4WE3A

Structure of the binary complex of a zingiber officinale double bond reductase in complex with nadp monoclinic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
342
Chain Sequence
DVVVVNKQVLLKHFIPAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMIGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
molecule keywords Double Bond Reductase
molecule tags Oxidoreductase
source organism Zingiber officinale
total genus 109
structure length 342
sequence length 353
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4we3A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4we3A01
1GL3A 2J5QA 1ADCA 3QHAA 1P0FA 1M67A 2IZ1A 3U62A 3OETA 3A28A 1ZK4A 2IRWA 4EJMA 3KRTA 4XQ9A 3WMWA 2GERA 3WB9A 1GUFA 1UP7A 4FBGA 3X2FA 2I6TA 4CMGA 3G17A 4TMFA 2NVBA 5I8WA 4OH1A 1V6AA 5JBIA 4TVBA 2PNFA 4YRBA 1BG6A 4CM9D 3L77A 1RYEA 1NAHA 3HDQA 4BNJA 2TMDA 4DLAA 3NTRA 4BGIA 3QQPA 7ADHA 1P31A 2YDYA 3WYBA 1VL0A 4R54A 2DLDA 3DAFA 4MIEA 5EIOA 2OOSA 1Q2XA 5T64A 5KJ1A 2DFDA 5L7WA 4L74A 2NUAA 1H2BA 5COQA 4WASA 1UAYA 1WDKA 1J6UA 5CFZA 3HB4X 2OORA 4UVGA 4AJPA 2C2XA 2JFGA 2X22A 4HFMA 4EJ0A 1GD1O 2HMTA 4OSOA 2VWGA 3TL2A 4DUPA 2AHRA 3H3JA 3PFFA 3PJDA 4B79A 3U4DA 1DFHA 3ZV6A 4CLEA 4A7PA 4J91A 5TT0A 4CM5A 2AA3A 3KEQA 4ZQBA 1JWAB 1ZMOA 5IG2A 2VTEA 3W4JA 2PZKA 1XHLA 2C59A 2VWQA 3JQEA 4WEQA 3GR6A 3TSCA 3UW3A 1UDCA 3D64A 1KC1A 4FFOA 4O6VA 4U7WA 3WQSB 1R16A 3S2GA 1GZ3A 4PLVA 2EJVA 4J9UE 2NU9A 1GCOA 4PCVA 1EFLA 3CUKA 3IKVA 4Q3NA 5B1YA 1M76A 3CMCO 3H9EO 5TJHA 4CM7A 1PJLA 3GG2A 4JJFA 4W9NC 1WMBA 2JAPA 1CJCA 1TVEA 3CZRA 1DAPA 1I0ZA 1HYGA 4NIMA 4YJGA 1HSZA 2Y0EA 1DBVO 4XR4A 5DCWA 5JXWA 1MLDA 2Z1NA 4YJFB 4LISA 3R1IA 4ZVVA 1F06A 3GK3A 3JQAD 5KVVA 1QYDA 2BKAA 3PWZA 5CEJA 5KIAA 3Q2IA 2J3KA 4P4GA 3RC1A 2WMDA 4L73A 1HTBA 4UREA 2G0TA 1PGJA 3UICA 3NDRA 3DHNA 2VOEA 4HFJA 4N5LA 3RUIA 4BIIA 4R3NA 2DBQA 2C07A 