4W82A

Enoyl-acyl carrier protein-reductase domain from human fatty acid synthase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
332
structure length
306
Chain Sequence
HAFVSTLTRGDLSSIRWVCSCPGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRSFEQHVLWHTGGKGVDLVLNEKLQASVRCLATHGRFLEIGAIFLKNVTFHGVLLDAFFNESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human Fatty Acid synthase enoyl-acyl carrier protein-reductase domain complexed with triclosan reveals allosteric protein-protein interface inhibition.
pubmed doi rcsb
molecule keywords Fatty acid synthase
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 103
structure length 306
sequence length 332
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4w82A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4w82A01
3ONFA 5HM8A 4ESOA 4NH4A 3LT4A 1L1FA 2QIOA 4IMPA 1NQOA 4MIYA 4I5FA 5CG2A 4J9VA 5I9LA 2NADA 4D42A 3VTFA 3ICPA 3O8QB 4YAKA 1E0DA 2JJYA 5DZSA 1E5QA 2HK9A 1QYXA 4IZHA 4TMFA 4ALLA 4IXWA 4FR5A 1XDWA 1PJSA 4OXYA 3D64A 2DQ4A 4J91A 4CLHA 1KEVA 1WVGA 3NJ8A 2HMSA 4X54A 5H82A 1JVBA 1A71A 4ZRMA 1N9GA 3KOUA 4Q3AA 2JCYA 3MWEB 1T2FA 3GRPA 4CUJA 3TF5A 1YQDA 3AK4A 1D1SA 1T25A 4DIFA 4JIGA 2Q1SA 3W4KA 1LNQA 3L6EA 2BGMA 3G49A 4MVJD 5TNXA 3BTUA 2BLLA 3AUAA 1MXFA 4Q3EA 1ZSVA 2QZ9A 4A26A 1SAYA 1LTHR 1UXIA 2PGDA 4Q3NA 5COBA 2W8ZA 1OI7A 2EERA 5JCJD 2YV1A 3VKUA 4CQMA 5TSDA 3IC5A 1ISGA 3GC6A 4DTIA 5IXSA 5IN5A 4JLWA 3KVOA 3FN4A 4DC0A 1JKIA 4J1NA 4UVHA 5GZ3A 5I9NA 3NDRA 4GLLA 4AJNA 3BAZA 3HZZA 3I5MA 2ZYGA 2JHFA 5K0ZA 2B36A 4MP8A 1QYVA 3Q2KA 3F5SA 5KVCA 5IJZA 5DCYA 3V5NA 4GQAA 3OA2A 3WOHA 2ET6A 4EUHA 3GR6A 4OJNA 3JQAA 1N5DA 5B4VA 5CEEA 4D0SA 3BXXA 1V3UA 3WXBA 4BKOA 3S8MA 5HTOA 4E13A 1Y1PA 4JJGA 4IQ0A 5DF1A 1GZ3A 4DPLA 5A9SA 2WM3A 1YBMA 1UXJA 1CIVA 1LQTA 2BF7A 2C82A 2YQ5A 4H15A 4WK6A 3UKOA 4PLWA 4NJOA 1HTBA 1DPGA 1YJQA 2DUUA 3SBOA 1ZMOA 3QIVA 3ZWMA 5I7SA 4BKRA 2PWZA 3DBHB 3UCEA 2EHDA 3RQSA 3JQDA 3EMKA 4N54A 4DQVA 1O5IA 1NR1A 1ADBA 1O6ZA 2VZ8A 3WSVA 4WLUA 4JNKA 3ICCA 1LLDA 1LEHA 4JROA 4Q3CA 4E5KA 4DC1A 4IDEA 2C2YA 3ROPA 4E5YA 1I3MA 3MJVA 5K1SA 3JQBA 3FBTA 4O59O 3DBVO 3KLPX 4EW6A 3WGGA 4RV9A 1HETA 2JKVA 3KYBA 4Y6PA 3ON5A 4D41A 3OQBA 1BDMA 1WZEA 2DC1A 1PJLA 4UUNA 4BO2A 3PYXA 3WGYA 3HB5X 4Y67A 4W4TA 4CMKA 2Y1OA 4R3NA 2NWQA 1JWAB 5G4KA 4NFSA 3FNHA 2DKNA 4A73A 2X0IA 1PJTA 2ZCUA 2Z1MA 1CEQA 1MG5A 4NMHA 2I9PA 1WMBA 4WOKA 2TMDA 2V65A 3Q9NA 1H9BA 4TRRA 4ZD6A 9LDTA 1U8FO 3PJDA 1HDOA 1PJ4A 3MOGA 4FFPA 3WGOA 4CM9D 1DJNA 1LUAA 3MTJA 4NDNE 3JQ7A 2B4TO 5KJEA 2J6IA 3ZU2A 4XCVA 1C3VA 3V1YA 4MIOA 4YJGA 4BNHA 4MKXA 4B4OA 4DVJA 2B37A 1LU9A 5AXAA 3ZWYA 2JD1A 2B83A 3DZHA 4OQZA 2CVQA 2BRUA 1YO6A 3F1KA 3GLQA 5L51A 1KY4A 3K2EA 5TJHA 2I6TA 1A4IA 4BO5A 4XYLA 4JJIA 3VTZA 4CM4A 2VHXA 1UDAA 5KVSA 2D59A 4R69A 3E9QA 4ZJUA 4FFOA 4NBUA 2C7VA 1NAHA 2R00A 2D8AA 3GOHA 1WW8A 2C5AA 3PYLA 3FNGA 4OMUA 5A5FA 1VPDA 4CLOB 5CDUA 3S2GA 4BGIA 2VUTA 4QEDA 1PL6A 2OBYA 4PLZA 5HBRA 4JXKA 1YOVA 3QWFA 4HNHA 5BNIA 3BMQA 3PTZA 4FCCA 4EUFA 3ZU5A 4BNGA 3EHEA 3NYWA 4FGWA 1GAEO 3RUDA 3TQHA 1GD1O 2OBNA 2VCYA 2W90A 1WAMA 2VT3A 3DR3A 2BGLA 3QVOA 1ULUA 3JQCA 2W2KB 2LDXA 4Z9FA 1GTMA 2OORA 4FC6A 4BNKA 1SEPA 3LSYA 1NNUA 2Q46A 3RAJA 5JDIC 4K1LA 4MVJP 3EAGA 2ZYAA 3ANNA 2VYND 1Q0HA 3IIEA 5G0TA 5A3JA 1YVEI 2JCVA 2ZQYA 3MEQA 2Y99A 2AG8A 4OXNA 4XA8A 3FTPA 4ZRNA 1X15A 1WLYA 2EG9A 2OGUA 1EUZA 1UP7A 3ANLA 3EZLA 4BO4A 3AUTA 1T24A 1J0XO 3EK2A 1GQYA 2A4KA 4DL9A 2HO5A 1HE3A 1CWUA 1NBOA 3R3JA 3L4SO 4O63O 2PH5A 4J7CA 2ZTMA 1WWKA 3RUIA 5MDHA 3H9UA 5A4DA 4C4OA 1C1DA 1RJWA 4CM5A 2EWMA 3KYCA 2CDAA 3AWDA 2J3JA 2AQ8A 2Q49A 4BO6A 3ETDA 4PLPA 4UEJA 1YBAA 4ID9A 4JCOA 4EGFA 3L6DA 4E5PA 3DONA 1FF9A 2OUIA 2AG5A 2NNLD 1GZ6A 3ZNOA 3OJ0A 4J43A 1XHLA 3DBLB 1P1JA 2IZ0A 3K73O 2JFFA 5TIIA 2Y67A 2WD7A 3I6IA 4YJHA 5GZ1A 4C7KA 4AJOA 3GAZA 4RQTA 4OOEA 2ZJ1A 1G0NA 1QR6A 3H8VA 2ZQZA 2ZIZA 3JD3A 4WEOA 4C7JA 3CPSA 2VYVD 1JLLA 3NV9A 4W7HA 4ZGWA 5BQFA 4G2NA 3P7MA 5IZCC 3G3EA 4RZHA 4CPDA 1TA4A 2DT5A 3VH4A 1Q7BA 2IYOA 3CUKA 1U3TA 1DC3A 2QZZA 4RF2A 1HDCA 2XXJA 4FS3A 4P4NA 1Z74A 1TT5B 1B26A 1LBEA 3NEPX 3KLMX 2VRCA 4M1QA 3U3XA 2EW2A 1VRWA 1UR5A 1SB8A 2EJVA 1LDNA 3TOZA 3OHSX 3A9WA 2BKAA 4PLGA 1XWFA 3FTNA 2NVBA 1O8CA 3PDUA 3HHPA 4Y98A 3QQPA 5EMHA 4RORA 3VOSA 1I10A 5EN4A 1TLTA 1HYEA 1OFGA 4KDEA 2FMUA 1H2BA 3KM0A 3NDIA 1A9ZA 4DQUA 3P2OA 2YQ4A 3JTMA 1HSOA 4Z3KA 2O3SA 1MFZA 4CV2A 4E6PA 2YHIB 3QLJA 3SVTA 1ZJZA 4WKGA 1QYCA 4ZQEA 3WB9A 3RUCA 1DBVO 2IZZA 3WR5A 3EUWA 3VZPA 1KS9A 3BTSA 5A1TA 1K5HA 3LK7A 1Y9AA 3N58A 1Y6JA 3NRCA 1TT7A 4ALMA 1SMKA 4TRMA 5EPOA 3MJ4A 4LRTB 5DOVA 1HLPA 1XELA 5A9RA 1R16A 3D4OA 4FQ8A 3RUEA 1DC4A 1EK5A 3WLFA 5TRTA 1WMAA 2FSVA 4XWYA 3L9WA 3AFMA 2O3TA 1GCOA 4CM3A 3GF4A 4IS3A 1O95A 3UFXA 3GAFA 5A5EA 3ZHBA 4O5OA 1V6AA 3DOOA 3DFUA 3COSA 5FYDA 4W99A 2Y66A 4NBTA 3WBFA 1E3IA 4BNIA 1PS8A 3O03A 2BMAA 1R12A 3HFGA 1X7HA 1XCBA 4YWJA 1F14A 3BTVA 3WJ7A 2Q1UA 3B70A 3WIEA 2I99A 3DZKA 2PY6A 3E5MA 3KETA 1GZ4A 5ITWA 3LF2A 4DMMA 1SO8A 5EQDA 2GN4A 2BI8A 3OA0A 4YAIA 3U4IA 1T1RA 1H94A 3PYMA 1P1HA 1Y8QB 4H16A 4IDGA 4JGBA 4PZEA 4OM8A 3TOXA 1H9AA 