA 3GVIA 3G3EA 4FSHA 2Y0DA 4RLSA 2P2SA 4ZGWA 4NFYA 3SJ7A 4D0SA 3GMDA 1E5QA 4UVDA 3RQSA 5JCJA 5A04A 2GN6A 3DOOA 1FK8A 2BLLA 5DF1A 3AUSA 3AUTA 4Q3DA 1BVUA 5FEUA 5K9ZA 1MFZA 5IDXA 1ZO8A 3PEFA 4JJGA 1HLDA 1HYHA 2VHWA 4YACA 4GPD1 2ZTLA 4K6FA 5B37A 1YBVA 2W2KB 1H93A 3U0BA 5JAMA 1E3JA 2CSUA 4KUEA 5LDGA 3G1UA 4RPGA 4R01A 1YE3A 4XGKA 2VOEA 4DIOA 5KJ1A 1BXGB 1QYWA 4RQUA 2X22A 2HMUA 2VZ9A 2O4CA 1NPTO 5L9AA 4MP3A 4QXMA 2ZYAA 1BG6A 1ZSVA 3V2UA 1KVRA 5IDWA 1KERA 1VL6A 4L4XA 3U4CA 3D4OA 1GQ2A 3QJ5A 3T4XA 3GFBA 2WD7B 4JGBA 3WGGA 4GBJA 1ZSNA 4XB1A 4PLYA 4UVIA 1ZVMA 2BH9A 1GUYA 1EE2A 4FFPA 3HHPA 2PKRA 4CM3A 1QV6A 7MDHA 1Y9AA 1ZNQO 5A05A 3LK7A 3I9OA 4B3JA 3S2IA 5CEEA 1ONNA 4BO3A 4WGGA 1AGNA 4I5FA 4KUHA 4YJDA 1IHYA 1FDVA 3L4BC 3JQ9C 3H5NA 3DHYA 3K92A 3PK0A 2PD6A 4LVUA 4P4LA 3VVCA 4L74A 4EITA 4WASA 5EMHA 4PIVA 4L4RA 5KVQA 3U4HA 2PZJA 3QVWA 3RUAA 2B36A 3ITKA 5HM8A 2QZZA 3ENKA 2HAEA 5TNXA 2NVUB 4PZCA 4A2CA 3W8DA 1PZHA 4RDHA 1MC4A 4J49A 1DAPA 1YOVA 4TSKA 4CM9D 3OJEA 4ZU3A 1YQDA 4CLOB 1DC6A 1I5RA 4BNFA 1C0IA 4PCVA 4ND4A 1LTHR 1XWFA 3TFOA 2G0TA 4OO3A 2C5AA 4PG4A 1Y8RB 2VRCD 2DBVO 3BMOA 1U3VA 1X7HA 3QLJA 2AXQA 3WYBA 4U8GA 4HNHA 4MIEA 3GVPA 4Q39A 4XQ9A 3BTOA 2HU2A 2H6EA 3GUCA 3ON5A 4WPGA 3L0DA 4MO2A 4W6ZA 4LMPA 2O7SA 4BO7A 3I4CA 3Q6IA 3G79A 3JQ7A 5F1OA 3DOJA 1UXGA 5JY1A 4A26A 2IZ0A 1N7GA 3ROKA 5ICSA 4E5YA 1HZZA 3W6ZA 4QO7A 4WCFA 4HFNA 3WLFA 3PRJA 4ZICA 4Z9YA 4AJJA 3KYBA 2G1UA 2Q4EA 1JA9A 4Z3DA 3UHAA 1PWZA 4CV0A 4PZDA 5GZ6A 2Y1CA 1S7CA 3ZW8A 4HFRA 4FS3A 1DC5A 3VZSA 2OO5A 4CM9A 4OMUA 2G76A 3TZ6A 1YXMA 1BXZA 1E3LA 2O3QA 5L3ZA 3UKOA 3CE6A 4N54A 1GZ3A 1PU2A 3HDYA 2CF6A 3PJEA 2B37A 4BNMA 4U5QA 1BDBA 5TSDA 3O4RA 2W2KA 4YWJA 1FDWA 2EEZA 1PJ4A 2WYWA 5HBRA 3UVEA 1Q2XA 4J9VA 2VRCA 4TROA 2ZB8A 4F6LA 3GGOA 5F3RA 1I0ZA 1DIHA 3TDKA 2GNAA 2O2SA 2VZ0A 5DBFA 1BXGA 1NPDA 3A06A 4XJSA 1JAXA 5TF4A 1A71A 4NHEA 4BNUA 2NVBA 3OIGA 5U4QA 1Z6ZA 2X0IA 3RUCA 1UAGA 3HDJA 1IPFA 3JQBC 2NWQA 2W2LA 3RFVA 3VAZA 1HWYA 2Q4BA 1UDAA 3WFJA 5JE8A 1SPXA 2OP1A 1MB4A 3GUYA 3ONEA 4IDCA 3RUFA 4NFSA 4ZQHA 4CLRB 5KVSA 3ONDA 4HNGA 2PR2A 1F0YA 2BFMA 2YDXA 1F06A 5K1SA 1N8KA 4PLHA 2DUWA 3SBOA 3WR5A 3QA9A 4XQEA 1H0KA 4I8XA 2BFPA 4CUJA 4XEHA 5AYVA 4EZBA 4R9RA 4YT5A 2V6GA 3MJSA 5DCWA 4XGNA 4RVDA 4BNGA 4A0SA 2OMEA 4WECA 2JL1A 1GCUA 3O9ZA 1F17A 4N5NA 4ALNA 5I9LA 2NU7A 5U9CA 5BNTA 3PQDA 4PZEA 5K6AC 2EWMA 1VE9A 4PLCA 3JYQA 1H94A 1QV7A 4Q9NA 1ISIA 3PXXA 2D2IA 4ZJUA 3EHEA 1HSOA 1VPDA 1EQUA 5GZ1A 4WNCA 4OXYA 1Q0LA 2QX7A 1YB1A 2NQ8A 3RIHA 4JP2A 1CERA 2I5PO 3OA2A 4D44A 4E13A 1Z45A 3V8BA 4FOSA 1Y8RA 3HFSA 3GG2A 2O7QA 4E33A 1F14A 3CXRA 2FY8A 3GNSA 2JAPA 5T8KC 1OBFO 1YL5A 3F5SA 4DC0A 1QMGA 1ZSYA 1UZMA 4M1QA 2UYYA 4ZD6A 3RC9A 4XDZA 1A27A 3I4FA 2BMAA 3E9QA 4XR9A 4UAGA 3NV9A 4UUNA 2IE0A 4YTEA 3WYCA 4OJNA 1WDKA 2GR9A 3ETGA 3KLMX 5H82A 3AM3A 4B8WA 1ISGA 4GVLA 4YT8A 4O63O 4FW8A 1X7DA 2HCTA 2HO5A 2XOXA 4CMBA 1HDZA 1R16A 1ZKMA 2J5RA 3D3EA 3DXFA 3BYZA 3HFGA 4K26A 3WICA 4MIOA 4LRSB 1YONA 5COQA 3I6IA 3FTPA 4L73A 2CUKA 1ZJZA 3FWNA 3ZV3A 2PTGA 5C5IA 3L07A 2BFOA 4I9HA 3EGOA 1SEVA 3DZJA 3TRIA 2FPIA 4GAEA 4IJKA 5FWNA 4NFHA 4PG5A 4J3FA 4XR4A 1E3WB 4TWRA 4Y67A 5KKCA 1ADCA 4CM7A 3GQVA 4M49A 5JXWA 4NPCA 3ZI0A 3IOYA 1I2BA 3QVTA 3TNLA 1T4DA 4U6SA 3RKUA 2EKPA 3GZ4A 3EAGA 1PZEA 2J5KA 1QG6A 1O9BA 1F8FA 3P19A 3BXXA 4WK6A 5F21A 2VT2A 3BTSA 5TIIA 3DWFA 2ZIZA 1QLHA 4EYEA 1BGVA 5CP8A 3ZU2A 5B1YA 1K5HA 3H5AA 4M55A 4CM4B 1Y8QB 3LT4A 4NR0A 1GUFA 1JDJA 5JPIA 3H4VA 4CUKA 1AHIA 1PQPA 2YHIB 4RDIA 1ADFA 4R5HA 4XCVA 1RWBA 1XHLA 1HDOA 3FR8A 3JQGB 4YJFB 1R4NA 2IDZA 4YRBA 2X0RA 1QR6A 3UGKA 3EVTA 3ZHBA 4UUMA 2I76A 4YDRA 4DQVA 3COSA 4HP8A 5G0SA 3LVFO 1DRUA 2R6JA 2OFPA 2NTVA 1O8CA 