3PJGA 1WZIA 3C1OA 3OIDA 4GX0A 2VZ8A 3BXXA 3I1JA 4ID9A 4K6FA 2ZQZA 4QSMA 2DTEA 1C1XA 4RORA 2R00A 2J6IA 4J1QA 4QO8A 2BI7A 3JQ8A 1RM4A 4XCVA 2NV6A 2NADA 3PWSA 2QRKA 4PG5A 4IS2A 1QLJA 3ITKA 5EINA 2BD0A 3KLMX 3D4PA 4ZU3A 2JD1A 5TLSA 1MUUA 4R68A 1I5RA 3OP4A 1ZO8A 2IYPA 1GDHA 5GZ3A 1HWYA 2GO1A 1LDGA 3ROMA 2FPGA 4BKPA 1KVUA 1PS0A 1R4NA 4U0JA 1JA9A 1NR7A 5IF3A 1NFQA 5JSFA 5KJCA 2X9VA 1PZFA 3RD5A 5JNLA 5F1KA 1D1TA 3H9GA 1DJNA 4CUZA 4KDEA 1E1MA 4IMRA 5ILGA 2PH3A 3TDKA 1PS8A 3BZUA 1LA2A 1DIHA 2X0JA 1ONNA 1N7HA 3NTOA 3PLNA 4AJJA 4HNHA 2NLOA 3EAGA 1N2SA 1PZEA 2W2KB 2X23A 4TRRA 3V2UA 2VRBA 5JO9A 1IYZA 4M54A 1BMDA 1T2FA 4ROSA 1UXKA 3DFZA 1HDYA 3RROA 1LEHA 4CM8B 3ADOA 4XWYA 3FCOA 4FC7A 1H6AA 3OA2A 2G5CA 3QW2A 3DONA 2QQ5A 3DOCA 3RU9A 3IMFA 4C4OA 2WD7B 4WE3A 1EE9A 3HZZA 3NJ8A 3DR3A 2FSSA 5COBA 2EKLA 3DZFA 4XQEA 3B1JA 5BNIA 1ID1A 2O48X 4JN6B 3OQ1A 4D3FA 3BMQB 4IDGA 4RL6A 2NVUA 1H6DA 1UP4A 2BMAA 2AW5A 2B36A 3GLQA 4HV4A 2ZATA 3QE3A 5TGDA 3DZJA 3C1TA 1E3JA 2F1KA 3TWOA 3PLRA 4XRRA 1EDOA 4FFNA 4ZHSA 3A1NA 1A7KA 2GLXA 4F6LA 2EXXA 2Q1WA 4JBGA 2Q2VA 5A9SB 3ZWMA 1ML3A 1VSVA 3KETA 3F5SA 3WGGA 2IYOA 4YT8A 1U8FO 1PL8A 2V7PA 1IOLA 4NJOA 2J3JA 4D44A 3JQFC 1CWUA 2VYNA 1DRUA 1RM3A 2PZMA 4I5EA 5HBRA 4NBUA 1Z7EA 1GQQA 1Z82A 4FFMA 3ZHBA 1TB4A 2EW8A 4Q3DA 1W0CA 5L40A 3IS3A 4DIOA 3HUDA 1MFZA 4DL9A 2YUTA 1DHTA 3QY9A 4YAIA 4PLPA 2Y66A 4E4YA 3BTOA 3FTNA 3JQGA 5EERA 1B15A 4P38A 2NTJA 1XKQA 3H65A 3AFMA 1UR5A 4FQ8A 4GX2A 3M6IA 4IJUA 5B4TA 4K6CA 2Y1DA 1XEAA 5BSFA 1E3SA 1NVTA 4E6PA 3ZI0A 1DO8A 1RKXA 3VKVA 3B6ZA 3AI3A 1PJ3A 3BHIA 2BGKA 2ZB3A 2VCYA 2P91A 1T4DA 4ZA2A 5AXBA 1ZH8A 3DZGA 4J9VA 3GAZA 2X5JO 2G17A 2H5LA 4GSKA 2EKQA 4ILKA 4CJXA 4Z0PA 4DPKA 1YQXA 1OOEA 3QRWA 3K30A 4RLHA 4TRMA 3Q1LA 4W7HA 3NAQA 3D1LA 4MVJM 1ISMA 4NBTA 5TJ9A 5L4SA 4BOYA 2X0NA 1GY8A 4J7CA 1ZZEA 5JCJD 3IKTA 3ETGA 1IE3A 3INTA 2C82A 4K28A 1YL7A 