4CLXA 3DAFA 1GDHA 4BNJA 2Y1EA 3FD8A 2HMUA 3GFGA 4R1UA 3V2HA 1UDCA 3CZRA 4MVJI 2YFHA 2FR8A 1LDGA 2DUWA 3GH3A 4PIVA 4BNTA 3L77A 3LYLA 3KSZO 1HDZA 4BO7A 5HWSA 1N1EA 3WGTA 3OEWA 2CY0A 4R9RA 4CMAA 4ITUA 3RSHA 3NAQA 4Y8VA 3ZWAA 4BKQA 5L3ZA 5IZCA 3AOEC 1VL6A 1NPYA 3LC7O 3LF1A 4II2A 3NDJA 3GVPA 4N5MA 3SXPA 1TVEA 1N9GB 2O3RA 1PSDA 3CEAA 3DB2A 2FWMX 3PLNA 1L7DA 2V6MA 1UZNA 2IODA 4R3WA 4YYZA 1N92A 4S1VA 3T7CA 1NASA 3B1FA 3CTMA 1M66A 4U0JA 1E7QA 3S55A 2QYSA 2F00A 3P5SA 1DFIA 3IAHA 4EJMA 4TQGA 1NR7A 3VPFA 4NBWA 1MUUA 5GMOA 5JNLA 3B20A 3STHA 3AW9A 4NPCA 4QO8A 4CQMB 3DMTA 3OQ6A 4PG4A 1E3JA 3ZWXA 4CUKA 1K3TA 3I52A 1EFKA 2CUKA 3H5NA 3OICA 4TKMA 4UUPA 4YCAA 3IKTA 3OFSA 4R16A 2C5EA 1LRKA 1WDMA 1EBUA 2VHVA 1GEGA 4TRNA 1T1SA 4QT0A 1RM3A 3JQFC 3JQAB 2DTEA 4CMCA 1P1FA 4PN3A 4GVLA 3A4VA 3WFIA 5A9SB 1F17A 5EQFA 1ZO8A 3IS3A 3K96A 2H63A 5CDYA 1RM4A 2Y0EA 1XEAA 3JQ8A 5LDGA 4BNFA 4JBGA 2B0JA 5TQVA 2V6GA 4YPOA 3ROKA 9LDBA 2BH9A 4OSOA 2Q4BA 5IXYA 4I5GA 4UAGA 4NU6A 2Y1DA 4CJXA 4D43A 5BSEA 1NQAO 4HADA 5CAEA 5A06A 2C29D 4ND1A 1GR0A 1XR3A 4QFCA 4CM7A 5JLAA 1RM5A 4MVJE 4XRGA 1HEUA 1PGJA 3EC7A 1ZEJA 1E1NA 1YE3A 4GX2A 2VWQA 4FJ2A 1I3LA 4YACA 4PG7A 2C0CA 2WDZA 4KQWA 4WNIA 3ROMA 4DYDA 1H6BA 3JD0A 3TWOA 2QHXA 4OH1A 4Z0PA 1W4ZA 4BV9A 4AJ4A 5G4KB 3WYBA 1YDEA 1QV7A 1P9LA 4CMIA 5A05A 2FPGA 2HMVA 1EK6A 3E6AA 2NU7A 5G2OA 3PHGA 1PJQA 2X1HA 2XF8A 4R1SA 3WWYA 4D3FA 1B2LA 1F8FA 1QXSA 1C0PA 1H6AA 1PL7A 2PH3A 1EUDA 5KJFA 3JQ7B 1PZFA 3AOEA 4TVBA 1E3EA 1RKXA 3RI3A 5LCXA 2ZATA 1UDBA 3V8BA 2C07A 3F5QA 3OECA 3WSWA 1EQ2A 3ENKA 4P8RA 2DBRA 1YGYA 4LCEA 4YJFA 4BQRA 3IL2A 2PR2A 3ULKA 1BDBA 4OKIA 2OHXA 1B8UA 3ZNPA 1ISMA 2XXBA 1JA9A 2QG4A 5AVOA 2PNFA 4GMFA 1MGOA 1ZSNA 4U0KA 4RJTA 4PVCA 1H5QA 3F1LA 4XGNA 4CM4B 1Z6ZA 3DQPA 1H0KA 1AN9A 2JL1A 3UXYA 4XDYA 3PQDA 2X7HA 5I9MA 5BNTA 3E48A 3K9QO 1X14A 2NTVA 4LK3A 3RIHA 1PGNA 3HN7A 4B3IA 1SB9A 4Q39A 3DL2A 2W2LD 5KOIA 3GA0A 2NU8A 3UCXA 1ADCA 1K6XA 4CODB 3W1VA 4DQXA 1GQQA 1YOVB 1FDVA 3BMQB 4N7RA 4J49A 5I7FA 1LSOA 2NQTA 4KDFA 3F3SA 4RVSA 4CLDA 5F21A 4M49A 3PIIA 1X13A 2IYPA 5THQA 2DBZA 3UUWA 4GMGA 2ZTVA 3JQFA 1KERA 1PQPA 4K6CA 4CQMD 1ONNA 3FCOA 2X0RA 4IQ8A 5TF4A 3AI1A 3DEYX 3ZN2A 2AA3A 2FPPA 2D5CA 5L53A 1E7MA 3PHIA 2YHUA 3B1KA 1A5ZA 4LGVA 3I6QA 1ARZA 5A3VA 2Z1NA 1LX6A 3ZI0A 4L8VA 3RCBA 4BS9A 1HE2A 4FW8A 1E3WA 1PGOA 3S1LA 1I8TA 1LDEA 3LC1O 4OQYA 3WIDA 1PJ3A 3C8MA 5I8WA 4IDDA 4F6CA 4IY1A 4RPGA 3W8DA 1IHXA 1H6DA 1P74A 4ZA2A 2WYUA 3ZHXA 1HYGA 1VL8A 4IS2A 4BVAA 1BW9A 2LDBA 5DULA 3OJFA 1EEHA 4MVJM 4TSKA 2EKQA 1KVQA 1LDBA 3HB4X 5JY6A 1VLLA 4R41A 1U28A 4IJKA 2PZMA 1C1DB 3ZU3A 2JHGA 5C7LO 3KYCB 1OBFO 1DRVA 2FP4A 4WEQA 4JX8A 4NJMA 2CF5A 4PLHA 4ZQBA 4B4WA 2ZB7A 3C24A 4L74A 4DA9A 3WQQA 2YY7A 4E5MA 1VJ0A 3ADPA 5DCUA 4E2XA 1K6IA 4B3JA 1NWHA 2B4RO 3PI7A 2BD0A 3L0DA 1KEWA 2X58A 5FF9A 2PKRA 2C7GA 3FF4A 3RFVA 4YB8A 1EE9A 4EEZA 3UCFA 1EQUA 4OGWA 4XYMA 4YJHB 5DCWA 3VH1A 1QP8A 1DDOA 2PZLA 3GG9A 1RPNA 3BMOA 5GZ6A 8ADHA 5DNAA 1LSSA 1HDYA 1CQJA 3ANMA 4RDHA 1DRUA 2R00C 1NVMB 4J16A 1A27A 4YQZA 1CYDA 3SEFA 1JWBB 4K9DA 3PGXA 3H9EO 5EL0A 4KUGA 4XR9A 1YB5A 2NVWA 3GVIA 2YJZA 3AM5A 3NTQA 1M2WA 2VNAA 5JAIA 1ZZEA 2J5QA 1I2CA 3KB6A 1QYDA 1XQ1A 1U4OA 4Z3DA 5ER9A 3FNEA 3MJEA 2CF6A 3ZHYA 1VKNA 3ZV4A 1KVRA 4DLLA 1GUYA 2GZ3A 5T5QA 3DZGA 2A9FA 3HG7A 3H9QA 4CMBA 3H65A 4FFLA 1FDTA 4FOSA 5C37A 1ZBQA 1YRLA 2DAPA 3PWZA 3D3EA 1PTJA 4U5QA 2DPHA 3QP9A 4KOAA 3RU7A 2AEMA 4YEDA 2Y1CA 1LI4A 2GYYA 4J7UA 4CR7A 5L9AA 4ONEA 2J3KA 5U4QA 4BGVA 4DWVA 3C7AA 2O7QA 4NK4A 2WE8A 7MDHA 4QX6A 4NHEA 2FPIA 1IZ9A 3BYZA 3FR7A 4AJLA 1GPDG 3HDJA 5FFFA 2JCXA 3JYLA 3JD1A 4BO9A 3WJAA 1P1IA 3R0IA 3NJ4A 3KXDA 3EY4A 1LLUA 3W4JA 3ZWOA 3Q6IA 4M54A 2X5OA 5A04A 4WGGA 2DTXA 4PLYA 3FSRA 1DC5A 4YT4A 1M67A 2Y68A 5L40A 3TZ6A 3DZFA 3SX2A 3JQ9A 4XQGA 2OFPA 1HKUA 4M55A 3V1UA 3CMCO 4BMSA 4EI2A 5ILOA 5EIOA 3I9LA 1Y5RA 1DB3A 1GUFA 1HDXA 5JAMA 3Q2IA 4M8SA 4E33A 1IE3A 5JSFA 2X9VA 4WLFA 1CERA 4LMRA 3KBOA 4J4BA 4AJJA 2A35A 3ZZNA 1HZZA 4OKNA 4R68A 3U0BA 3WS7A 1NFFA 4U6QA 5B37A 3WYEA 5F1KA 4AJ2A 1NHGA 3KHUA 3M2PA 2GF2A 2BFMA 3OIDA 1DFGA 2HRBA 3ASVA 1KEUA 2QW8A 3QSGA 3HJAA 4FJ1A 4MVJA 4B3HA 1PX0A 3PLRA 4B7UA 4IM7A 1P33A 4ZQGA 3KEOA 4XKJA 5JCJA 3GGGA 1ENZA 2DFDA 3B6ZA 2Q1WA 4PVDA 1G1AA 4OXKA 4BNUA 4BO1A 4BO0A 1YJ8A 1KETA 5JY1A 3TSCA 3RKUA 5DBGA 2P4HX 2DVMA 4FOOA 1ZVMA 5U9CA 4YBZA 1YB4A 3T7EA 5IDXA 4GKVA 3JQGB 2EJWA 3VC7A 3C1TA 1MA0A 4TRJA 5KKCA 1HSZA 4J4HA 3MJSA 2JFHA 4QO7A 1W0CA 3OH8A 3WFJA 5CP8A 5I7EA 5ENDA 2X5KO 4Y6RA 4EZBA 4YR9A 1HZJA 4I9NA 4EJ6A 5A03A 3GEMA 3IMFA 3QY9A 4CUZA 1W6UA 2C59A 3ZHZA 3DTTA 2VWGA 1AE1A 2PGLA 3NGXA 3PHJA 1Z7BA 1HWYA 3Q11A 4IDAA 3H2ZA 1LDYA 4INAA 3VPGA 4YRDA 1SC6A 2PKQO 1Y81A 4Z9XA 1MB4A 1T2CA 1F12A 2VWHA 3RUFA 1PGPA 3T4XA 2X22A 4XIYA 1E6UA 3UN1A 3GQVA 1T2AA 5JW6A 4BNVA 4URFA 3GDGA 3TL3A 3W6UA 1IY8A 3KYDA 3QA9A 3E8XA 2FZWA 3DMYA 2CVOA 1VM6A 1IPFA 4F45A 4XR4A 2OP0A 4CM8B 1HDGO 4HX5A 1NP3A 2VRCD 3GK3A 1I24A 3GPIA 2B5VA 4P38A 3VDRA 2CNBA 3G17A 2GZ1A 1B0AA 1TXGA 1ENYA 1ZJYA 1M75A 1T2DA 3GRKA 1WZIA 2CDBA 3HE3A 4F6LA 3LLSA 2GUGA 2QRJA 5DBIA 4EDFA 3F4LA 5ITVA 2V6FA 1LRJA 