4YJGA 5BSFA 5IG2A 5CDSA 1DBVO 3L9WA 4BNVA 4F46A 3S8MA 1JTVA 3CSDA 3D7LA 1NAHA 2X1HA 1B3RA 1GCOA 2DFDA 2GERA 1NVMB 1XKQA 1VRWA 3SC4A 2ZTUA 1ULUA 4OAQA 1WPQA 3QQPA 4D79A 4R1NA 4RZIA 4J0EA 2X58A 4EUHA 4MVJF 4Q3EA 1R0LA 4J6FA 3DZFA 4YR9A 2E37A 4FN4A 4GQAA 3VZPA 2DPGA 3DBHB 4J90A 4NK5A 1EBUA 2NNLD 3I9JA 3KXDA 4L9RA 4K9DA 3LC7O 3KB6A 3MJVA 4U6QA 5JC8A 1K6JA 1UP7A 4PLGA 3RUEA 5I8WA 1PGNA 1LDEA 1B7GO 2D59A 3P2OA 4QT0A 4LISA 4DBZA 2HRZA 3I52A 2NU8A 3JQEA 4YCAA 3JYOA 2AQHA 1H6AA 2P4HX 4RZHA 2CDAA 4ESOA 4IQGA 4KP7A 5L7TA 5ER9A 1I32A 2B35A 4G5HA 3KYCB 5T57A 1EUZA 3WSWA 4XYBA 1DRVA 5LCXA 3P2YA 4BOYA 4YJHA 5TS3A 3DZHA 4MKZA 4Z9FA 4E21A 4BO6A 2X5OA 1Y5MA 4XYLA 4J1SA 2ZB7A 4FIZA 4CQMB 2NADA 3H9EO 1ORRA 1NQAO 1KVUA 1QXSA 5KCZA 3Q1LA 2PZKA 4GI2A 3UUWA 4ALLA 4HFMA 1K3TA 5FF9A 3H9QA 3I1JA 3NDRA 2DFVA 2IXAA 3B70A 3JD1A 3UCFA 4W9NA 5DCYA 4YBZA 4AJLA 3D4PA 4RVUA 3ETDA 4KDFA 1ZMOA 4YEDA 2VZ8A 3E5RA 3SEFA 3VH2A 1TT5B 4GMFA 4CM6A 4KTVE 4NBUA 4P4GA 1A7AA 1HF3A 1DAOA 2AE1A 4PG8A 4AJ1A 3KSDO 4GH5A 2VUTA 3WWYA 5TT1A 2GPTA 3VZRA 1LQTA 3HB5X 3ROPA 1FDSA 4CODB 3RJ5A 4DUPA 4RL6A 1MXFA 4PRKA 2BGLA 4J2HA 2FR1A 4B7XA 1TA4A 3JV7A 4GMGA 1R0KA 3GVCA 4NNJA 1TXGA 4R1SA 1R6DA 3JQGA 4EUFA 3BMQA 3QRWA 2FN7A 3F1KA 1YL7A 4DL9A 4BMNA 3RVDA 3I5MA 3GAFA 1WWKA 3TN7A 3TOXA 1E6EA 1YDWA 4M86A 4DYDA 5EQFA 1LC0A 4ILKA 1H6DA 2JD2A 3V1YA 3ASUA 5TRTA 5I9MA 1ZK0A 3O26A 3OMLA 1E6WA 2Q2VA 5BSGA 3TL2A 4AJOA 4Q3BA 2VWPA 2Y1FA 2C2XA 2F1KA 1NAIA 1IHXA 3U4DA 2GN9A 1GADO 2DM6A 4CQMD 2J3JA 2Q1SA 3PYMA 1KETA 4HWKA 1B15A 2X4GA 3ZWVA 2W8ZA 4AJIA 3NRCA 5L4SA 4YVFA 1RM3A 1HE2A 3ZH2A 2R00C 3VKUA 1GZ4A 3DEYX 4BGVA 1BDMA 2AEJA 4QEDA 3NEPX 1GDHA 3O8QB 3DBRB 4JJFA 1EDZA 4II2A 4RPKA 4BNYA 5BSEA 1GQYA 5ES3A 4Z9XA 3KO8A 2JAHA 4FOOA 3ITDA 4JP3A 4BO8A 1BHSA 3RC2A 5C7LO 1HETA 4BGIA 4J2OA 2Z95A 4Z0HO 3U9LA 4G2NA 5JCXA 4TRRA 3ZNOA 1ISJA 3A9WA 4E2XA 2DTDA 1XLTA 3AUAA 5C7IO 2IRWA 5HS6A 4BQRA 1I36A 3AM5A 3S1LA 2YQ5A 3WTCA 5IN5A 4UVEA 1P0CA 1VJTA 1X14A 3DOCA 4CQLA 4PLVA 4L0QA 2ZJ0A 4LSWA 4UULA 3AI2A 5ER6A 2B4QA 1NQTA 3NTQA 1E77A 1PJ3A 3GT0A 1IZ0A 1PX0A 3SLGA 5IDYA 3VZQA 4XQCA 1H9AA 4CQMA 3GEGA 2VHXA 4D45A 2GRAA 2PZLA 3M1LA 4CV3A 2PWZA 3H3FA 2ZYGA 2VUUA 1GAEO 4LN1A 5EERA 1B3BA 3BHMA 3F1LA 4UVGA 3WGHA 5IAAA 4B3IA 2OP0A 4B4VA 3PFFA 3LT1A 1AE1A 3EW7A 1DIAA 1SC6A 2I65A 3Q11A 4MVJI 4BQPA 2JCVA 4IJWA 4FQ8A 3AFNA 3LDHA 3WGZA 4ND1A 3IKTA 4Q3AA 5JSFA 4R9SA 3PWKA 3ZDFA 2I3AA 5KTKA 4MVJH 4E0BA 5JMPA 4A03A 1LLUA 3GG9A 4AICA 5JLAA 2JCXA 5I8ZA 2GDZA 1OFGA 1NVGA 3GPDG 3HB4X 2Y1GA 4AJ2A 4MKRA 1JN0A 5EESA 2E4AA 4FPXA 5I7EA 3E82A 1B8UA 2E49A 2O23A 1ONOA 3ULKA 5KVCA 2Q3EA 4JBIA 1MLDA 1G0NA 4FC7A 2Q45A 1L1FA 3W4JA 1UXJA 3HZZA 3CINA 4LCEA 1S6YA 3CUKA 4BNJA 4FB5A 2YQ4A 3GHYA 1ZXBA 1LEHA 4YAKA 1ZEMA 4CR6A 2VQ3A 3LC1O 5A5EA 3DZKA 5DULA 2CMDA 1SOVA 1XQ6A 3L9XA 3PDUA 4IUYA 3F46A 2PLAA 3WBFA 3LLSA 4BO9A 2O2YA 4JN6B 4FDAA 4D41A 3QWBA 3BZUA 2OZPA 3B1FA 2RHRA 2RHCA 4M54A 5TGDA 3BMCB 3ST7A 2FPPA 4GX0A 4XGIA 4WKGA 3D3WA 1IZ9A 1I24A 2VWHA 2VT3A 1R37A 3AU8A 2FR8A 3DFZA 2OXIA 3TOZA 3KYDB 4JBHA 1ZZEA 2QHXA 3ABIA 3ZWPA 3PQFA 3OSUA 2ZJ1A 1DJQA 1HZJA 3G0OA 4E5KA 3FR7A 2BD0A 3ZV4A 1O5IA 1C1DA 1JW9B 2EP5A 5L95A 4JIGA 4DQXA 2HUNA 4MOWA 4ZHSA 1SB9A 3JYLA 4CR7A 2JD1A 4XYMA 1W0CA 3F47A 3V2GA 2C20A 3KUXA 3WLEA 1ZW1A 3ORFA 4IDDA 4TKLA 5A03A 4INAA 1P45A 5TJHA 3ZV6A 2PFGA 1WVGA 2IYOA 2EW8A 3A4VA 1IB6A 4WLFA 3DBLA 2WSBA 3JSAA 2GO1A 4J1QA 1EUDA 3K8ZA 2CVOA 1HRDA 5AXCA 4KOAA 3IC5A 4NZ9A 4B3HA 3SJUA 3H7AA 4WOJA 4GSLA 4RVFA 5CHEA 3ZZNA 3JYPA 1SNYA 3VC7A 3VKVA 1HE3A 1PJQA 3JD3A 2DLDA 4UEKA 1HLPA 3N58A 3ZWXA 3K30A 3E6AA 5KNLA 3NKLA 4EI2A 3PHHA 2CY0A 2C5EA 1UXIA 3D5QA 4YT2A 2GZ1A 4J4TA 