5T8KC 5A03A 3K2EA 3VH3A 5CG2A 3DMYA 5L51A 4R9RA 4XGNA 4J1TA 2OP1A 3TZKA 4RZIA 2EJWA 3NYWA 3QVXA 1KETA 5TS3A 1ARZA 2NSDA 4ND4A 2Y0DA 2J5KA 3OEWA 1EUZA 2C29D 1KVSA 1V3UA 2I3AA 4RDIA 1LDMA 6ADHA 4JNKA 3RJ5A 1Q7BA 2X0RA 3RBVA 3SEFA 1M75A 4OXYA 3W1VA 4R4JA 1K5HA 4GKVA 3SC4A 3UCFA 3QWIA 2FOIA 1QORA 4LRSB 1FF9A 3CSDA 1V0JA 3ZGYA 1YOVB 3UN1A 2Q1TA 1K2WA 3KLPX 4PLCA 2JCYA 1GAEO 2X6TA 4J6FA 1NR1A 4GMGA 5CDTA 1VM6A 3WG9A 1E5LA 4RCVA 3WNVA 4U5QA 1HZJA 5KWEA 3O8QB 3IAHA 5HS6A 4CQLB 4LK3A 5JW6A 3N58A 3BMCA 3OHSX 3SJUA 1WZEA 3TF5A 4MVJI 3GNTA 5ER9A 3SLGA 5B4VA 1A5ZA 4LN1A 2ZKLA 3C7AA 4CV2A 1A4IA 4RQTA 1XIVA 3EK2A 3W6ZA 1ENZA 3KVOA 3Q2KA 5CEFA 5HWSA 2PGJA 4TZTA 1U4SA 1H93A 2GN8A 1MB4A 1SO8A 3WGTA 1ZVMA 4J2HA 4PZCA 3U3XA 3W8DA 1B16A 3EVNA 3VH2A 4OOEA 5KCZA 5F21A 2Y1EA 1UP6A 3MJ4A 2DC1A 2UDPA 1YBAA 4MINA 2JJYA 1IHXA 3QIVA 3QP9A 1JVSA 3W4IA 3PYMA 1PQUA 1BHSA 2O50A 1UZLA 1ZW1A 3K2BA 4XYLA 3KYDB 1SNYA 4HUJA 1IULA 1AE1A 4TRNA 1WPQA 3ZU4A 1E6UA 2DTXA 4L75A 1P3DA 2Y1OA 3SC6A 1R37A 1YDWA 4NHEA 2CNBA 4MVJF 4PRLA 3GFGA 3AUUA 4R5HA 4UVHA 4DREA 4BNHA 3DWFA 4UUNA 4HFRA 1H2HA 4A2CA 4RPGA 4E30A 3LYLA 4OHUA 2OZPA 3RJ9A 3KYBA 1R6DA 2O2YA 1HLPA 3WXBA 4CLRB 4EUHA 4R1SA 2IXBA 3ZDFA 1HDOA 1FK8A 2PZLA 3MEQA 4ZQGA 3JD2A 2AEJA 4J7XA 4JIGA 1OC4A 2CY0A 5THQA 3GF4A 2Z95A 2GN9A 4FD3A 3ANLA 3VTZA 4PIVA 5JDCC 1MFPA 1N9GA 1XA0A 5BQFA 4D41A 4E2YA 8ADHA 1IPFA 4EZBA 4A10A 4PG6A 2AEFA 2WJPA 3T4XA 5IAAA 4EBFA 2GRAA 1X0VA 5CDSA 3E82A 3PTZA 4MVJG 2X0IA 1MG5A 2DFVA 3GRKA 4R1UA 4WCFC 3A9WA 3BMOB 1DHRA 3PP8A 4FFPA 4N54A 5K9ZA 1C1DA 5DBFA 4BQRA 4CL3A 1ENOA 4E13A 2QZZA 4UEOA 3I9OA 3DAPA 4BHTA 1O6ZA 2HLPA 4XDZA 1LRLA 2FMUA 2JFHA 3Q11A 4F6CA 2DU8A 2DBRA 2C7GA 2GPTA 2B4RO 5AVOA 3IJPA 1HSOA 2D59A 4MVJH 1QMGA 2Y1FA 4AJ1A 3UH1A 3PHLA 4CM3A 5LC1A 2NU6A 3L6EA 2JFFA 2XPCA 3FWZA 1HLDA 3DBVO 1PJSA 3NTQA 5BR7A 1T1SA 2Q99A 4OO3A 