1SOVA 1E7WA 3VPHA 3KRTA 4ND4A 4CM9A 1P0CA 5ADHA 1CJCA 3DO5A 3ZCXA 1FDWA 5HA5A 4JP2A 2BGKA 1U3WA 4U8GA 4WLVA 4ZU3A 5JC1A 2YUTA 3NKLA 3AUSA 1E7RA 4AJPA 1NFQA 3ORFA 2IXAA 1DLIA 1HE4A 3RBVA 1GL3A 1XU9A 4RPLA 2NTJA 1YWGO 2I5PO 2XAAA 3GEDA 2ZB4A 1YQXA 3GDOA 4P4LA 4PG6A 3KO8A 4XDZA 4IXTA 1ML3A 2AE1A 3QW2A 2EP7A 3RUHA 3EW7A 6ADHA 1SEVA 4CLRA 1OC2A 2D4AA 4IQGA 3QVXA 1NQTA 1R37A 2OXIA 3VZSA 4BNMA 1B7GO 2YV3A 4E32A 3SLKA 3L4BC 3OETA 1BXGA 4QSMA 4NFHA 4TZTA 5ER6A 2CMDA 2IDZA 4GX1A 3PDJA 4CQLA 1YS4A 1WP4A 1VL0A 4CMIB 4EEXA 1Y8RA 4R9SA 4Q3DA 4RLSA 1KC3A 4MPDA 5K9ZA 2NTNA 3R1IA 4DPKA 2PGJA 5LDHA 1PJBA 1JKJA 4RDIA 3VKVA 1I30A 1RYEA 2Q3EA 3QWBA 1ULSA 1XSEA 3U49A 2P2SA 3D1LA 1R6DA 5IDQA 3DBRA 1Z82A 1PGQA 2HRZA 1W73A 1NAIA 5DBFA 4FBGA 2VYNA 3LLVA 3QWHA 4L73A 4ND3A 4BNYA 4NK5A 2NVUA 3DMTC 2Y1GA 3PJEA 5KJ6A 4J1SA 1KYQA 5T6BA 2DLDA 4UREA 1CQIA 1XLTA 1WDLA 3BMCB 1VJTA 3IJRA 4YTEA 3VH2A 2NV6A 2OP1A 4YVFA 2NUAA 3UICA 3AJRA 2AE2A 4FSHA 3A1NA 4I9UA 1ADFA 3QE3A 4A5OA 1E6EA 1JDJA 2VT2A 1I0ZA 2I3GA 4ALJA 4GLOA 2DM6A 3K92A 3MCVA 4P4GA 4LRSB 2HK8A 1IOLA 1N7GA 3GN2A 4II3A 5ILGA 4CMEC 4IJUA 1M6WA 3FWNA 1DO8A 4MO2A 3HADA 5F1OA 3SC4A 2YYYA 3RC1A 1E1KA 1U8XX 4KTVE 3VPXA 4KTTE 2RAFA 1AHHA 4GBJA 1Z7EA 5AYVA 1ONPA 3G79A 4D7AA 2QRLA 4GX0A 4QECA 3PQFA 3WTBA 2D3TA 2PKQP 4RF3A 3KSUA 2YZ7A 2GPTA 3NT5A 4JN6B 2WTBA 3ZV5A 3ZWPA 4EUEA 2XOXA 3TRIA 2FY8A 4WLOA 3TNLA 1BSVA 4RQUA 4E30A 2YFQA 3H9GA 4YJDA 1PJ2A 1SZJG 4UULA 4AJIA 1R0KA 2IEBA 4R5HA 1EVJA 3D4NA 3I4CA 5KCZA 4IBOA 3K31A 4EITA 1ZIDA 2PTGA 5IF3A 3EYWA 3GFBA 3GVXA 4FFRA 1C1XB 2PFGA 1VJ1A 4IJVA 2VYVA 2VUUA 1J5PA 2UUPA 4IGEA 3JYOA 4BOYA 2ILTA 2ZTLA 1NQ5A 1D8AA 1OZAA 4MVJH 4RVDA 3UH1A 1BW9B 3HSKA 2I65A 2PV7A 4DMLA 2A94A 3LT0A 5H81A 3V2UA 1X1EA 3TZQA 3UVEA 3JCZA 4A27A 5JDCA 1GU7A 1WXDA 2POQX 1F0YA 1P31A 1U2DA 1U1IA 1UZMA 2OOSA 3AI3A 3C3XA 3BHJA 2UV8A 4YT8A 1K6JA 1Q0QA 1I5RA 1DJQA 4MDHA 4NJMB 1XGKA 4FN4A 3W8FA 3L4BA 1X0VA 3Q0EA 4GGPA 2PD4A 2GGSA 4YXFA 1VKOA 4TVOA 2HSDA 3OF2A 5G0UA 3T4EA 2Q99A 4B7CA 4WNCA 2P68A 3WQRA 1SOWA 2Y93A 1CF2O 2J5RA 1DFHA 4BGEA 2YW9A 1K0UA 1NVTA 4BB5A 3BMOB 4FC7A 2PD3A 1C0KA 5KJ1A 3MWDB 1A9YA 1SNYA 2B69A 1U9JA 2FSSA 1YL5A 2J3IA 1UAGA 3U5TA 1FK8A 3JV7A 1D3AA 2FN7A 3QV1A 5TGDA 5CDTA 4J3FA 4TZKA 3IP1A 2GD1O 3UF0A 4A10A 3I83A 5CDSA 4UUMA 5TLSA 2VWPA 3I23A 4PG5A 1GY8A 1UZLA 3OIFA 5I7VA 2H9IA 1LSJA 2WYVA 4PLFA 4BNLA 3IKVA 4HY3A 3INGA 4CMEA 2HMTA 3IOYA 3ENNA 5JAQA 4EYEA 1LLQA 4XQ9A 1I2BA 1XA0A 4E31A 5B4TA 3G1TA 1GV0A 1IL0A 4NQZA 2UUOA 2AQKA 1B14A 5COQA 5ENVA 3OIGA 1MX3A 2P9CA 2Q2VA 3GHYA 1I33A 3F46A 4Z0HO 3PHHA 1U2GA 1GEEA 2ZKLA 4GSLA 1Q1NA 2EP5A 4Y6SA 4FIZA 4RPHA 4A7PA 3NTRA 2PD6A 4O1MA 5BSFA 5I8ZA 3U4HA 3RKRA 3G1UA 4HFRA 2J8ZA 3ZV6A 3E18A 3MOIA 2W4QA 1T4BA 1GYRA 4AJ1A 3IQDB 3LT2A 4PRKA 4J2HA 4BMNA 1ISFA 2VOJA 5CEFA 3AM4A 3V1TC 1Z73A 2UAGA 1E1MA 1UXKA 3H4VA 3HDQA 3CSDA 3TFOA 1NX6A 3D0OA 4EJ0A 3E9NA 3C1OA 4J1TA 4XYGA 2IEDA 1GV1A 3BHIA 3DTYA 3OM9A 1L7EA 1NHWA 2E6UX 2Y1FA 4A2CA 4AL4A 1OC4A 4FDAA 4NZ9A 1MV8A 1OOEA 1YL6A 3WTCA 5ICMA 2XPCA 1R4MA 4DYVA 2FRDA 3TFQA 4F3YA 1IULA 1IHYA 2NLOA 3S2EA 4BNNA 5TX7A 1DAOA 3HQ4O 3QHAA 5JXWA 4H3VA 1T4DA 1E6WA 4AICA 3F47A 4GI2A 4GVXA 1M76A 4WCFA 3FPCA 4RVHA 3LU1A 5COAA 1DHRA 4IDFA 1PQWA 3I9KA 4YJGB 3U4CA 1XYGA 4IINA 3F6YA 4FGSA 4PCVA 4Z6KA 1BVRA 4DRYA 1F8GA 3DOJA 4R4JA 3PRJA 3RVDA 2X9GA 4E2YA 2PLAA 1EVYA 4LCJA 1U3VA 4W9NA 1VSVA 3GVHA 4HWKA 1I01A 1J4AA 1K89A 4ZN6A 3I9JA 3I9NA 5C3MA 3QVTA 2NSDA 1R0LA 2CFCA 2O4CA 5CDGA 2PZKA 1ZK0A 4CV1A 3WBBA 1GADO 3O9ZA 3PFWO 4D46A 5KWEA 1PS9A 2FZEA 3I4FA 1YXMA 1EE2A 1ZXLA 5KIAA 4E12A 1DHTA 3WMWA 5G4LA 4L75A 4E21A 1NTOA 1NWCA 4YT2A 1LC0A 4L9RA 2Q45A 1U4SA 4Q9NA 1CRWG 6LDHA 4YAEA 5MGBA 3TJRA 3ZGYA 1N1GA 1PL8A 4BQPA 2I66A 3R6DA 2WEKA 4GKBA 2DBVO 2BHLA 3WX0A 1U7HA 5TT1A 3E5RA 4WUVA 1ZK3A 3KYDB 1S7CA 2FOIA 5JYDA 3SC6A 4J7XA 3C7DB 1PIWA 1MC4A 1ZFNA 3M1LA 1A7AA 2O23A 3DHYA 4NI5A 4RVUA 2WE7A 1G6KA 4ZQFA 1QLHA 1XKQA 1X1TA 2BELA 5KNLA 4CMHA 3JQ9C 5EESA 5HS4A 3K5PA 3JQAD 3JD2A 1KVUA 2RIRA 4K26A 1KIFA 3KSDO 4IGFA 4A03A 2JAPA 3D3WA 1W8DA 3RJ5A 1P3DA 3DXFA 3DWFA 5G0VA 2IRWA 1Q0LA 4LSMA 3INRA 2EKPA 1E92A 5C7IO 3GGPA 3MZ0A 2TMGA 4DLBA 3PXXA 5JBIA 4N18A 4J9UE 4E4YA 1MG0A 2BFAA 4J0EA 1TI7A 4K28A 5L45A 1O94A 2DPGA 3AI2A 1U7TA 1D4FA 2AQIA 2I76A 4Y9DA 2DFVA 1ENPA 1V3VA 4XYBA 5L7TA 2O3UA 3QWIA 4OHUA 4E0BA 2GN9A 2HDHA 1ISIA 1HT0A 3WICA 4IIUA 3PQEA 4I8XA 5J23A 1PEDA 4J0FA 1ZCJA 1IB6A 1XQ6A 2G82A 4IPTA 2GO1A 1IZ0A 1XIVA 2VN8A 5TC4A 3U4DA 1HRDA 4BNZA 5IN4A 4FFMA 4B4UA 4QQRA 3ZW9A 3VAZA 4BKPA 2Z5LA 2WD7B 3GGOA 4E3ZA 5K6AC 1SPXA 5IDWA 2P5YA 3PHLA 4DBVO 3INTA 4CLRB 4CMGA 3RASA 3W4IA 3GNTA 2VUSA 3W8EA 4LSWA 4DIBA 3JD4A 3WGQA 3JQ6A 4BO8A 1Q2XA 4MOWA 4KWHA 2VTEA 5KTKA 1HDRA 1C0IA 3PZBA 4GH5A 3DDNA 2DTDA 1GPJA 1O89A 1X0XA 1ZEMA 2W2LA 3SLGA 4XRRA 3DZIA 5DP1A 3GN1A 3D7LA 1KY5A 1BXGB 4OSPA 5AXDA 5CPBA 5HS6A 4CQLB 1LJ8A 2NM0A 1QORA 1V3TA 3V2GA 4I1IA 3OEYA 4NBRA 2Q50A 3E1KA 3QVWA 4J4TA 1Y8RB 1ZW1A 3JYPA 1BXKA 2YV2A 4RF5A 2NQ8A 3WG9A 2Y05A 3M2TA 1ZH8A 2PZJA 4HP8A 3AU8A 4YAJA 2AW5A 4ALKA 3CE6A 4JBIA 4ILKA 2CZCA 3JQEA 4NR0A 