2QYTA 2VUSA 4UEJA 2QG4A 2BKAA 4L4SA 3RKRA 4YAIA 1BSVA 1U5CA 3OECA 1I3KA 5EN4A 4WLOA 1NHGA 5ILOA 2ZYDA 2OORA 2Q1UA 1LSSA 4E5MA 1XDWA 2O3SA 1B8PA 1ZEJA 3RC7A 2HK7A 4RJTA 1ENOA 1D3AA 1Y7TA 2Q46A 1RM0A 3WQSB 1XU9A 3IUSA 1EVIA 4FFMA 5L45A 3G1TA 4WLEA 1CIVA 2BHLA 3WSVA 1Y1PA 4TRJA 3JQ8A 5L7YA 2B0JA 4MVJE 4RVGA 1AHHA 3E8XA 1PJTA 5HTOA 1BXKA 1LX6A 4CJXA 1DC3A 1KOLA 1Z73A 1HE5A 1WZEA 1PJCA 2FRDA 3UXYA 2WWRA 2C54A 2HMTA 2YV3A 3ADPA 3E9NA 4I5EA 2X9NA 4AVYA 4G65A 1PL8A 3HQ4O 4JX8A 2O50A 3DDNA 3H9JA 3BTVA 3L4SO 3QE3A 3ZW9A 3FD8A 4GL4A 3ANLA 1JQBA 2AQ8A 1XIVA 3GFGA 3SVTA 3BHJA 3RU7A 2CD9A 4IBOA 3B1JA 1TVEA 2FMUA 4IMPA 1GTMA 3WGIA 1VKOA 4HXYA 1VM6A 1ZCJA 1HE4A 3EVNA 1NXQA 4GX5A 3BMNA 4J16A 1PSDA 3DTYA 1KIFA 3H5RA 1WXDA 4TMFA 4CMGA 3NGLA 1LU9A 1P9LA 4J1TA 4PGFA 3NDIA 1EDOA 3KYDA 1DOHA 3PIDA 1ID1A 3DMTA 1GYQA 2W2LD 3PP8A 3JQ6A 1MA0A 1OC4A 4RORA 1VLLA 3FBTA 1QYDA 3FNEA 4NMHA 1ZMTA 3HDHA 4YT4A 3AM4A 2PKQP 2P9CA 4ALIA 4E30A 3PJDA 1H2BA 4MDHA 2EIHA 4NK4A 2I3GA 2J5QA 4IXTA 5MDHA 4CMIB 1LXCA 4URFA 5JFOA 5AXDA 5J23A 1KVSA 3OQ6A 1O89A 2CZCA 1U28A 1BMDA 5HS4A 3FSRA 1IPEA 3ZWNA 1PJSA 2LDBA 1Y81A 3GZNB 1C14A 1P77A 4NI5A 5T5QA 5ITWA 3GNQA 1PQWA 1R15A 1E1LA 4U0KA 3WYEA 3C1AA 2BF7A 3D64A 4U7WA 3WIEA 2BI8A 2PY6A 5DNAA 3X2EA 5CEJA 3N7UA 4BKRA 2DT5A 4XYEA 1U1IA 2P9EA 1DSSG 3DAGA 3JYNA 3TZCA 4DLBA 1Q0QA 3AFMA 5BNIA 2IZ1A 1A4IA 2EKLA 4R41A 5B4UA 3PWSA 5A3VA 1NTOA 1RPNA 2BRUA 4GKVA 1P31A 5CDYA 1WAMA 3W1VA 2HSDA 1D1SA 3RI3A 1JWBB 3ANNA 3ZWAA 4WUVA 2RBEA 1D8AA 2WD7A 2UAGA 3OJLA 3PTZA 2EW2A 4I5GA 3GEDA 5GZ3A 1EVZA 2QRLA 1NYTA 4I9UA 1T2FA 9LDBA 2UUPA 4W4TA 2FSSA 3Q3CA 5I7SA 2I9PA 2FHSA 1W4ZA 3VVBA 2RH8A 1NFRA 1P1IA 1AXGA 3DO5A 4K6CA 3RC1A 1JVSA 4BKOA 3OJFA 4AL4A 4ONEA 4EBFA 1A5ZA 4XB2A 1TB4A 1YDEA 4QO8A 4WLVA 2RIRA 5ITVA 1IOLA 1CRWG 1NP3A 1GPJA 1WW8A 2X8LA 3H2SA 2CDBA 3G17A 3KRTA 3DFUA 1T24A 4YQZA 4RV9A 3V1UA 4BVAA 3JQDA 4FCCA 4IS2A 1AN9A 2X0JA 5JDCA 4ZQEA 4MPDA 2NVUA 5G0TA 2AQIA 3AI1A 4CPDA 3IP3A 1I8TA 5DDIP 5AXBA 1DIRA 1Q7BA 4DIFA 2UUOA 4UUPA 2DAPA 4CLOA 3ZV5A 3K9QO 3FPCA 4C4OA 1JU9A 1CEQA 4GX2A 1NR7A 4J4HA 1GEEA 4DIBA 1LSOA 2X0NA 2YYYA 2ZB4A 4Z0PA 2VYNA 5EJ2A 5JO9A 2JHFA 4ZQFA 2GZ2A 2PGLA 2AW5A 1KEPA 1Q7GA 4E6PA 4WCDA 3HUDA 3R6DA 1I01A 2RH4A 4J7UA 1E92A 2G82A 5CPFA 2Q1WA 4I5DA 2VTDA 3A1NA 1HKUA 1WNTA 2J3HA 2YV2A 5JW6A 3R0IA 4BNXA 1I3LA 4B4WA 4S3MA 5ICMA 3WGYA 2IEBA 4E4YA 4R68A 4AG3A 3ROMA 4GVXA 5BT9A 5DP2A 2F00A 1HYGA 4XA8A 5CDTA 3FNGA 1M6HA 4I9NA 3INRA 4O0LA 1R66A 5LDHA 1E3SA 3LF1A 1KEVA 3TZQA 3NDJA 3UCEA 2EHDA 1VL0A 1DEHA 3VPGA 1Z82A 2CVZA 1IULA 1BTOA 4BO5A 1V3VA 3NT4A 4FFLA 4B4UA 4C7JA 5A9RA 4O1MA 1MG0A 2C2YA 1Z75A 3W4KA 1R4MB 4J1NA 4CM8B 4L75A 2PK3A 4WJZA 1Z7EA 2QW8A 4QSMA 4MIYA 1Q7CA 1E7RA 1I2CA 2LDXA 3EYWA 1GQQA 1HL3A 1A7KA 4W99A 4D43A 3GGGA 3HSKA 4M87A 5JAQA 1A9ZA 1N2SA 4FJ1A 1JKJA 2EGHA 2DBZA 4BB5A 4YQYA 4DYVA 2NU9A 1KC1A 1GU7A 1LDMA 4IPTA 3ICCA 4BL5A 3SX2A 3NJ8A 4OOFA 3TZHA 4BNKA
chains in the Genus database with same CATH superfamily
1NBOA 2H1RA 4LKRA 1OAAA 4Z4HA 5KOIA 1VMEA 3AJRA 2XWSA 5E1OA 2ZJ7A 5G4KB 1NVWQ 4CDMA 3G5LA 1P2TA 5JALA 3VA7A 1X87A 1EFTA 3P9XA 1HFKA 1VKNA 2FFQA 3DMTC 3RVNA 2NMVA 4PSDA 3NASA 1Q1AA 2XUJA 3GN2A 3ZTTA 4EGQA 4WA8A 1AGXA 1QKJA 1S4QA 3OM9A 1NRWA 1U1DA 4GE3A 5KNCD 3I0NA 4LF8B 4B7CA 2A92A 3GRUA 3ID6C 4FEYA 1HL7A 4W1RA 1EX9A 3RBXA 2ZM6B 5B30A 4B43A 1AK9A 1SHJA 4HPXB 3UWPA 1UFVA 3F3SA 3VOBA 2B8EA 1PG0A 3RVQA 4GDFA 1A7JA 1Y8AA 2V5VA 3H3JA 1ES9A 4OX9Y 2P9QA 2G3YA 3M4NA 2OD9A 1D7OA 2JFGA 4M0EA 1E6CA 3ACDA 3CH6A 1U28C 2PSDA 3GH3A 4MYSA 2ZQYA 2SKCA 1YZNA 2VAMA 2XNDA 1G6Q1 5JDIA 4PM4A 1Q77A 4AQDA 2XUHA 4MKIA 4HAXA 1EX7A 1K6IA 5C1IA 3P9CA 2GEUA 1HDYA 4O1HA 4NESA 4XD2A 4BNZA 1YZYA 2BFBB 2A0KA 4K9OA 1IZYA 4PQYA 4GLBA 2ZJ4A 4ND2A 4RD6A 2BM8A 3K72B 4JDUA 4X8HA 3DHNA 2ACEA 2RHDA 5IAGA 1G55A 4ZVUA 4GUDA 3EDRA 3PA8A 4WXHA 2VH5R 2CXSA 1T1EA 4ADSG 4BTVA 5CFPA 1BEEA 2HQBA 3ZHRA 2GS9A 4G5GA 4QJIA 5IT5A 4PX5A 1WCXA 3K31A 3LRXA 5FFFA 1KEEA 1E9AA 3NIGB 1G2PA 1V8DA 2OZLB 3MINA 2PDAA 2FEXA 3VNQA 2HJVA 2IUUA 4AJHA 3DUFA 1UDXA 2IPXA 4IIDA 4RH1A 1U2PA 2IS1A 2NU6A 3JWEA 2AK3A 2J6HA 1OGIA 3A1DA 4G8JA 3IDZA 5J4HA 1KJNA 4RAOA 3OHMA 4N0QA 4PAWA 2GCGA 1DRWA 1TTTA 4DQLA 1NVVQ 1ISSA 1G8YA 4TLAA 1FW8A 1NC3A 1RKUA 1USIA 2BGIA 5IHPA 2A0YA 4WXRA 2NVOA 4YPOA 3ABOB 4DPLA 4K28A 4WNAA 2QQ5A 3TMKA 2BUCA 4B3CA 4DBLC 4IV8A 4EPVA 3EZ6A 3V7UA 1BHO1 2SECE 3AL0C 3IVGA 4B6FA 2HRBA 4W8OA 4DN6A 2DKNA 1E8NA 4EB3A 2NTJA 3DMGA 2G17A 1NJ8A 3QU7A 4OAPA 3H0KA 1VE1A 2PG3A 2JCYA 4F5ZA 3K7EA 4QGSA 6GPBA 4A8JC 1WXWA 1XU7A 2FP4B 4EJ0A 1FP4B 3C6YA 1NG1A 4IO0A 4N49A 1FLVA 4IJVA 1CB7A 4O8CA 4RLFA 2F1HA 3DAFA 3K1AA 2DPMA 3T1YB 2DWQA 5F5NA 3GDWA 1GXSA 2BHRA 3BILA 3L8FA 5BRNA 2INGX 1CDEA 5GY7A 1X7ZB 4CM8A 5CDGA 1E3WA 1TU4A 5K0EA 2R1VB 3THXB 1ZD4A 3EDMA 5IDVA 5B3KA 2JK1A 2GJSA 1VL8A 2YC4C 3I39X 4R8RA 2CBZA 1UK6A 1Z34A 4CKBA 4F92B 4Y2GA 5AQ1A 4M1EA 1JIVA 2XVAA 3EQZA 3LPNA 4MKHA 4XFJA 2B1JA 4I6GA 1IVNA 4YCDA 4A5OA 1GGMA 3WRWA 2ZUFA 1FE8A 1NP7A 2VP5A 4CMEA 4NCXA 3GJYA 4HADA 4XX1A 3MLAA 1N34B 4AKIA 1FYEA 4Y6PA 1Y1SA 1UJMA 2MTBA 3AHGA 2J9YB 3DR3A 3RU3A 1BW9B 3C7TA 5KJCA 1GV0A 1U4NA 4BGUA 2O57A 2BFCA 1Y8QA 2E87A 4AMYA 3FN4A 1R6TA 3QX7A 1N5KA 2C94A 2O2ZA 3CPJB 4X1KA 1YKSA 2AWNA 4P8RA 5FO0A 4D96A 5ALQA 2QRHA 4EKNB 2I4IA 5BY2A 1XXHE 4A2PA 3ZY5A 1O2DA 1D4FA 4UM5A 1VJDA 4J75A 5JARA 5LJIA 4XWTA 4BN4A 3UPTA 3G2NA 4YGXB 5AK3A 4ARBA 2GM9A 1F38A 1R3UA 3IP5A 5JAOA 4NG5A 4OQ4A 3HPQA 5D00A 3GIWA 1LDYA 1WY5A 1VHWA 3BWBA 5BN3A 1UKCA 1Z25A 4PAMA 3K32A 3OKFA 3PGMA 4MROA 1FVFA 2HV9A 2RAVA 3MWEA 3OE5A 4XVUA 7REQB 2UUBB 1EUCA 1WLSA 3OPQA 3CX6A 5K51A 2VYCA 4TVBA 1E2NA 3FVWA 3KL4A 1QS0B 5DNCA 2I6FA 5ED0A 1C3VA 1TO6A 1ZOPA 2JCGA 2HHLA 1KS9A 2C5BA 2HWWA 2QRUA 3W6UA 5JAZA 3AR2A 3C39A 8ABPA 1C7ZA 1N1MA 1LVGA 1WVIA 3HU2A 5FWAA 2QMOA 5DZSA 4CMJA 1UXKA 3D7MA 3KOMA 3L0BA 3FRJA 3UT0A 4F11A 3E70C 3JWPA 2VQDA 1KXJA 2CNOA 1IHDA 3F6PA 2NM0A 2OYSA 3KDPA 4DMUB 1GRQA 3OEHD 3EDQA 3R9IA 2AYYA 4B4OA 1T2EA 3AR9A 1KYWA 4A10A 3O38A 2LE0A 4QREA 3L1JA 3Q9UA 1BQ4A 4FN5A 1DB3A 2QQFA 4RY8A 3MMNA 3EDOA 3F78A 4RD3A 3M6IA 5KKAA 2AZXA 3ZWBA 1QDLB 1NW6A 4KN9S 1RHUA 4QHSA 3VISA 3SP1A 2GYVA 1J00A 2YVKA 3DEHA 5CVDA 2FX3A 1DARA 2XCIA 3LQ1A 1Z6YA 1WL8A 2BE9A 4L9WA 2EFCB 3KKNA 4XTCS 8LDHA 3C4JA 2J0UA 2X86A 4QYWA 2V9CA 1W76A 2AEFA 5AK0A 5DJ5A 4B7UA 1T9HA 2UZ4A 2OE2A 4Q12A 2H1VA 4HS9A 3UC5A 3WBKA 2H1FA 4D42A 3IALA 1EKXA 3KAPA 4S24A 1O9HA 3PQ3A 2KLBA 3RVMA 2P5SA 1BIFA 1E1YA 4QUIA 1IN4A 5EJ9A 1US8B 3W90A 3OZIA 4IIJA 3LP8A 2OOSA 4RKRA 5FL7A 4EHJA 2POCA 4JJ6A 4FXPA 3DDWA 1FP6A 2OWDA 1FX1A 4RHEA 5B4TA 3A70A 1Y3HA 1DJLA 3KZMA 1T9AA 1MX3A 4N1AA 4FQ5A 4DDHA 4JI1B 4Y2YA 3OHSX 3TIGA 3LCCA 4IINA 1NJFA 5HPYB 2PXCA 4MVJD 4BVGA 1UXHA 4TVOA 5KSYA 4PTYA 1JDBB 5K4AA 3DC7A 5JDIC 2DFLA 2EV9A 4YNBA 1UP4A 2DQ4A 4S2UA 4AF7A 1M7BA 4CIBA 1F9AA 4HCJA 2JBAB 5DISB 3N1UA 1G21A 4Z1OA 3EVAA 3OIFA 3KJZA 3PX7A 1UOPA 3A27A 2FEOA 1WETA 3QW2A 3V4VB 1IJBA 2OCXA 4JKIA 1ESZA 4KBGA 3RVOA 5CLGA 3CPHA 4CM5A 1VLJA 2GH1A 5H81A 2ACVA 3AY6A 1ECJA 2YWHA 3RSFA 5C8ZA 5MFPA 2UXDB 3KVRA 1NVTA 1XAHA 1Y37A 1E5VA 1I3MA 4ALKA 1Z5NA 3PXCX 2M9MA 3SIRA 4WQMA 3ITNA 3RARA 3U81A 4FCVA 1J97A 4PINA 2J31A 5E4YA 1QGDA 3C3YA 3HGTA 5IH7A 3CJTA 2CLSA 3QVGA 1KQPA 1YMQA 3EQ6A 5CB0A 4HYEA 3ILHA 2HQ1A 1E7WA 2ZIWB 4J0FA 4M46A 3NIDB 1C7IA 4NONA 4GMHA 5F7ZA 1JSZA 2P9GA 5IVDA 2WQ7A 1VPTA 5ADWA 1KFEB 