3TDKA 1OMOA 3DBRB 4WECA 4CR8A 4JK3A 3CIFA 2WSBA 4R5MA 1P0FA 2IXBA 1I3NA 2AEFA 1NPDA 3DHEA 2VNSA 5HRUA 2NVUB 4KQXA 3QJ5A 3UAGA 3F9IA 1GFSA 3RUAA 3WGHA 4AJEA 2EXXA 4FJ0A 1TB4A 2P91A 5T67A 4AG3A 5EINA 1U3UA 5F1PA 4XZ3A 1ZKMA 2RBEA 3ONEA 4PLCA 5F5NA 4XQCA 2V7PA 3RC7A 2CVZA 2W98A 3C7CB 4LN1A 4D0RA 2RCYA 2G0TA 2YDXA 5C5IA 4FD3A 1YQGA 2O7SA 5AXBA 2X5JO 3RU9A 1KC1A 1X7DA 2AXQA 3Q3CA 4LVCA 2GN8A 2VOEA 4GSKA 4OIMA 2R6JA 4RPKA 1FJHA 4HFNA 5L4LA 4ND2A 3GNQA 5FEUA 3KZVA 1WPQA 5AOVA 1LQUA 4ND5A 3VVBA 1OAAA 3KUXA 4B8WA 4BV8A 2HMWA 4P22A 4GL4A 3X2FA 1ZUD1 3WMXA 3WQSB 3BMNA 5T8KA 2GRAA 3FHLA 1F06A 1JN0A 4D45A 3GZ4A 3H6KA 1DRWA 2J5KA 2UDPA 4CMJA 4HFMA 1CETA 2VHYA 4MKRA 4XIJA 1JVSA 4TWRA 1KVTA 1NPTO 1QLJA 3H5AA 3BTOA 3IUSA 4L4XA 4WE3A 5BSGA 2P9EA 4XB2A 1HLDA 4OYRA 1FDUA 3H9JA 3PZRA 2AQHA 4M86A 2Y0CA 2I3AA 1EFLA 1DLJA 1ISHA 2A92A 3B1JA 3RROA 3NUGA 3NT4A 3HUDA 1J6UA 1EVZA 2EIHA 3CINA 1DOHA 4NU5A 4I5EA 1B3BA 5JS6A 3C1AA 5FI3A 3H7AA 2EEZA 3ASUA 5K6AA 1PS0A 3WWZA 4UUOA 2H6EA 5JMPA 4D3SA 5CHEA 5CFZA 2HK7A 4LVUA 1P77A 2D1YA 3I3OA 5THKA 1ZK1A 1SCUA 4AJHA 3IJPA 1NM5A 4BHTA 4E2ZA 1XG5A 4DXHA 4YDRA 3Q9UA 2E37A 1E3LA 3PPIA 3DAPA 5L7YA 1TEHA 7ADHA 4J1QA 1GQ2A 1HL3A 5TT0A 3ZV3A 4I08A 1D1TA 1ZSYA 2WWRA 4ALNA 3U09A 2HU2A 2FR1A 4RF4A 5JMWA 4CM1A 4YQYA 1EZ4A 4XB1A 1LRLA 1BGVA 1BVUA 5ES3A 4ALIA 3ZU4A 4UEKA 4J6FA 1NVGA 1B8VA 1C0LA 2E48A 5FI5A 4DUPA 4AFNA 2AHRA 4PFJA 4L76A 1Z45A 2EF1A 3NT2A 3FI9A 3GT0A 2HJSA 3F4BA 4ZVVA 5JFOA 3N74A 3EVTA 4W6ZA 1HXHA 1Q7CA 3A06A 4FB5A 1GCUA 2C2XA 4HNGA 3AY3A 1JW9B 3L07A 4CL8A 2EW8A 2EV9A 2ZCVA 1Y7TA 1FXSA 2HLPA 2E4AA 1E3SA 2EGHA 2OZPA 3PWSA 4CL3A 1PZGA 4OAQA 2ZTUA 1PZEA 1UXHA 2G5CA 2WD8A 3BHMA 3IDSA 1NFRA 3VHRA 2GLXA 3RD5A 4XJTA 2X4GA 2Q2QA 2VQ3A 2QX7A 3PGJA 5DN9A 4RZIA 3SJUA 1PQUA 4BUCA 3JQ8B 1R4NA 3ABIA 1H93A 4MIEA 2GNAA 1JTVA 4PRLA 3I9OA 2BFPA 2HKIA 3GZNA 1NXQA 4JP3A 4DIOA 2GASA 3R3SA 5KJCA 3RBXA 3EVNA 2Q2WA 1DIGA 3K2BA 5EERA 1QRRA 2JD0A 1PWZA 3LVFO 2GZ2A 4XD2A 4XGIA 2EKLA 1AGNA 3O8QA 3TL2A 1I3KA 2FR0A 4KP7A 1PWXA 2X0JA 1Y5MA 2ZJ0A 5AXCA 2P9GA 4R51A 2P4QA 1DXYA 1J49A 1C14A 3K6JA 5JDCC 3CKYA 3WYCA 5JO9A 2VRBA 4KWIA 3RJ9A 4IJWA 3MTGA 1E7SA 1T2EA 3PJFA 1RWBA 2QYTA 3KV3O 2QRKA 4OL9A 3GHHA 4G5HA 3OJOA 3OSUA 2B5WA 3D4PA 3TPCA 2C54A 1R4MB 3KTDA 5JYEA 3DOCA 1UXGA 3GUCA 3ADOA 2JFGA 4PLVA 2DBQA 3QWAA 5T57A 4XQEA 3WGIA 3OMLA 4IIVA 1B16A 3RC9A 3KEQA 1G0OA 3GVCA 4KZPA 3GDFA 4M89A 3X2EA 4HUJA 3MJCA 4WCFB 2CD9A 3OQ1A 2G17A 5JPIA 1DIBA 2I67A 5CEJA 1U5AA 2X86A 4GX5A 4HBGA 1FDSA 2D0IA 4OOFA 2X0NA 4YJFB 1DEHA 2RH8A 2X8LA 2IE0A 4BGUA 1WNTA 2WYWA 3HDHA 1S6YA 4PGFA 1EDOA 3CMMA 3U62A 1R15A 1JAXA 1AUPA 1KEPA 1N8KA 2HCTA 1RM0A 4BB6A 1I2ZA 3H3FA 2RH4A 2Q4EA 4O0LA 4ROSA 3NX4A 2YDYA 5KVQA 4IUYA 4YT5A 1ADGA 2NU9A 3AY7A 4GPD1 5G0SA 1QV6A 3ZW8A 3LQFA 3ROQA 4H7PA 1LA2A 3TN7A 1VC2A 3GMSA 3DFZA 2O2YA 1UAYA 3DBHA 3P2YA 1E77A 1UH5A 5JCXA 3RWBA 2X6TA 2CDCA 1KBZA 4IMRA 3Q1LA 2WJPA 2NU6A 1KOLA 4XX0A 4OO3A 2HQ1A 3L6OO 3GNSA 4WASA 5JDIA 2R2GA 4D3DA 3WNVA 3TZCA 1BWSA 1WDKA 2GERA 4GGOA 4BL5A 4NG5A 4YA6A 3OBBA 5GY7A 5BNFA 1T26A 1X7GA 2OL4A 1BRMA 3AOGA 3A28A 4WJZA 3IP3A 3L9XA 3HDYA 4J90A 1YBVA 1EMDA 2FHSA 1D7OA 2BI7A 3EZYA 4KUEA 4WPGA 1JAYA 4R1NA 2QQ5A 5CPFA 5BR7A 1M6HA 1E3WB 2GSDA 1PJCA 4JBHA 3W6ZA 3RC2A 3NTOA 4DREA 1YH3A 4NIMA 1RYDA 4AVYA 1Z75A 3ST7A 1V9LA 3D3WB 4PZDA 1ORRA 1MXHA 5TS3A 3FR8A 3PIDA 1YL7A 4BO3A 1BTOA 1LLCA 2JD2A 3AFNA 1QSGA 5CG1A 3M6IA 1O0SA 1IPEA 2HUNA 4UVGA 2NACA 3AY6A 5B12A 5IG2A 3RFTA 4N5LA 5F5LA 4MKZA 1DC6A 4HXYA 4UVDA 5IDYA 2VTDA 1VE9A 3BIOA 1QYWA 3BZUA 3K30A 4L4SA 4RGBA 4WLEA 4QFDA 5IZ4A 4WCFC 5B4UA 5KVVA 3WLEA 3O26A 4RCVA 4MVJF 3ITDA 4R1TA 2ZB8A 4QUKA 2VHZA 4MP3A 2OMEA 3JQGA 3M1AA 1ISJA 2GN6A 3ITKA 4NBVA 4BMVA 3ZNQA 5L95A 4W9NC 4UVIA 4CR6A 3QVSA 4CLOA 5U1PA 1EDZA 2JAHA 1MP0A 5DOZA 1PZHA 4Z0TA 5G0WA 1JQBA 2AEJA 4YAGA 1HYHA 4MINA 4CLEA 1YB1A 1IYZA 3ZH2A 5DDIP 3PJGA 3D5TA 2Y0DA 1ZXBA 3HWRA 5C7OO 3GMDA 2F1KA 5L4NA 4M87A 4RPJA 1A4UA 3PWKA 2G76A 3ZDFA 4KMSA 2UVDA 2W2KA 1MFPA 1JKFA 4BNXA 1PU2A 1B8PA 2Z95A 3HNPA 1UJMA 1P1RA 2GCGA 4IZIA 1N2SA 2RHCA 1DIRA 3LZ6A 5H83A 3TZHA 4MJLA 3H3JA 1MLDA 5BSHA 1B3RA 3ETEA 1K2WA 4CM8A 4UVEA 4R01A 3ZWVA 2OO5A 5FWNA 4W7IA 4O6VA 4B8ZA 1NYTA 1EUCA 3WGZA 3AU9A 3P19A 4FFNA 4HFJA 2HAEA 2O2SA 4G81A 1EVIA 3G0OA 1I32A 2RHRA 1BMDA 4QTZA 1Q7GA 3GPDG 5L7WA 2Q1TA 3VZQA 4YRBA 1QG6A 2IZ1A 3A14A 2D2IA 3E03A 2VHWA 3UW3A 3D5QA 2ZB3A 3HFSA 2DU8A 4E5NA 1A72A 4D44A 1QKIA 3E82A 1UUFA 4RVFA 3N7UA 1BXZA 1AHIA 1GUZA 1UP4A 3GUYA 3I1JA 3ZWNA 5BT9A 2AMFA 3RBZA 2BFOA 4IDCA 4FPXA 1PR9A 5DP2A 8LDHA 4BNWA 1E5LA 3VZRA 3DZBA 4I5DA 4WLNA 1GYPA 1ZK4A 4B4VA 1P44A 3DC2A 1JU9A 1P45A 2H1SA 3DBLA 4NFYA 4UEOA 1ENOA 1PR3A 2O48X 1AXEA 4EBFA 5JC8A 1V35A 1SBYA 1YDWA 4RL6A 5JO0A 5ICSA 1U5CA 1V8BA 2O3JA 2O3QA 2X23A 5B1YA 4CM6A 2O4UX 5TJ9A 1B15A 2HJRA 1DIAA 3BMNB 4ZICA 3AUUA 4DPMA 4GWGA 4KUHA 3LT1A 3VH3A 1ID1A 2E49A 3PEFA 4R54A 4ZQHA 4N5NA 3H5RA 1E7YA 1BHSA 3FBGA 2WMDA 2B4QA 4U7WA 1XU7A 3NGLA 2V6BA 4GAEA 5L4SA 5JAZA 1ONOA 3OJEA 1A7KA 4IDBA 2E82A 4TKLA 4MP6A 1DAPA 1ZK2A 5AQ1A 3LC2O 1TT5A 2O50A 4Z9YA 4GWKA 4B7XA 