3B1KA 5HKAA 3I5AA 2GTHA 2O6HA 2OENG 3TK1A 2RH5A 1SEPA 1EVYA 2GXUA 2X5XA 5CAEA 3R0VA 1XZGA 1WB9A 4L8YA 4YCLA 2XQGA 2JLSA 1RRCA 3C3CA 5F4BA 3WHKA 4UNRA 2B92A 4N7MA 2GN4A 3GWGA 3UHPA 2ZI6A 2B8NA 3DZIA 4JJIA 5DNYB 2AE2A 3OF2A 1RHJA 2JI7A 3HCPA 1LQUA 3H2JA 4WD3A 3ZHYA 5C5CA 5HGXA 1ZK4A 2PT5A 2WJ4A 4IS3A 4XX0B 3SMVA 2R8XA 3D6MA 4JK3A 2C58A 1YWGO 2DOKA 2OLEA 4NZNA 3VR1A 4P7GA 1EJ0A 2BI7A 2X1LA 3I01A 2B5WA 1IONA 3K5PA 3OBIA 4PC7A 1QGUB 3SYTA 2OA0A 4QYIB 3WHPA 3B6IA 3KJEA 4Y0VA 3R3SA 2GBIA 2JAQA 2NV6A 4B8YA 4EQ6A 1O96A 4TS9A 5EHZA 1SXQA 3DBOB 5KTPA 4KWHA 5EPEA 3W77A 5B4VA 5K5EA 1OLOA 3A28A 3GJZA 2F9LA 2I87A 2JFFA 3PVZA 3RRMA 1E32A 1I4LD 4IKOA 2J67A 4OA5A 4RD1A 3SHVA 4ESHA 5B12A 5ILGA 4O3MA 2WYVA 2FWIA 2O7RA 3S8EA 4YRQA 3BRCA 3H5OA 5FR1A 2W90A 4RF3A 5I5GA 4O8ZA 3PCXA 3FCEA 3STUA 3QQ5A 4EOGA 5GVRA 3O95A 3LMKA 4X54A 3VDMA 4BNNA 3IAXA 4DREA 5T3UA 2GYYA 2IHBA 3L7YA 1RWQA 2BTQA 5H83A 4M4SA 4D5EA 1Y7PA 3Q0EA 4ZOEA 1HNZB 3E9YA 5HZGA 2PUDA 3TZKA 2DHDA 3L7IA 4BN5A 1EZ4A 2OILA 2HXSA 2YZ7A 3R0XA 3CB4A 5GIOE 3Q0IA 1HYEA 2CNWD 4AUMA 3KQQA 5LZ5A 3RS4A 1ADBA 1KMCA 3VVLA 3WIDA 1B41A 1L0BA 1XCGB 5FV4A 1AA9A 2A33A 1FMCA 3HYNA 2IT1A 4YRRA 2XLBA 4IFTA 1LBEA 3KKZA 3ZEIA 1YL6A 4F9TA 4BWFB 2PUEA 1MAAA 2RBGA 4M0KA 2UVPA 2ZI7A 4LDPA 4WVLA 2VNHA 1UK9A 2G72A 3GP3A 3ZD9A 5LQCA 5MN6A 1KDPA 1LPSA 1R0RE 4GG1A 4WKPA 3MOIA 5JROA 2PUJA 3GT7A 4EIWA 3PI6A 4TXLA 4ZAZA 5C32A 1S0UA 2G25A 4DF3A 3HLTA 4GYYA 2JC3A 1ISFA 4HQOA 5EHNA 3V4FA 2XEDA 4C0XA 1G8SA 5FI1B 3KSRA 1Y6ZA 2EL7A 2N0SA 4XPIA 4JYPA 3L5KA 4KQHA 5CBPA 4ZOQI 2CF5A 2C00A 2IC5A 3N0VA 4LV8B 2YXBA 1FRNA 1CQPA 3AW9A 4TWIA 3CJRA 2ES4A 1L7DA 2HADA 2J3MA 3BWXA 3I58A 3I9NA 4OSOA 4CKEB 3KM0A 5BSVA 2HJSA 3VU1A 5TMBA 3CN7A 1P44A 1Q1GA 3CNNA 1REQB 3FNHA 3NR2A 4TGLA 5EMJA 1C9NA 1J2RA 3FZGA 4IIFA 2FETA 3AI7A 3VR5A 1T5HX 4Q03A 1IQUA 4FWTA 1N2CA 1CUDA 1KH2A 3WMWA 1A9OA 2PNFA 3DM5A 4PCLA 3KBOA 1KDVA 1HMPA 3N75A 3MGKA 3RREA 2O5VA 1PL6A 1M6YA 1XR3A 4G0UA 5MHTA 1GLVA 5T8KA 2FJUA 3IT2A 1RYDA 1ZONA 3PEYA 4BC0A 4K9KA 2ATCA 2Q28A 3BIFA 3EHDA 1DEKA 2GCEA 2XADA 4I6JA 1L4FA 1VBFA 4I9FA 3M4YA 2NACA 2AJLI 4UXIA 5B3AA 2VAPA 1UODA 1UKZA 3CUWA 4L6CA 4B7AA 3U6KA 4YRZA 3M9XA 2CLKB 4FHCA 4ZQGA 2I2XB 2XGJA 3PVSA 4EHKA 1RXUA 3GI1A 1CSEE 3VPCA 5JS7A 4R3WA 4HDAA 4E12A 3E3AA 4JX9A 3B9QA 3GGPA 1VI6A 1UBNA 3T5DA 3T7JA 1DCKA 4JNKA 2I99A 5EXTA 521PA 3EUFA 3AVXA 1UJ5A 1OTXA 2PIDA 4B44A 3U44B 2J4FA 3QH4A 2ET6A 1WHTB 4GIBA 3I2KA 4B2YA 2BHTA 4QPZA 4MW9A 4W7IA 1WB6A 5A5VA 3BMCA 2NU7B 1BJTA 1QG0A 1U6IA 3V34A 1RMTA 3FPBA 3OP1A 4BVHA 3ADKA 2FJPA 4NPHA 5GGXA 2J07A 1NM5A 4YP5A 4ARCA 4EO7A 2A0WA 2G71A 1LDNA 1DG9A 3T52A 4PSAA 2FQYA 3KR2A 4JUIA 3F67A 2D2VA 2DX7A 2APJA 4FBMA 4HZUB 4D8XA 1J0DA 1AF4A 2QRZA 1Q7RA 4G1MB 3MT9A 5IXSA 3QVLA 1CUFA 4PVDA 4OA8A 3HH8A 4O25A 5J2TF 1FYDA 3KZ1E 4Y1RA 3IVXA 1A9QA 2MSKA 3MYRA 3RFFA 3UTDA 3KFLA 4AZ0A 3HN7A 3N2LA 4H16A 1N6NA 1RXIA 1SHKA 4FBGA 4KXUA 3B8HA 1OCEA 2HK8A 4UCWA 1PLLA 2G8LA 1TMOA 4KO4S 5TY0A 3STVA 1HEUA 3PXUA 1M0EA 3TW8B 5KHOC 3ZWQA 4BLRA 1R9NA 2YFHA 2GZ3A 2PWAA 3FOBA 4N39A 3FVVA 2JEYA 1FU4A 2MMGA 1R5NA 2PJZA 1PYDA 2QL7A 1HPLA 4AK9A 2J08A 4N47A 4YRMA 1UPCA 5ABPA 3HKBA 3T3OA 2D1RA 4MP6A 3WLTA 1JJIA 2OHOA 3I9KA 2FGKA 1X7YA 1WUYA 2ZSDA 3EUAA 3KB8A 3LA8A 4PRYA 1GZ5A 4U39A 5AQEA 2H0AA 4HD8A 2LZ0A 2GK7A 4NS1A 5A3JA 4ECEA 1MD9A 1NU8A 1SBZA 3TECE 5FI3A 4NV3A 1A72A 2O8BA 1MEEA 3T94A 4F8JA 1VDMA 5AKYA 2G5TA 2LTAA 3KTDA 3ZVKA 3DJYA 2WD8A 5B1SA 1S4MA 3EG9A 4JMPA 1GZSA 2Q3DA 1G8HA 5G4LA 3HXLA 4EG5A 3LPAA 4HAUA 2BR5A 5DB4A 4E5NA 1XZPA 3DQPA 4WIAA 1MOQA 2VQSA 4DIDA 3A25A 4JUBA 1FFWA 2BDTA 2VYND 1YI1A 4KK3A 2WY2D 1UANA 3DDCA 2GSDA 1EHCA 2I4LA 3OUUA 9LDTA 1QHEA 1VIVA 1YH3A 3KHKA 4GKAA 4P5EA 4QQRA 4C20A 4G84A 4RTLA 1OU0A 2XOEA 2ZWOA 3IT1A 4R0NA 3WK9A 5F23A 3PXAA 2ZTMA 3GY0A 3SR3A 3O1IC 3T1QA 4J7CA 1HYQA 2DTXA 4BRSA 1N5JA 3EW9A 2XYRA 3FNBA 1DQZA 4WLNA 5BW8A 1RE1A 3PDIB 1P4HA 3GRAA 5TVKA 1VSVA 3ROFA 2NSJA 2DU8A 3FCOA 3HBMA 3NIFB 3TD9A 4RC9A 1Z8NA 3T7IA 4C2UA 3CZMA 4JJ8A 4Y30A 1MIOA 1PFUA 5E2BA 3ICPA 4IM7A 3UG6A 1VL2A 2OGWA 2R7NA 2WP0A 3CIOA 2JEZA 3GJQA 4KQFA 1JJVA 4MLCA 4XGQA 1NQOA 2E7ZA 3RANA 4DUGD 1E7QA 5JYDA 2D1TA 2C7GA 3DO6A 2YRXA 3N0TA 2BL4A 4GWLA 5HM6A 1PW7A 2AKAB 3K4HA 2XNKA 3FLMA 4F7DA 3CF4A 4WKOA 4N5LA 3TLCA 2PBFA 2AG8A 3R5JA 2Y92A 4EUEA 3W5DA 3MBIA 4AIRA 3HVUA 1I51A 3N87A 5AVZA 1U02A 3V9PA 4IGKA 5HQ3B 3T1TA 2FFBA 5K3AA 3FHJA 2C3UA 2JLUA 1UQUA 3M2TA 2BLNA 5LP6A 5ILQA 4ZZ3A 4F6CA 1E3IA 2NZ2A 3ZTWA 4L08A 3Q15C 1TM4E 3QOWA 1YS9A 4MDFA 2NUPA 3ER9A 4P92A 3RG8A 1ECLA 1V8PA 1VYUA 2GMWA 2YHBA 1MQAA 3QW4B 5KWEA 2B4KA 3FZYA 1C7EA 1LGYA 2FFRA 3CGWA 3EBOA 2CXHA 5KSPA 1P3DA 5IU6A 1ZVQA 1RJDA 2MYTA 2Y1XA 3N74A 4BU0A 5IWAB 5CT9A 1R0CA 3H2ZA 4YA6A 2WVJA 2DTEA 4L02A 5J2TB 3B89A 4R8VA 1Y98A 1QU3A 4RJJA 3W9SA 3EN0A 1DIBA 1L5RA 2OM6A 5GOTA 2XUPA 1JDSA 1NP6A 1I10A 3LM8A 3R5KA 4U63A 5E95A 4RTPA 4QAJA 5LYJA 1WUHS 1PKEA 4BMCA 1OUMA 1BVRA 2VCYA 4NBNA 1GL3A 5DP1A 4DJJA 1GQSA 1KO1A 2NO5A 1BMTA 1UBTS 4UBOA 4ZO9A 2J3IA 1CRZA 3RIXA 4C07A 4W5QA 1FNBA 1CY1A 5L7WA 1GTJ1 2O2HA 4ZAFA 4BY9E 3GJ8A 1UDBA 2FAXA 3JZAA 3RS9A 3VR3A 3Q40A 1ZN2A 4FQ7A 4RF2A 2WMOB 3RUDA 2DERA 4CMIA 4W5JA 3RSZA 4R3NA 2AG5A 2JZOA 1M2WA 4EPTA 1DKUA 4LMRA 1XUOA 1YZLA 3IKVA 1SA0B 2EOAA 4O4JF 5HX7A 6CHYA 4NBRA 1ML4A 4TZKA 2XRFA 3AEQB 3O92A 1BD3A 1Z63A 3DAHA 2NU8B 3SZUA 4J91A 4EY8A 4PC1A 1UDRA 5KDDA 2ETXA 3AR6A 1AUOA 3IT3A 3WK4A 4EG6A 4JS0A 1V5IA 3F4KA 3LC0A 3NALA 2A1UA 4HHEA 4DYHA 4HR7A 4JL8A 4DXAA 5F98A 1DPGA 1LV7A 2B99A 2GLXA 2J41A 1MH1A 4G81A 4JLDA 1KZYC 4QARA 4QBIA 1ZIDA 1H6CA 1LRKA 1U2TA 3R2JA 4PF1A 4KFCA 1DFHA 3O7WA 1WHSA 4YJHB 3PZRA 4DXHA 3KFXA 2ZE8A 4MUXA 2RGWA 1SQFA 2RDMA 2XPCA 3I28A 3LY7A 3WAGA 1QTQA 5JRZA 4Y6SA 3DE0X 1CJVC 3I83A 4MI6A 1MV5A 4ZQIA 1FJGB 2FH5B 1FU7A 2BKXA 3RK1A 1D04A 2BE7A 2EG9A 1EXDA 4CF4A 3UK7A 3IAEA 5JYBA 3FTNA 5KX5B 2LV8A 4CEHA 4R7TA 3RG2A 2OUIA 1R0XA 3BXEA 3QA3E 5CBKA 1CEEA 3IPRA 2A0UA 2F67A 2NZVG 5BN4A 3AJAA 1ND6A 1PAUA 3MAJA 1QAQA 3PUHA 4Q3KA 3ZWCA 4TYPA 4UHCA 1E1QA 4HYYA 4BZWA 4QVIA 1Y6FA 3GWZA 4LK3A 2Q9BA 4NU6A 3O8OB 2DR0A 3K15A 2NTEA 2PX2A 1KJYA 1MXHA 3K09A 4H0NA 2BFDA 5JD3A 3U49A 5A62A 1RRMA 3NM4A 3UGQA 4ZRNA 4DVGA 4QEKA 4EUNA 1W44A 5EXPA 1XP8A 2CXPA 3UFBA 4C7KA 1BX0A 2P6NA 3ZQ6A 2X8JA 3AHJA 3GX1A 3LX6A 2PQ6A 4HV4A 4AKTA 1HURA 2XNJA 3AEUB 1MHPA 2WICA 5DKFA 2C7OA 2NXEA 1CDZA 4YAWA 1AMOA 2XE8A 3OD5A 4EYKA 3DE4X 3AO0B 1PNOA 1U3UA 2QW1A 1KC3A 5JO0A 2HA7A 4IUBS 2Q21A 4DLNA 1ADJA 3GDGA 2EEPA 2VQ6A 5EUBA 3X0DA 9MHTA 3DTVA 4M1TA 3CLSC 4Y9RA 2X8AA 2DBRA 1QDUA 2ODNA 3FGPA 2YWRA 4KG7A 5DT2A 1BWRA 2FOLA 2A9RA 1C80A 3DVAA 3OZFA 1N0IA 4QXPA 4RXTA 5LLTA 4KFUA 2GPJA 1O1YA 3TLEA 4E5PA 2AD5A 1IEQA 2JIPA 2POQX 2VSYA 3OOWA 4Y0AA 4YUYA 1XPOA 1DO8A 1KORA 1PQUA 4LOHA 1DKOA 1WULS 2IPNA 3LCRA 4X7MA 4ZEWA 4CKWA 1YIOA 4FFRA 2FUEA 1LUAA 2AN3A 3TD6A 5K8TA 3TD2A 5KUTA 1P4GA 4OCZA 4WN3A 1U6KA 2IDKA 4RF5A 4BX3A 1CQZA 1SB8A 2MCFA 4QDKA 1X2BA 3RC3A 3WOHA 4YP6A 4MUYA 1ZJYA 3WP1B 4DCJA 5BWOA 1VJ1A 1VFNA 4O4JB 1N0HA 2JVKA 3FH0A 4ZVOA 3H5TA 2AOWA 1YCFA 2E4WA 2OG1A 3F3MA 4HB4A 1TC2A 4OUDA 5EE9A 4EH1A 5HRAA 4UTPA 1KSJA 3HS3A 5LOVF 1P1JA 1Y6JA 1U0SY 2CLHB 4HPWA 1K7CA 3VX3A 1OVMA 4NBVA 1R0YA 4JGGA 1DL5A 4DJAA 4K2HA 4CMAA 1JUDA 3CO5A 3KOUA 2CE2X 3IHLA 1IJFA 5D87A 5JBIA 3FMOB 5IAOA 1O9GA 3PIRA 2DH5A 1N9GA 2WT9A 1EAYA 4ZVKA 1QQBA 3I32A 1FOEB 3LCJA 3GPBA 1NBIA 1I2AA 