3JSAA 4WOJA 1AXGA 1E1LA 1LDMA 1Y9EA 4LISA 3VDQA 2VZ0A 3PP8A 1H2HA 3DAGA 3VPSA 2PA3A 3CH6A 2ZK7A 3ETGA 1LC3A 4J2OA 5A9TA 4RVGA 4HV4A 4L4RA 1KVSA 3ZNNA 4E2WA 4ZHSA 3TZKA 1MC5A 3WNQA 3S2FA 1LSUA 4MVJG 2GDZA 3CXRA 3OJLA 4U6SA 4PZCA 4G65A 2CSUA 4JQCA 1IUKA 5T64A 4Q3BA 2UYYA 3GEGA 4BKUA 1EBFA 1CDOA 4D79A 3PVZA 3MJTA 3BMCA 2YHIA 4CV3A 2PK3A 3OP4A 4JJFA 3O4RA 4RO0A 2ZYDA 4AJKA 3BA1A 3GY0A 3LDHA 1DSSG 1ZNQO 4K6FA 1VI2A 3I9MA 3PK0A 4XEHA 1HE5A 3RFXA 4DGSA 3UOGA 3FNFA 4DBZA 2H5LA 1N7HA 3ZWCA 3K8ZA 3QRWA 5JE8A 1QMGA 4L0QA 4WCDA 4YRAA 3HN2A 3DZJA 2J3HA 1BG6A 3PFFA 3UHAA 4B79A 5F3RA 3O38A 5DT9A 1GYQA 5LC1A 5EJ2A 1YKFA 3C85A 3FPLA 4PG8A 3GG2A 4LMPA 4TROA 1R66A 1V0JA 2B35A 2EGGA 3JYNA 3ZWWA 3CZMA 3FWZA 5KKAA 2SCUA 3JYQA 3AM3A 1I36A 3DHNA 1ZMTA 3U9LA 3VVCA 4BIIA 4DLAA 1O9BA 1UP6A 4A0SA 2GR9A 1DIHA 4XYEA 2C20A 4NNJA 3JQBC 3E9MA 5A02A 4PLTA 4XGKA 1YONA 3ZWBA 4CV0A 2X9NA 2D5AA 4I9HA 5IFLA 3UGKA 1HF3A 4RLHA 5T8KC 4HKTA 3FRJA 2VZ9A 3EDMA 4F46A 1C1XA 4W82A 1FMCA 3ONDA 3H2SA 2P5UA 3IUPA 1Y8QA 4XJSA 3S2IA 2G1UA 1LXCA 1R4NB 3SJ7A 1H6CA 4S3MA 5IAAA 1R0SA 3EGOA 4LW8A 1VSUA 3WDSA 3GZNB 1P1KA 4QXMA
chains in the Genus database with same CATH superfamily
4J0GA 2HSGA 1Z0UA 4I1VA 3EOZA 4I81A 4PAOA 3OOJA 1LFAA 2XCIA 1L1FA 1Y5IA 4BE9A 2R7AA 1NQOA 3OOWA 4FEGA 5CNMA 5K03A 1Y6GA 3BDAA 4I5FA 5CG2A 3QKSA 1HNWB 2QT1A 2FN4A 4IH4A 2AC7A 3ICPA 3O8QB 3DV9A 4YAKA 2UZ0A 1U6KA 2F3TA 5DZSA 1EFRA 3CF0A 1QYXA 3RKSA 4AMUA 4BRUA 1GDDA 1SUEA 2XE7A 4PHTA 2GCPA 4UKDA 1PJSA 2ZBFA 3CISA 3R7AA 4M1MA 5YASA 2DQ4A 5CB8A 2XLCA 4A8HA 3NJ8A 2YFYA 1C7FA 4QPCA 1HE1C 1M3SA 1SKUA 4DZRA 2PGXA 2NYUA 3LT5A 5BMVB 3KOUA 4DE5A 2JLXA 2HI0A 1IY2A 3LP5A 1U1DA 1UMCB 4CUJA 2FDXA 2AG1A 2LPMA 1NXOA 3H0KA 4NBNA 2X1LA 1D1SA 1RAGA 3DDHA 1EPUA 4L07A 2CMKA 4EL0A 2WC1A 1QHIA 4JIGA 4QRDA 2IBSA 2CJWB 3CX6A 1NRIA 1HQYE 1VXRA 3BTUA 4RFVA 4DMRA 3A1VA 4GM0A 1YHZA 2QKYA 2YYAA 5D7NA 2R65A 1UXIA 4AB1A 1V9SA 2BUAA 2BP7B 2EERA 5EIBC 5JCJD 3K0AB 1YS2X 5DVZA 3VKUA 2HGZA 2ZAGA 3GC6A 4DTIA 1ZITA 3UB4A 2BKVA 3KVOA 2F59A 3WNBA 4KFSA 4DC0A 2NXJA 2GJ9A 2RC6A 2RHLA 3GQBA 4J1NA 2HHHB 1UJBA 4UD6A 3EBLA 1PJ8A 4MK4A 4AJNA 4NXMB 3I5MA 3G2PA 1NW3A 2JHFA 1BC5A 1IXSB 4EKGA 3F7OA 2B36A 2GKOA 3N75A 1GFIA 5EP3A 5BUQA 2MYPA 5AUOB 3V5NA 3OA2A 1GL9B 2XTNA 1W9MA 2F8MA 3JQAA 1N5DA 4C30A 4M9QA 3QEBZ 3WXBA 3S8MA 5HTOA 1UT5A 4PNEA 2VNKA 1Y1PA 3QJGA 1TLLA 4DPLA 1N6OA 3E9RA 2C82A 4KAFA 1Q95A 4PZ9A 5LQKA 5FUVA 3DLHA 1FJGB 4AKIA 5J1TB 4Z4QA 1YJQA 1DPGA 2VPIA 4BYMA 1KZ1A 2J4CA 1IZ8A 2NPOA 3VR5A 3MOSA 1BJKA 3DBHB 1XNJA 2XT0A 3AHDA 4I4TA 2P9FA 3RQSA 2WQ7A 2F4VB 1O6ZA 3IQWA 4LC0A 4WWHA 4LHYA 3D0KA 1UPAA 2XMCA 1ZD5A 1LLDA 1LEHA 1Q0UA 1QUEA 1S2DA 2M6SA 1T36B 4GOND 4Q3CA 5AJXA 5TE9A 1B73A 5H4GA 1MJFA 3ROPA 4G8CA 3IYLW 5CFOA 3MJVA 1G8AA 3CEJA 4O59O 3FBTA 3ZK7A 5BSKA 1H65A 2E1RA 4Q3OA 3WGGA 4JXXA 2L42A 2PSDA 1O57A 4HBZA 2HD4A 2JEZA 3IQGX 4X71A 2VA8A 1QX3A 4YAFA 1WHSA 3JRXA 4MGKR 5EMJA 1BDMA 1T10A 5EXXA 4F9GA 1XOIA 3QHQA 1W0KA 4UUNA 4D9NA 2VAXA 2YMPA 1GG8A 1CULC 3HYNA 4H27A 3WWEA 3ZKWA 4BVJA 1AMUA 4HQRA 2DPLA 4W4TA 3G2JA 4DNQA 3OU7A 3PRHA 3RRNA 1P3JA 4W6QA 1U02A 2CFSA 4A6PA 3BG5A 2NWQA 1JWAB 1L1EA 4KBYA 2TSYB 3IPRA 2X0IA 3OMWA 1NIPA 4F4JA 4WBNF 1F1JA 1Y6RA 4HYEA 2PWAA 4JC5A 5KO2A 2I9PA 3AM1A 4ENSA 4ARIA 2ZBQA 4TS9A 1JQKA 3LUPA 1G63A 3QU2A 1Z33A 3FYDA 4IIEA 4TRRA 4ZD6A 2D2FA 3AKCA 4ERXA 1PJ4A 4ZVSA 2V5UA 1DZIA 1Y3CE 1UK9A 3HXTA 1CEXA 5CJPA 1G3MA 5KSOA 3COYA 4G0XA 2CJYA 4C2AA 521PA 4W5OA 3JASB 4ZOLB 4MQEB 3ZU2A 3ZR4B 2D4HA 2XZPA 3V1YA 2NV2B 1AX9A 4PPGA 2QL7A 2H1IA 5F1YA 4BNHA 3FFWA 4I55B 3Q8LA 1R8JA 3SHQA 3F97A 3DZHA 2C3OA 5KDLA 4ZFNA 1UPXA 3DAHA 3NWPA 1XN1A 2H7XA 2I6TA 1A4IA 4Q48A 2B2CA 2Q6VA 3GDHA 1NW9B 1HFKA 4PYLA 1NY5A 5KSWB 1F38A 4XLTA 1PTKA 4LE2A 3WKBA 2C2GA 1M2OB 2FEWB 3FM9A 4NBUA 2C7VA 3SE0A 3MCZA 2R00A 4RVNA 4HS4A 4OMUA 1K8RA 3FSGD 4U7HA 1JDZA 4CLOB 4DAOA 5CDUA 2ID4A 3RHSA 4Y0NA 3L0YA 3ZX5A 1Z9BA 3UUFA 3FUTA 4OGFA 2WKSA 2YIDA 1FSGA 4JXKA 1YOVA 2ZIEA 1J8VA 3RSOA 5BNIA 5ALTA 4ZAFA 1BHO1 2VDLB 3VU9B 3ZU5A 3AT1A 4UJ3A 3HU2A 5H80A 3T9AA 2C5LA 1JKXA 2IS1A 1KWGA 3CLRC 4MWZA 1GAEO 3H19A 1GD1O 2OBNA 3L1VA 1E2LA 1Y4SA 1O6FA 2VT3A 1JDBC 3I32A 3ILVA 4H7IA 3DOIA 2C61A 2CBZA 2N47A 1KPHA 2VF8A 3DVSX 4WT7A 4Y1GA 1U7OA 3V3TA 4DHWA 2H0QA 4Z0NA 4BNKA 3LV8A 2GS9A 1Z8DA 3LSYA 4HAUA 5JDIC 3RAJA 1Y8ZA 1II9A 3DJFA 3ET4A 4K1LA 2PT9A 2HPVA 2ZYAA 2YQZA 3KYIB 1XMXA 3N1UA 4H7JA 4J0IA 5IC5A 4CT5A 3JAKA 1QDUA 1Z4LA 3ESXA 4ENTA 4LEIA 2W2XA 2QJFA 5KNDD 5G0TA 3W1EA 1H2RS 2J48A 3REGA 2J87A 2PO5A 4LJKA 4C29A 3DZ8A 1T8SA 2PMFA 2XJ4A 4BLWA 1SKYB 3PX2A 4XA8A 4ZT5A 4ZRNA 3ZZMA 1PBNA 1X15A 3CV3A 3IIMA 4PO1A 4ZVMA 3WNZA 1VCMA 4BVLA 1EUCB 3RRBA 4BQEA 3EZLA 3MUNA 1T24A 3T34A 1XTBA 1GQYA 3TIVA 2ZJ7A 4JLMA 3KAQA 4DT1A 2WM2A 2ZBEA 4MS4A 5DHTA 1NBOA 4RS4A 1I9CA 4FT2A 2PH5A 4ZZ2A 3QX7A 2G6BA 2CBGA 3A10A 2ZTMA 1U0BB 2X0DA 3RUIA 4C4YA 5MDHA 5H5JA 5EE5B 4KFRA 4P3NA 3WOVA 5MGNA 5I4CA 1BZYA 1U3CA 3G5AA 5LA6F 2P1DA 4CL0A 2WTUA 3A6PC 2FHPA 3E7XA 3H2BA 3MB5A 3OOHA 3HXPA 4FFDA 4UEJA 1YBAA 1OV4A 1XHEA 1WEKA 2XYPA 3L6DA 3S1AA 3V8RA 5ADVA 1QDEA 5CX4A 5K01A 4OQXA 2AG5A 3BGVA 2BDEA 3ZNOA 3CUSA 4J43A 5CFLA 4WJKB 4XFDA 2XVAA 1IWOA 5K8VA 3DBLB 3ILYA 4R2LA 3E0XA 4MW4A 2IZ0A 4M0UA 4RS3A 4UFOA 3O90A 1GZDA 4AD8A 2ZRAA 4RQTA 4U3JB 3LOUA 4X5OA 3X1JA 2H7VA 1QR6A 3B12A 2AZTA 5H02A 4ZO9A 1VBMA 2ZQZA 3C8UA 2BGUA 2ZIZA 5F7JA 3D8TA 4KLAA 4NX2A 3OQIA 5INTA 3B89A 4O0MA 4D4KA 3NANA 1R0ZA 5BQFA 1XRRA 2EHJA 3P7MA 1E9RA 2BN4A 2FPLA 1FA9A 5KX5A 2E4XA 3CQ9A 3HEAA 3LQ4A 4RZHA 5CDFE 3SU8A 3N28A 5EUQB 1NRXA 2DT5A 1Q7BA 3JALB 2QS9A 1A98A 1S8AA 2JS7A 2QYOA 2QZZA 2XXJA 2ZBRA 1MO2A 2ETVA 3O1HB 3QYJA 3F49S 4FS3A 5UKDA 1TT5B 1B26A 4LGCA 5EXSA 2GQ0A 1J00A 2BEKA 5BSUA 5HKOA 2B8TA 1UR5A 4IV0A 5AHRA 2IS6A 4ZVLA 1LDNA 2ZIFA 1KHTA 3GLFE 4LC9A 1DKQA 3RHFA 1O77A 3FTNA 2NVBA 3M8KA 5AK3A 1MH1A 2C83A 3PGVA 3HHPA 2C9BA 2J0EA 2JGKA 3A1DA 2GRUA 2IDJA 2Y2VA 3M5DA 4HJRA 5LXTA 5IWAB 5ERYA 4MWDA 1K8YB 3STYA 1HYEA 2OBMA 3UB2A 3WGNA 1H2BA 1QWSA 4LY6A 5DNYB 1JHOA 3D2AA 4ZT7A 4TUYA 2YASA 4Y9SA 4B9AA 2OSBA 4TYYA 1XKLA 4DA6A 2G08A 1BRTA 1JG6A 4WKGA 3WB9A 3S3TA 4F97A 1V1JA 1BN7A 3VR4D 3PKIA 1DBVO 3SQWA 1T9DA 1XVLA 3FOCA 4OU5A 3W3AH 1VCHA 2WJVA 5LLTA 3VZPA 1DU4A 3DDCA 4ZO8A 4M0CA 5A1TA 2AI2A 3F5MA 4ETMA 1GKIA 3LK7A 4H3SA 3TOSA 1G4UR 3N58A 3NZEA 3NRCA 2VZEA 2W2TA 4ALMA 4JLSA 5EPOA 4ZAWA 4IAOA 5C53B 1O03A 1XELA 2NVOA 3M0EA 4DW8A 1NZFA 1J1ZA 2V7XA 4MITA 5ICGA 1MGPA 1PK7A 2YZ2A 5BQ5A 1NVKA 4MV5A 1WMAA 3PNPA 1KDYA 3PXUA 1JE1A 3KEFA 4YRQA 4J7AA 2WFZA 1B41A 3DOFA 3UG6A 5BWCA 5K8UA 2V4MA 2E3JA 5EUMA 3UFXA 4OB8A 4FBLA 1QK3A 4D0GA 5HJEA 1NJFA 5A5EA 1R5BA 4O5OA 1V6AA 2M9MA 4M8NE 3DFUA 5ALFA 3DP7A 3T0IA 1NQVA 5TARA 1AQIA 3BH0A 3H5VA 2JASA 2Y66A 4M6WA 3WBFA 4AY2A 1N2JA 4JZKA 1DKLA 4L9AA 4BNIA 2HWKA 3L7BA 5EMNA 3HFGA 1U2ZA 1OZ0A 2H2DA 2Q3HA 2PLWA 4YWJA 4IHAA 4OYYA 1JFLA 1F14A 1BE1A 1PI3A 2HM7A 2JAQA 5DK6A 2IX3A 3UAZA 1FTGA 2VHEA 3QVUA 1GTG1 2PY6A 2G5PA 4B5KA 2RHGB 4ME6A 2WP0A 3UJCA 1SO8A 1COZA 1W2WB 3L06A 1GTZA 2GN4A 3RK0A 3OA0A 1S9DA 1L8AA 1FLNA 1H94A 4ILEA 3M6XA 4BLQA 3BCHA 4H7DA 4DV1B 3WP1B 5ELXA 5FD8A 4FU0A 1YCHA 2PSHA 2CKMA 3GFGA 4TTAA 2HMUA 5DRTA 1IAQA 3U3JA 1OLXA 1MORA 2CCGA 2B78A 2HMYB 5EHXA 4Y1RB 5DYTA 4FR0A 2YFHA 4XUDA 3SHFA 3JAWA 4PIVA 1CIPA 2CHUA 4BNTA 3L77A 3P9PA 1J33A 1OYWA 3R8XA 3LYLA 1VJ5A 3VR3A 4J76A 3KSZO 3SQDA 4DN6A 4KFCA 4LF8B 3QKSB 2XWBF 3UM9A 4J3JA 3UJ7A 3L8HA 1QE5A 2ODQA 2RJOA 1V8ZA 4JWTA 2ZUFA 1DX4A 1ULHA 2XD9A 2PKCA 2CZQA 3HV0A 4G97A 3CVXA 3ZWDA 2QPAA 4GZ6A 4RIHA 4G1BA 3GLHA 3NDJA 2I03A 1EFHA 1V8OA 2JHAA 3I1FA 5K3DA 1ZGAA 3SXPA 2HSEA 3X2SA 1VIAA 3CEAA 5ABPA 1PRYA 2FWMX 2QN8A 5BQPA 5BO5A 6AT1A 3B6EA 1T4GA 1BGXT 2F9MA 1FUUA 4W1SA 3BEDA 1SCAA 3IHWA 3KL4A 3L82B 4QJ4A 3T12A 3T7CA 2JLUA 3TG8A 2Q9CA 1KFCB 4YXWA 2PEZA 1ZXXA 2NP7A 4U0JA 5I4KA 1XEWX 3VFDA 3I5XA 2VDVE 1QG0A 3EVDA 3V4FA 4DB4A 1ABFA 1WXEA 2HIHA 2P3SA 3LBFA 3EDCA 3P5SA 3GJ6A 1EE1A 2XVZA 4TQGA 3C5EA 4JI1B 2VYQA 2ZWIA 3A4TA 1MUUA 1VP3A 1Z08A 4DA7A 5JNLA 1FP7A 4QO8A 4NPCA 4C0HA 1MT0A 4V2UA 5B53A 4BRZA 4DJDC 2XLBA 4KRXA 4TLEA 2YYZA 2C5SA 2C57A 5ARCA 2CD7A 3GQBB 4YUAA 4PG4A 3ZWXA 1EJ6A 4CUKA 3KWJA 4M0KA 3OICA 2CFRA 2V3WA 5MN5A 3IUNA 4O1IA 4R16A 3C6KA 2CEKA 4Z3OA 1KP3A 1EBUA 1KO8A 3AINA 1B4DA 3MW8A 3NHPA 3QOXA 5DGDA 4QT0A 3R7NA 3EOBI 3JQAB 4CMCA 4L5YA 3LHKA 4B2LA 5AM1A 4V2IA 1VPWA 3DLTA 3FZYA 1L5GB 3NYRA 5EQFA 2ONZA 1CQXA 2JH8A 2Y0EA 3JQ8A 3L7AA 3CN9A 4A1FA 2RG1A 4POOA 2ZM6B 4PQEA 1DTSA 2X9QA 4LHVA 2Y1XA 5K3CA 3IB6A 4I4TB 3C97A 1HDIA 1JNYA 1KDPA 3IODA 1JR3A 1V5GA 4LHZA 4UAGA 2QXYA 2EFJA 5H3CA 2Q6KA 2FTKE 4IGAA 5CAEA 2REBA 2FSHA 2SBTA 1JDSA 5D1HA 5A06A 4ND1A 3FTFA 4QFCA 3ESAA 5HFAA 3GJ7A 3GPLA 4MVJE 4XRGA 2IIBA 3T3OA 1F8XA 5C51B 2PVPA 4BBPA 2QSJA 1WHSB 2ZSKA 4EF4A 1ZEJA 1E1NA 2B5OA 4GX2A 2FG7C 3LCMA 4E88A 1SUPA 1Z25A 1I3LA 1OSNA 1A82A 1HG1A 1E99A 3ZKWB 2O20A 4INZA 5LPNA 3K3PA 1FSZA 4KQWA 4C6RA 4QG3A 1UWKA 2ZRNA 1H6BA 5E3HA 1GU1A 4GPTA 2SHKA 4AJ4A 1Z22A 5HP4A 1QV7A 2IYAA 1GARA 5LP1A 3QG5A 5BMVF 3VU3A 3G8BA 2G09A 5K0EA 3PHGA 1YF3A 1Y33E 1GRQA 1PJQA 3HA7A 2XF8A 3AEUA 4LJ9A 3WWYA 3SMVA 4D3FA 2P2DA 2JJ2A 1IOWA 1QXSA 2G77B 3KEGA 5B6PA 1A1VA 3WJ2A 4AMGA 4F5ZA 2FZ5A 4PYIA 3PC6A 5D5HA 3WWCA 4TLBA 4BMXA 3MM4A 1N4AA 4MR7B 4HZGA 4RMHA 1E3EA 4TVBA 3RI3A 4RJTA 3H17A 2BGRA 2ZATA 3I2HA 4ZODA 2W22A 3TAUA 1P2TA 4HB3A 3V8BA 3W7BA 3D6TB 3K94A 1EQ2A 4RM2A 2R6AA 4K6GA 1YGYA 3EMVA 4M0DA 4YJFA 2JZNA 2R86A 4MPRA 3ULKA 2OHXA 2QUBA 4QBFA 1RP1A 1SG6A 2XXBA 4BFSA 1XJ5A 4M4SA 1YJAA 3ABQB 3DMRA 4LI0A 4O8CA 3WK6A 4ZI2A 2HRCA 1JYSA 1GLGA 5FAKA 1XVUA 1BE0A 1NV9A 1N9ZA 5ECWA 1OU0A 4WCVA 3WLNA 2BIFA 1EFRD 3DUWA 5CNKA 1H0KA 2VDPB 5BNTA 2C2WA 3NHZA 3PQDA 3PL1A 2OC9A 2WVHA 3E48A 5D5PA 5F35A 2DEUA 4MV1A 1T9GS 2LXNA 2NT4A 1SQ6A 3IVRA 4OFZA 2IHJA 2QTTA 4TTQA 1KARA 1WB4A 2FV8A 1NSYA 3ROEA 4QT4A 3EW9A 5IVHA 1ADCA 1K6XA 4DF3A 5IK2D 3W1VA 3HR8A 4DQXA 5BSRA 5BN1A 1YOVB 3KXKA 1Q0PA 2XQKA 4N7RA 1GTJ1 2O54A 3HP4A 4IG4A 4ZMSA 3PHBE 5HKKD 1FQJA 1V7ZA 2IHUA 2ZS9A 3F3SA 4DKXA 5F23A 2X9LA 3CKLA 3QLEA 5EIWA 1H23A 2QVBA 3ICVA 1T9GR 5SZJA 2OCKA 1MD9A 4NYMQ 3FPGA 1P8AA 4R40A 4ZYZA 4K6CA 1G9XA 2GBLC 1EJBA 4JI3B 1C81A 1ONNA 2XRFA 4G0WA 3ZD9A 3FCOA 2X41A 1QGZA 3N8KA 1SBZA 