2Y1DA 2X3FA 4NIMA 2V8BA 3EZLA 2VTEA 4OYRA 1L4HA 4KSYA 5ECYA 3QTBA 1GYRA 5LP6C 4YYEA 4BMSA 4P81A 3GRVA 1R4MA 2H07A 3OFND 3PJGA 5SYAA 4CQLB 4UOZA 2OCLA 3FOFC 3KQNA 1XL1A 2H8KA 4N03A 4D74A 3RSHA 1XVLA 2M1ZA 3QE9Y 1V35A 1D2CA 3BD9A 4KDEA 3EZGA 1N5OX 4FYWA 2ZRIA 4GLLA 5IEBA 2VQEB 1IH8A 3KV3O 1CUGA 3C3EA 5FEMA 2WUDA 1FQWA 2HMVA 3ASZA 3CW9A 4Y1GA 2FNAA 5SZJA 2JHCA 3COWA 3LRPA 1IBRA 4KMSA 4DMLA 3HCEA 4MW6A 1KVTA 3U4QB 2IYZA 2EF1A 1TT7A 2EWWA 2PRJA 5BV7A 4C3VA 1RZRA 2XH8A 4MKGA 1EFPB 1ORWA 3ZYCA 4DZTA 3Q8LA 3QE0A 3N2IA 5JXIA 3W5BA 2ZIGA 4YAEA 3IEPA 3E9DA 4ML3A 1YVDA 4QGHA 4IJQA 3WB0A 1TFRA 3OETA 3QHQA 4OFWA 2VO1A 4WZBE 5AHRA 2IVZA 3PJRA 5TE9A 1WU8A 1E4VA 4DLPA 4RZXA 2VNSA 3DPSA 1KJQA 1VKHA 2IODA 4TV8A 3I04M 3Q10A 4DEXA 3BXZA 3ZE8A 5ICGA 1CWUA 2R96A 4Q4LA 2LUOA 3WNCA 3EXG1 5IJAA 5JADA 1NASA 1C9MA 3MTGA 3IHKA 2VYQA 2YC2C 1RAIA 3O8NA 1N7JA 1QPZA 3HM9A 1DLIA 2W0SA 1E0JA 2P1RA 3NUGA 4QJ3A 2DWCA 2FPKA 3NETA 3KPYA 1UOOA 3OICA 4YQEA 3H84A 3TSCA 3D0KA 5I7UA 1TL7C 1CRQA 2D7JA 4JI4B 1NQVA 1N1DA 1UPTA 2PGAA 4MVJM 4I4CA 3CFYA 1IYZA 3PFWO 4OVKA 3ZPXA 5JT1A 1SO8A 2DWUA 2JKVA 5IJZA 2F64A 1U9IA 1EDDA 2BFBA 2C8KA 1YASA 3GFPA 1S96A 3SKYA 6PFKA 5I7FA 3RTGA 1JXOA 4NWIA 4RNCA 1PR9A 3DLTA 3H05A 3R9KA 5ED4A 4ZOBA 4LF6B 2QXUA 4NULA 4B79A 2JLWA 4II3A 4DCMA 1Z0ZA 4HDNB 3FUUA 4R5MA 2HMYB 4G1CA 5EINA 5HG0A 5JFTA 5EOVA 2HLDA 5LOVB 2PGDA 3QNMA 4LCBA 4OK6A 3C2QA 1W36B 1OXUA 2OQVA 1DX6A 4HQFA 2FPPB 3W6NA 3ZGVA 2X5KO 3VVMA 5FYQA 4GOLD 4O6VA 2HDHA 3D6HA 3KVVA 3H97A 3IR5A 1E99A 2HXYA 2ISSD 4M7RA 3CR7A 4EL0A 3P5SA 1Z6XA 2XCOA 2PS0A 4QNRA 1G42A 1ECBA 3LRTA 5ESRA 4IZIA 4YCBA 3SM3A 3EXIA 4ABTA 5TX7A 4G0OA 1FBNA 3MOGA 2GA8A 5FJJA 2VL7A 4GFDA 1M5RA 2O8EB 5H3HA 3RWOA 3K09C 3V8NA 3I2GA 3VNUA 1KEWA 3JAWA 3L4BA 4FSXA 1C1DB 1V26A 3AEZA 4AWXA 3OG9A 2ZT8A 3TRDA 3CRVA 1RXWA 1EM8A 1SWVA 4PFKA 4UM8B 4EEXA 5IBQA 4GM0A 1SVNA 1TTHA 1CY7A 2G36A 4FU0A 3M5DA 2I4OA 3KHUA 1NQ5A 3VU9B 2YJ5A 2Z6AA 3KSMA 1P9NA 2FP4A 2BEVA 1JA0A 3W5HA 2BELA 2DR3A 3JQAA 4IIVA 4ER6A 4L0DA 3QLEA 3W06A 2YJ3A 4UUQA 3MJ4A 1ZGAA 3WRVA 4GKBA 5LFAA 1S7GA 1VLMA 1FP7A 3CBQA 2B2CA 2Z1MA 3T99A 2BDEA 1X7ZA 2B83A 2R1VA 2K87A 4BKUA 4LY0A 2GD1O 1DIGA 1XCBA 5K0ZA 1QLJA 5LZ4A 2WFAA 2MOKA 3WLPA 4ZRDA 5KU1A 3INGA 4MRRA 1QZUA 5IM4F 3GUUA 4N5MA 5GAJA 2D13A 3QKIA 3KUUA 4TMKA 1WXIA 1CFZA 1CR2A 1VA4A 4FMBB 4ILEA 1I3CA 2RHHA 4KQCA 4UJ5A 2ZWPA 2QL6A 2FN8A 4G5SA 5CT4A 4EDFA 4Y2RA 4C5BA 3OBBA 3AILA 3TIIA 4TKMA 1WMDA 3QM1A 5IASA 3OH8A 2CLEB 3QGMA 1BW9A 4HEJA 3FMPB 3KFVA 4I1SA 5IUJC 3DZGA 1KHTA 3RFTA 1N2GA 1IUKA 4MCAA 3BORA 5DTEA 1RQPA 3UT5B 3OQ1A 1B0UA 2Y68A 1JJ7A 3HBAA 2HBQA 4OHUA 4RHCA 2HZ7A 2YNMA 4IEFB 1ABFA 4MEBA 2OBFA 3EH2A 3DCYA 4OFZA 4LF7B 2REQB 1BKYA 2QUBA 3KTOA 2D1FA 3B53X 3UIEA 1GKUB 1G3IA 1YQUA 1T6NA 5CFOA 1B23P 1VIYA 3M4XA 1O95D 4NDZA 1PYGA 3UGTA 4NYJR 4QHTA 4FLMA 2YUIA 2YS6A 3DB1A 1LSJA 4XB6B 3ZNNA 3VKGA 1PG5A 1NN1A 3DKKA 1DWOA 4JKYA 3WNBA 3SR0A 1U3DA 1VSQA 3CPSA 1RKBA 3NHZA 2Z8YM 4PFQA 2BSXA 2HMWA 1NA5A 3NTOA 4W1PA 2ZU6A 3HE3A 2JA2A 3TXAA 4ZTUB 3MJCA 1Q83A 1Z8FA 2Y67A 1V7CA 2JEOA 3S27A 1VJGA 1W85B 3ZNPA 3SS7X 1NW7A 3AF0A 3JAKB 3BH0A 5KNBD 2BVNA 2P75A 4UNSA 2IZ6A 2BV3A 3WGTA 5BN1A 5CA0B 2I2DA 3Q3IA 1UFKA 2ZZNA 3EOAI 4KN8A 1ZOOA 1ZD9A 2GBFA 2UVDA 2Y6UA 1TMKA 5AKEA 1Y3FE 3QXCA 4KO3S 4P4NA 3L40A 2RGRA 4WOBA 1XYVA 3RYHB 4BMXA 2JPDA 1M1XB 1RRPA 2F8MA 2PMDA 1RMQA 3FYUA 5IC6A 3CC8A 1ANKA 4PZPA 5IM5A 5TJ9A 4DCSA 2CUZA 5I9SA 5F7XA 5E7MA 1X1TA 3RWBA 2GN8A 1XMQB 1V9CA 3N8GA 3LQ4A 1D4OA 4PANA 3G7NA 3U62A 4DLWA 3HLYA 1XAJA 2B2XA 1A3CA 2GZAA 1Z47A 2Q5CA 4V2UA 4WNIA 2QN8A 2GWRA 5FNVB 2ZTVA 2F2TA 2D3TA 5DYIA 2Q9UA 4BO1A 2Q49A 4P3OA 3RUIA 3JQBA 2W8BB 2OXTA 1EFLA 1HI9A 