2ODBA 5TF4A 3LS2A 3SE7A 1WETA 3P9QA 1KQFA 1R2QA 4M1WA 3OWHA 3JAKB 1ZGZA 1NY6A 2CXOA 4PTLA 1FYXA 4L8VA 1FMLA 2HQRA 1NF9A 1KZYC 3L6BA 2OHHA 4YGXB 3DMFA 4LV8B 4MX8A 3S1LA 1UJ5A 1LDEA 4OQYA 2Q4OA 4KFUA 4D26A 1X94A 2BGTA 4DYHA 4F6CA 4IY1A 4JOCA 3W8DA 3WFZA 3VHQA 3C8HA 2WYUA 3ZHXA 1KAGA 4YAWA 1WCWA 2Z2JA 5ED0A 3CUWA 4KE9A 4YY3B 3OJFA 1EEHA 1NI5A 4DT1B 3IE1A 1FS6A 3H5LA 4MS4B 4AX4A 5JY6A 4EAAA 5J5AA 1J42A 3VR5D 1CY1A 2X76A 1U28A 1LK5A 1P5ZB 2G9ZA 2HDWA 3CO0S 5ALSA 1M54A 4OFBA 3T3GA 5CFQA 4M53A 2ZANA 3ZU3A 5C7LO 4PN7A 5TVGA 1E8NA 1M1YA 2CF5A 3KJNA 4RTMA 1FFXB 4PLHA 3CPEA 4JIMA 2F62A 4TKVA 1QH9A 2IOHA 3PQ4A 4L74A 3PEYA 2YY7A 4G9EA 4ZOLF 3S8EA 2XE4A 2ZYHA 3MMPA 5DIZA 3S1AB 4E2XA 1K6IA 1KDTA 4UZEA 4L9SA 2B4RO 4C05A 1XDGA 3PD0A 3LRPA 2D0OB 3SIXA 1RE1A 1KMHA 1WRBA 4JLKA 3N2NA 2UYCA 2QRNA 4O2BA 3AXSA 1R0YA 1TJYA 2XT9A 4JY7A 1ATIA 2WHRA 4JVNA 1R5NA 1MPTA 1DDOA 4XI9A 5GZ6A 2JCBA 1MAHA 2PN1A 5DNAA 3ZC3A 4EB6A 4IFIA 3VNBA 3OZRA 1CX9B 1LSSA 2WF6A 3B3QA 4Y9TA 1XLUA 3SDBA 1YGPA 3MCTA 3NG1A 4Z4GA 3LHFA 2VDNB 3OQIB 4LOKA 4X7RA 5IJAA 4F8JA 3MGGA 1A27A 4KMMA 4LYYA 1W8IA 1JWBB 4YQZA 4DIKA 3PGXA 1JGTA 1TKCA 3EIXA 2NVWA 3NHLA 4KUGA 2EP8A 4GBED 1D0VA 2BHRA 3EF1A 1M2WA 3NTQA 4REOA 4CFYA 1C4KA 1ZZEA 2G9RA 4CKWB 5KX5B 1I1OA 2QE7A 1XQ1A 4YECA 5HDQA 4LDRA 5ER9A 4Z3DA 3RQIA 3ZHYA 1KVRA 1NYRA 1RPAA 1KH1A 1N8NA 2H9AA 3I9FA 2YZNA 3LVRE 3DZGA 4J75A 4KEAA 2P7IA 2XYHA 4S0ZA 1X92A 1JX6A 1OLOA 4XVHA 4E51A 3H9QA 3MUOA 3ZHQA 3G9XA 3MHTA 2OORC 4BWYA 3N05A 5KWIA 3DWGA 5AFSA 1YRLA 2Z9DA 1VMKA 3PWZA 4QA9A 3D3EA 1PTJA 1JIVA 3D5EA 1J9ZA 2QMQA 1Q17A 3LPMA 4XVQA 1RE0A 5E2BA 4L5JA 1E5VA 3S5UA 3I9V6 5CLGA 3K53A 4D80A 5LXTB 3COVA 1XNRB 4IDHA 2EC5A 2J3KA 4DWVA 3C7AA 4NV3A 3RS9A 5LIRA 3EG5A 4BZXA 3OZAA 1GGFA 3A6ZA 4YJ3A 5LLSA 4F85A 4G0PA 4KE6A 1FJ2A 5FFFA 2JHCA 2VPTA 3JYLA 2IYFA 1VSBA 3CXUA 2HA5A 4OH7A 1FU7A 2IH4A 2BCGY 2K4MA 4IHQA 2HDNB 3FYUA 4P92A 3LLCA 1GGMA 2YN0A 4DR2B 1TMGE 3IXQA 3I8OA 1JAIA 4BUJA 4EPWA 3LKBA 4M9ZA 1K88A 4EQ6A 3HVUA 4Q7EA 1ZGGA 1JYFA 2XE6A 3VJRA 3TZ6A 4RULA 4P7FA 3HGQA 3G8DA 1RXSA 3O3MB 4LE1A 5FJIA 3R9XB 3UGQA 2V3CC 2JLSA 1EAMA 2C4TA 4M55A 3V1UA 3CVWA 4EI2A 3AX6A 3AR3A 3FGNA 3QVGA 4FNMA 4L5CA 1QH1A 1DB3A 5FQNA 3HYSA 4HDNA 2ZSUA 3Q2IA 4M8SA 5E7MA 3UFXB 1O5TA 1THGA 3P9NA 5GJBA 3JWJA 5LDDC 4B6FA 5SZKB 5A7HA 1I7DA 1XWWA 3R9WA 4DDUA 1NNLA 2JIZA 2Q5EA 2CUZA 5JD4A 1GL7A 2FX3A 1MVLA 3UPTA 2XNCA 1M34A 1OF1A 2DSNA 4M6WB 4R68A 3WS7A 1NFFA 5KQMA 4U6QA 1P0IA 3M5WA 1IPHA 3Q0IA 4HUQA 4AJ2A 5MN6A 2AEEA 2JLAA 3M2PA 2BFMA 2ZSJA 1DFGA 1Y7PA 2WYHA 3ASVA 2DYKA 2JEYA 4WACA 1FYDA 2VP3A 3M3DA 5EIFA 1GLNA 3A1SA 2D2EA 4FJ1A 1Q7EA 5JJIA 4XARA 1VCNA 4BJHB 1P33A 4WFIA 1H2ZA 1JU4A 1S89A 2FJUA 2VXOA 4EB8A 1AY0A 3KIPA 1SXJC 3LUAA 4QRIA 4XKJA 2RGUA 3W6OA 4CGYA 4BO0A 4ER0A 1G1AA 4KGDA 3HZHA 2P4HX 2DVMA 2OCGA 1CJTC 4TL8A 1ZVMA 1ORDA 4ZVQA 3TSAA 4E1AA 1PD0A 4ENUA 5U9CA 5J2TB 1XQ9A 4RTSA 1OLXB 4JJ7A 4Q4JB 1MEOA 3T7EA 5IT0A 4JEHA 1DINA 3KAPA 1CTQA 1G20E 4WZAA 3IMEA 1AB5A 2E4ZA 4HCJA 2P9YA 4TKZA 2QNRA 4IYRA 3DL7A 2ZKIA 2YXPX 3T7TA 3EIOA 4UATA 4UE2A 5E4FA 4B32A 5I01A 1QVZA 1KORA 3OH8A 1G8PA 3NC0C 5I7EA 4F1JA 3CR3C 4YR9A 3ROFA 1HZJA 3DL4A 4FCVA 4LPSA 3I2JA 1CZRA 2DHRA 4ARVA 5BV0A 4PY2A 4ZKEA 1B76A 1W6UA 3GLHB 3O9VA 1L2TA 4L6CA 2QN7A 1AE1A 2PGLA 1YCGA 1OYOA 3M6AA 4F4DA 1M8JA 1LDYA 2G06A 3H2ZA 4PO3X 3VU0A 5D1NA 1L9XA 2G5GX 2QR5A 5FLXA 1T2CA 1F12A 2BGNA 4IWYA 4QXRA 1PGPA 3OZIA 1QRUA 1D2NA 3NLLA 4ABYA 3OM8A 3M9WA 3ZVLA 2ZYTX 2VJAA 2FSGA 5JSYA 3FG9A 4HH3C 3N87A 3KCNA 4H1VA 4UHFA 3TL3A 3KYDA 3QA9A 1ZC3A 1G8SA 2FZWA 1C9MA 4JB3A 3U1BA 1Q7TA 2FGKA 3UK6A 3EGEA 5HF6A 1N0UA 1WXIA 1QGAA 3DE2X 3ECCA 3MLAA 4MQ4A 4F45A 4B47A 1JR3E 1HDGO 1Z13A 2MSNA 2OV1A 2VHUA 1C7ZA 4G1EB 4LXHA 4V02A 5FWAA 4C76A 4ZTUB 3GPIA 3C3KA 3EH1A 4TQ9A 3UWDA 1QFJA 3N6RA 4WMLA 2XQIA 3AIIA 3FPHA 3ZQKA 2H8GA 3AF0A 1TXGA 1M75A 5DBEX 1QYIA 4DC9A 5BT8A 4PV7A 1TFRA 1UM9A 1MVNA 3P9IA 5E9AA 4HNRA 4JBNA 2QP9X 4LYDA 2GUGA 5CK4A 3RSQA 3CLRD 1Z37A 5EFZA 4LGMA 5ITVA 1KWKA 1G16A 3R3UA 2XWSA 1F3LA 1MDBA 2GEJA 3B53X 4IMJB 4CM9A 3DEHA 2LRHA 4RDHA 1FDWA 2OFWA 4R8VA 4TN5A 4ZCMA 4WK0B 3ICOA 1T6YA 1W94A 1LNZA 2BGKA 3O82A 1L4KA 2RHJA 1YMUA 4ZU3A 4MRVA 2GI4A 3BJEA 4RQAA 1NFQA 4FONA 3WLIA 4WW0A 1HE4A 5HMLA 2WICA 3RBVA 5HNKA 1GL3A 1W2GA 2QM3A 4BX0A 3FKSD 5E2IA 1YWGO 2AWNA 4JZYA 2CUNA 5CAEB 3LUFA 2ZB4A 3DVAA 5DNVA 3GDOA 4ESHA 3BCSA 1GP2A 4M9CA 1TQ2A 2RSLA 1J07A 3EEQA 3P9YA 3KZXA 1FS5A 4HC4A 2HEGA 4IXTA 3VO9A 5KPDA 3QW2A 3VR6A 4LRYA 1TQ6A 6ADHA 2H2IA 3TNYA 4RACA 3CNNA 5L3RA 3RIYA 1OC2A 2ATEA 1RMTA 2P0AA 2CZGA 5D3MA 3WGLA 1NQTA 1DEAA 1R37A 1VMEA 1XMPA 1SXJA 3F98A 3DOUA 3KJEA 4FS8A 1ACMA 1YI0A 4U39A 3UW1A 2Z83A 4KNWA 3SLKA 3EN0A 3OETA 5K0TA 4TZTA 5ER6A 3RTEA 2GAIA 2FFBA 4GX1A 3QNWA 1YS4A 3ND9A 4NSNA 3IXLA 1PYDA 5D01A 3DP9A 4B4DA 4V0SA 1DVRA 2GXUA 2XODA 4Q3DA 4RLSA 4AT1A 4N0EA 3R1IA 4DPKA 4PTYA 1OHHA 5LDHA 4US0R 3AEUB 2NZ2A 4RDIA 5I7AA 1JPVA 2HV8A 4HS9A 1Q50A 2WWHA 2XOEA 2IPNA 2ZDHA 5CVCA 1RYEA 2GXSA 3IUQA 2HSWA 4B5LA 5LQAA 2V6JA 1TIPA 2ARKA 3OZBA 1LF5A 3ZEAA 2UU9B 1VBKA 5D51S 2F9FA 4H08A 4GNKA 4M8LA 3MXTA 2HRZA 3FNIA 1E9CA 3QENA 5ISMA 1GRCA 3SBEA 3MJHA 3LQ2A 4ARZB 3QWHA 4AZVA 4BNYA 5BWMA 3EOAI 1PJRA 4OQLA 3QOFA 4J1SA 1ECBA 3V8PA 3EUFA 4UREA 4YV1A 1CUCA 1C29B 3H4TA 4LF9B 3S2SA 1EUQA 3L7OA 4UMDA 3IJRA 4Q47A 4RD2A 4YTEA 1HRKA 4MPPA 2WIJA 5LQUA 1TJ4A 3UICA 3X44A 3ZG6A 2X42A 4BY9E 1QTQA 2AE2A 1WY5A 3QE3A 4A5OA 1FFEA 6REQB 4XOUA 1JDJA 1YAHA 1Q11A 2WJWA 2Q1YA 3BK1A 2A1IA 3MCVA 3BREA 4EUSA 4LRSB 2HK8A 1IOLA 3DFIA 1W5AA 3AKEA 3NO4A 1A8UA 4IJUA 2C8JA 1DO8A 1OASA 3FWNA 4MO2A 5CA0A 3ZDYB 1NNI1 4EJSC 2V7TA 2GAFA 2A0WA 4KTVE 1M2HA 2YX1A 3L7MA 4YXWD 2BCEA 4KTTE 2PGAA 1AHHA 2RAFA 2VUHB 1Q3HA 5E3IA 5AYVA 4C4RA 1B6RA 1A9SA 1XDSA 2M6RA 5FJJA 1YFZA 3VRHA 5B58C 1EYZA 2QRLA 3LC0A 4GX0A 1RAEA 3DLAA 4GYJA 4QECA 4I4TF 3TIGA 2D3TA 1KYZA 4RIFA 4P53A 2QD4A 5DXFA 2XOXA 2OZLA 3A1WA 3AERA 2HR1A 4WLOA 2JIDA 3ZDDA 2WKQA 4YJDA 3ZQUA 1SZJG 1F4VA 4IW3B 5AKXA 4K9MA 3FJYA 4RK4A 5AM4A 3HUTA 3G9QA 3K31A 3RT7A 4TM7A 1KKMA 2XNDA 1KO5A 4B82A 1TGVA 1ZIDA 4PNPA 4NJEA 3DXXA 4RL4A 1DMSA 4RSHA 4B71A 4X7MA 2QD2A 3L8MA 4I1SA 4RM3A 4IJVA 2DFLA 2VYVA 3JWIA 4JSRA 3UWKA 4XSHA 1N6NA 3ZLUA 4BOYA 5HIKA 3CVUA 4C0QC 1NQ5A 1D8AA 1KYYA 3PLAE 3HSKA 2I65A 2PV7A 2EG5A 2OFOA 1AQLA 5E3JA 3FFTA 1BQ4A 4DMLA 1OI4A 2FEOA 4DQDA 5KQGA 1GN9A 1PYGA 3LT0A 4TXJA 4YIHA 1MB3A 3FETA 3TZQA 3EAFA 3ORQA 5TQJA 1ZIPA 3U17A 1T0BA 2IYZA 2ANCA 2POQX 1JQ5A 2MYUA 2PUJA 3OPYA 3PWTA 5IFKA 1F0YA 1M2GA 1U1IA 1UZMA 2OOSA 5EZ5A 4IUDS 3FBWA 4OI4A 4UC0A 2YYSA 1ECPA 2QX9A 1DJQA 1M1YB 2QI9C 4WZZA 1XGKA 4FN4A 2FE1A 3FDFA 4G0NA 4YV2A 5L6MB 7MHTA 4AMBA 3VO2A 2DLNA 4LK2A 4GGPA 4TKVB 1GAXA 1YRAA 3O2JA 2XMQA 3ZBUA 4YXFA 2AOVA 1OI2A 2R97A 2NXNA 3JPWA 3OF2A 4OREX 5JRJA 4GUDA 4HXGA 2G88A 5LQNA 4YUZA 1H1TA 4MUAA 5I7OA 1KMHB 4NOJA 3JWPA 1V6SA 5LZ4A 1ZUWA 3A9RA 4O2BB 1JHRA 5B30A 4B09A 2YW9A 1K0UA 1NVTA 2EQAA 4HLUC 4GQBA 4GOLD 1A1SA 3H18A 1GKKA 1IBLB 2B69A 4EB6B 4HTFA 1P17A 1Z4JA 3IUYA 3LWBA 4M7RA 2OQVA 3W2FA 3G0HA 4URUR 3DWIA 3ROXA 3HCRA 4ZT2A 3KALA 2FN7A 3WK9A 5CDTA 3IOMA 4J3FA 1R10A 3IP1A 4Q01A 5J2UA 1XCJA 2B7CA 4P1ZA 5LP6C 2OG2A 2GD1O 2P3LA 4FDLA 4I66A 4H6VA 3OT4A 4A10A 5AW5A 2JJ2D 5BUSA 5CDSA 3IP7A 3ELUA 2LCIA 3AESA 1T2VA 2ZT5A 3BFKA 4O4HA 1NVXQ 3I23A 3P27A 1HMPA 1HKHA 4XX1A 3FMOB 2FZGA 2H2WA 4XDHA 4I99A 2JNWA 4ZALA 4OP1A 3PC2A 2H9IA 1P7ZA 1FUEA 1GGKA 3MLBA 1LSJA 5IMSA 1L9KA 3C98A 1ABEA 1PCXA 2YJ5A 2XCUA 2ZU0C 3DW1X 4C7XA 4DEVA 5C8XA 4HDKB 1QQBA 1CUDA 1CJVC 4D81A 2ZSBA 3IOYA 4EJSA 1P2BA 3ENNA 4QG7A 1R74A 4XQ9A 5B4TA 3WKEA 2YRXA 3AB7A 2A5DA 3N70A 4QBTA 4NQZA 3P94A 1GNPA 1KDVA 4GSYA 4Z86A 5ENVA 1Z6PA 4GPBA 2WSSD 3G1WA 3R77A 3ICEA 1FP4A 1XBTA 1Z28A 1KGSA 4FZJA 4MW0A 4XWAA 1ZI9A 2VLBA 4FN5A 1GEEA 3D9QX 4BPBA 1Q1NA 2D1RA 4ED9A 3LL4A 4YJ3B 3WHKA 1M34E 4A7PA 3NTRA 1UQRA 1ND6A 3UMBA 3VOTA 1AS0A 3L04A 4QKQA 5BSFA 2GKSA 2L17A 3MBIA 1US8B 5TY0A 1X87A 4HK4A 2C1XA 4HFRA 3TPZA 1XZJA 2W4QA 4RZSA 5F3DA 4EG5A 1H8ED 3FYUB 4M76B 2HJVA 4B6GA 2QW0X 4PRKA 1UIRA 4J2HA 1H85A 3LNTA 2B30A 3BXFA 2ZRJA 2MU1A 4OQDA 3F6RA 3L4EA 4ZU1X 4CKCA 5CEFA 2YN4A 4EQ6B 3FRHA 1RR6A 3NFRA 5AVYA 2FK7A 1YR9A 5FPTA 2AMVA 2QVGA 5JCOC 3BIWA 1NBHA 3DTYA 4C5BA 2B0CA 3GUZA 4D9BA 1NHWA 4TSRA 4B3GA 3MBOA 4AL4A 4BCDA 3QVGB 1FIUA 4NZ9A 5GGXA 1PV4A 2MR6A 2XUDA 1OOEA 4HDNB 3OURA 4QBGB 3AVTA 5DWVA 3R3XA 2R8ZA 2JK0A 1TVMA 5DLYA 4DDMA 2Q3DA 2XBMA 3I3SR 3EVAA 3PSAA 4LXXA 2ZUBA 2WOOA 2DWPA 2V45A 1DAOA 3HQ4O 1XRQA 4FK8A 5DNWA 5AM2A 1YZKA 3TCKA 2OXEA 4G5RA 2XB2A 1E6WA 3KPVA 3AUYA 5HUHA 3EMDA 1FPQA 3R4CA 3RTDA 3R44A 4WERA 4N1AA 4CYMA 4YP5A 1PG5A 2CHEA 3ITNA 4QBHA 4GIBA 1H2XA 2DUNA 5HTKA 3BRWD 8AT1A 3GEPA 4JODA 1WA5A 4IINA 4PCVA 5IAKA 3L7LA 4DRYA 3GLGE 3X3HA 1F8GA 1PZXA 4L8WB 2IS2A 1KJZA 5EJIA 4PAWA 2E18A 2JANA 1SUAA 3EF3A 3QEJA 2C4UA 1KYWA 2MWMA 1OIWA 2PLAA 3FAKA 4B3CA 2A9QA 3PNBA 4EA7A 5F2NA 5KDDA 5KX5F 3MELA 2QPTA 1PNOA 4G0ZA 1SUSA 5J5VA 4HLUA 3HK2A 2PFSA 2IEGA 1MO4A 3MT9A 5KNDH 3DLPX 2OV6A 3GW8A 4WTOA 5LD2C 1YR8A 3KUKA 4RZQA 2FWRA 5EIHA 4RJ2A 3TLZA 1FVOA 4D9MA 3AGPA 1GILA 2CFCA 4V0NA 1XQYA 3DGFC 4Z8YA 5KYGA 1ZK0A 4EP1A 3BD9A 1ITZA 4LKRA 5ALHA 1TJ5A 1V5EA 1FL9A 2MDTA 3O3NB 3DLBA 1VJGA 4NCJA 1F0NA 5DW0A 4QVKA 1P75A 2Q4DA 3E4CA 4BQFA 1EE2A 1ZXLA 3A8TA 4WNYA 3OTHA 2H00A 4RELA 4RH0A 2EWWA 2HJHA 4D5EA 3NIDB 2PRJA 4MGZR 3X0DA 2PE5A 2RKBA 4N76A 4L75A 5LXTF 2XUKA 3D1JA 4E21A 1NTOA 1NWCA 2OQ2A 1LC0A 2CFTA 2KPOA 3NNSA 4KCGA 4L9RA 5EMLA 3VQTA 2Q45A 1U4SA 6LDHA 1F20A 2WWVD 2AF4C 4KQKA 3BWVA 4I4LA 2VJPA 4HB0A 3TTVA 4QQKA 3Q7EA 1BE6A 2GBGA 4RD3A 4BQPA 1USGA 2BGGA 1HH4A 2B99A 3DCIA 3R6DA 4M0EA 4X60A 1V5WA 2RGXA 1K6EA 5JISA 1U7HA 1V25A 3NM4A 3GCXA 1XK7A 4HMOA 1JNXX 3KYDB 3G9TA 1PLLA 3P2IA 1S7CA 2FOIA 3QA3E 5JS2A 2QE7D 5A5DA 5IPFA 2DR2A 2WIDA 1PIWA 1Q83A 4NI5A 2JC3A 4DLZA 4HX2A 4ISBA 1XJCA 4JLDA 2PT5A 1E4VA 2WE7A 5CM8B 5HE9A 1CF4A 1DBPA 1ICIA 1KAHA 1KU6A 3JQ9C 1V9CA 4F21A 3JD2A 4H31A 2QV7A 3T4UA 1TUEA 1Z2EA 3KSDO 3WLMA 1MIOA 4BPRA 1OX6A 3NWJA 1W59A 5C52B 4NXNB 1ZYUA 1NLYA 3BICA 4XVRA 3T3PB 1SFRA 1CP3A 3U37A 3WYFA 2EKPA 2H1HA 2GXQA 3FPBA 4UQLA 3MZ0A 3PXXA 2RGCA 1J70A 1SKQA 4IIYA 4TLAA 2LE0A 4IOJA 3DM5A 4L5BA 3U3KA 3D8RA 2ZVQX 1MG0A 4PINA 1UBMS 2AOWA 1FC0A