1K97A 2EKQA 2VHUA 1FTGA 4OXNA 4BAUA 5KWIA 4DMMA 1IG0A 1XZMA 1K88A 3FFAA 2O52A 4FGWA 5K05A 3OE1A 2CEKA 4IO1A 1P8AA 2HU8A 1V25A 2AMFA 2YVLA 1ENPA 3ONNA 4Q66C 3K73O 5CIQA 1R3DA 4AY3A 1RPZA 5ICFA 4QTUB 1ZH8A 4G4GA 3SHWA 1DC4A 2W70A 5F51A 1A8QA 3QX8A 3S44A 1Z35A 2Z9CA 2A9FA 1G16A 5I47A 3G23A 2C4VA 1P61B 3BG5A 2VHQA 2W98A 4ZAGA 4OKSA 5FQNA 3WYNA 4H6VA 5JNLA 1TKRA 4KPGA 3C0KA 3ZU5A 3RSLA 1ZY2A 2AI2A 3D1VA 4KKVA 1ISRA 2PX3A 3BMXA 4QVKA 2Z58A 4RLSA 3ENVA 1ULZA 3GMDA 4H7FA 2OOKA 4RTNA 1YB7A 3A3OA 2P62A 4R8LA 4NDAA 4LJSA 5JCJA 3S2SA 3T34A 3DOOA 1FK8A 4J0GA 4XUEA 4IEIA 3VR6H 3AUSA 5IBPA 1SIWA 2FUG1 3GDHA 5FEUA 5JJCA 5K9ZA 1GNTA 3A1VA 4L15A 4QKQA 1GVNB 4E51A 2CXNA 1FS6A 2PLWA 1HYHA 2I2CA 2O0MA 5KZMB 1AKEA 1ZINA 2VHWA 3I76A 2JBAA 4GPD1 3HV0A 4Q4JA 4RV4A 2ZTLA 3TR6A 4E1VA 1FMFA 3FHTA 3ILVA 5B37A 3GRRA 4X90A 1RXYA 3IV6A 4LE1A 3PXBA 5EQTA 3RW9A 5JAMA 2IP1A 1CLUA 5BXYA 1CQXA 5B7PA 5LDGA 2R751 3MB5A 4BRZA 4YALA 1JG2A 1KYYA 3F9RA 1X6VA 1XDDA 5KJ1A 1TA0A 3R5XA 1SG6A 2A7QA 4QXMA 3Q5EA 4HO1X 1BG6A 3IRVA 1ZSVA 4JB8A 5DI3A 1K8ZB 1VL6A 1EZ1A 3U4CA 1IATA 3D4OA 1NXWA 3QJ5A 3HP7A 1J9GA 3FUVA 3PNQA 5FLKA 1HYBA 2J59A 3GFBA 3T4XA 5JUWA 1PBNA 5ERYA 3ELWA 1I7DA 1PSWA 4RWZA 4EY5A 1OX4B 1ZVMA 3TQFA 5EMKA 4FFPA 1OXBB 3ND7A 1QV6A 5HXAA 2OC9A 2XLCA 2XQKA 2X0EA 3S2IA 5HJEA 4ZWNA 2WUEA 1U8YA 4WGGA 4Y3UA 4BO3A 4KDCA 3S1SA 1PZNA 2N1MA 4H4DA 1Z2DA 1PWEA 4C0LA 3L4BC 2J9RA 4LFCB 2QBYA 4WZ6A 1YRYE 4LVUA 4QQFA 3TUIC 3VVCA 2G83A 1DXHA 2WTAA 4JR0A 2O0JA 4WASA 4QUDA 3ZXSA 3BJMA 4L4RA 3KPVA 1QHGA 4URXR 3L7NA 4NU8X 3AFOA 3CE9A 1YULA 1UFOA 1GGFA 3ITKA 4AZWA 5HM8A 3VI3B 2HAEA 4HTFB 1AGRA 5AI5A 4AULA 1GKLA 1PZHA 1YI8A 3M6VA 4MGZR 5AM4A 4GO1A 1DAPA 4J49A 1QGUA 2ZYTX 2CV2A 4QYIA 1YQWA 3SF8B 4ZU3A 1AC5A 1YQDA 3OWHA 4CLOB 1W75A 5FP0A 1UBHS 1W19A 1I9CA 2GD2A 1DC6A 3KOWA 4G8DA 2ZIEA 3K70C 2ZS9A 4U2GA 5IABA 4PCVA 3MWGA 3PNYA 3ZCRA 1LTHR 4NFLA 3M81A 1QANA 4H6XA 3LZCA 1XWFA 1YJAA 2PH1A 1SQ6A 3CVUA 4XWAA 2QM3A 4OO3A 2FN9A 1XXLA 2E5FA 2WKWA 4REMA 5E6SB 1BXRB 5HIIA 2FQXA 4FOLA 4E1BA 4RMHA 3QLJA 1X7HA 3DPIA 5LQMA 3I5YA 4HNHA 1WMSA 5IAKA 2XQVA 1Y8ZA 1I9GA 2AG6A 1M0TA 1UBEA 5IMSA 2HU2A 4AIIA 3ON5A 4TTPA 3U17A 2IYNA 3VJRA 4W6ZA 2IOHA 3KAKA 4GRAA 5H1YA 3NH6A 3PHBE 2O7SA 3DM9B 4X65B 1Y1TA 3I4CA 4WERA 2ZLBA 4CCWA 1POXA 5K7SA 2XRMA 1N7GA 1LPBB 1FSFA 2CHUA 2E85A 2PRZA 4RE6A 5ICSA 3GFTA 1R9MA 3MD9A 2ZZMA 3NBAA 2AMJA 3WLFA 3HWWA 1KR5A 3UWDA 5JSUA 4LHSA 4DEYA 3NBQA 2OM2A 3EDCA 1N2BA 1G2IA 1EGAA 4CV0A 4PZDA 5GZ6A 3ICQB 1S7CA 3ORHA 3UAOA 4BZPA 3VZSA 4WKCA 2G76A 1OV6A 4HRYA 3L8YA 3QEKA 4FHFA 2YWEA 4M38A 1E3LA 3TZ6A 4D56A 3O5AA 2BEKA 3UKOA 2ZJFA 2HYDA 5HDQA 4N54A 3B52X 3L1IA 3W3AH 1GIAA 5T41A 4DCUA 2ZJOA 5DO9A 3PJEA 2D1SA 2OD7A 1QVRA 1PE0A 2V4UA 3L6UA 1DUIA 1IN1A 4CKEA 3O4RA 2W2KA 1FDWA 2E2WA 3CNBA 2J4DA 3E8MA 4EX6A 3N6VA 3JARB 1REQA 4BB0A 1OA0A 4D9NA 1Y3IA 4F6LA 4O4HF 5F3RA 5PNTA 1JAIA 1I0ZA 1DIHA 1PFGA 2GNAA 5BSRA 2QD5A 3TDKA 1YDGA 3FCAA 5DBFA 4GYWA 3A06A 3HGMA 5DTJA 5E3IA 2WOJA 3OZRA 4LNUA 5TF4A 4KQKA 2H3HA 2VBGA 2CYCA 3OIGA 5U4QA 1Z6ZA 3JQBC 1J42A 1DO0A 1DZIA 3T5BA 5EGNA 4JHXA 3T3DA 4PWYA 5T4EA 4HQRA 1UDAA 5HZMA 2H4XA 3K0SA 1JYEA 4CCAA 3O93A 2OP1A 3WQHA 5FRDA 2W2MA 1II0A 2DQZA 2R2AA 3PTAA 4NFSA 1XEWX 4CLRB 5CFLA 3IE2A 2GK4A 2BFMA 3Q7SA 4NVRA 1GCGA 1N8TA 4MV7A 2K7FA 3E53A 1M1YB 5KYVA 4PLHA 3SBOA 3HRHA 721PA 3H9CA 4I1RA 1NE7A 2DBYA 2FVXA 4XQEA 4KW7A 4B6RA 4DNXA 6NULA 1H1DA 2BFPA 4CUJA 4EHLA 3KB2A 4XEHA 2I7XA 3N0RA 4IUCS 4P9NA 1UKEA 4R9RA 4YT5A 4EZBA 4XIGS 3QI2A 2G1AA 4XGNA 1J56A 3A9CA 3U44A 4A0SA 3LXUX 1WHTA 4JP1A 3BD8A 4XM2A 2PBLA 4XD7D 3MSXA 1F17A 4LY9A 1UPFA 1B8NA 1L1QA 3OWXA 4LYJA 4N5NA 5E7JA 2NU7A 1SKBA 2A5FA 5I9LA<