4LGVA 3M1LA 3L4BA 2C2YA 2C54A 2W2LA 1HE5A 1LSUA 4IBOA 4LVCA 4YEDA 5JYDA 4J1NA 1U3TA 4Z9XA 4IDDA 1P1FA 4YXFA 2V6MA 4W82A 4IDEA 3OECA 3PHGA 5JAMA 2VRCA 3FPCA 4E31A 3OA0A 4BO8A 3E6AA 4B4WA 1GZ6A 3TFQA 3D4OA 4FJ0A 1Z74A 3ULKA 3MOIA 3PI7A 2PK3A 4YRDA 2UUOA 5A3VA 4DIBA 3UF0A 3I9JA 3N7UA 1UXHA 4E5MA 3I9NA 2CF6A 2OUIA 2ZK7A 3NDIA 2VNSA 4WLEA 3FNHA 3AY3A 5JE8A 4KZPA 4YJHB 5CPFA 3KYCA 1SEVA 3BA1A 4EDFA 5G0VA 2VHZA 4D7AA 3HN7A 3GPIA 4A73A 5G2OA 3GZ4A 2DBVO 3JQBC 4BB6A 2O3QA 4BO5A 3I9MA 5JO0A 3BMNB 3DZBA 2VZ0A 5JMWA 2Q50A 3FR7A 2Q3EA 2Q45A 4B3HA 3P2OA 3GPDG 2B0JA 1N1EA 4FFLA 4XJTA 1E77A 1JLLA 5DCUA 5FEUA 4F45A 1ZK1A 4R41A 3KSUA 1VPDA 1LJ8A 1E3EA 4YAGA 4OXKA 2UV8A 3UVEA 2CVQA 2ZB8A 1V8BA 2Y1GA 1NP3A 4X54A 1J0XO 3ENKA 5IZ4A 2EP5A 2X5KO 3BMQA 5JDIA 2P4HX 5AYVA 4L4XA 3ICPA 2HO5A 1Q7CA 3AWDA 1ORRA 3G49A 2BRUA 3ZWBA 5HRUA 3VZSA 4XZ3A 3U5TA 2BELA 3FWNA 4AJNA 3H9QA 3VZRA 3GVPA 3BTSA 3TZHA 3FF4A 2NU7A 3TN7A 2X9GA 2XOXA 4AJIA 1A71A 3IJRA 4II3A 2BFAA 4CL8A 4KOAA 3RUEA 1TXGA 1NXQA 3TRIA 2X7HA 3D3WB 3I52A 2A92A 2NACA 1ZEMA 3M2PA 3ADPA 4YWJA 1PGQA 2PTGA 1OAAA 2D2IA 1B3BA 4E5KA 2OFPA 4BNZA 4EEXA 3GUYA 4JQCA 4RVHA 4U8GA 1SZJG 1QP8A 4XEHA 1KY5A 1YH3A 2XXJA 1ZK2A 3IQDB 3P2YA 3V8BA 1LDYA 2ZCVA 1N1GA 1AGNA 1P33A 4CMIA 1SC6A 5BSEA 1KERA 2PGDA 1NASA 1G6KA 3O9ZA 4IDBA 5A1TA 4Q9NA 5I7SA 1ZIDA 4J43A 3QJ5A 5A05A 4ZRMA 1OMOA 5ICSA 3MWDB 2J5RA 4XKJA 3MJVA 3E9QA 1D1SA 3IIEA 3OEYA 1O8CA 1IB6A 4UAGA 3MJEA 4G2NA 4BKOA 3W8FA 4B8WA 2YJZA 5GY7A 4BGUA 3CMMA 3I6IA 3U49A 4L8VA 3VPHA 3ZV5A 4AJKA 1IY8A 2VYVA 3DTYA 4YB8A 1HE4A 5KVSA 2PWZA 4DPMA 4PG8A 3ZWYA 1GCUA 3L0DA 2BGMA 3MOGA 4BV8A 3IP1A 4DLBA 1JAXA 1JTVA 1HT0A 3ENNA 4JBIA 3PYXA 3WTBA 5JAQA 3RWBA 2EGGA 3WNQA 4YR9A 3TZ6A 3UHAA 1RYDA 4NJMB 1XQ1A 3SXPA 3M1AA 4FDAA 3RIHA 1GUZA 3GZNB 4WLUA 4YJDA 1BVUA 1PL7A 1LXCA 3CXRA 5CG1A 2OHXA 2VWHA 5GMOA 4UEJA 5AOVA 2YFHA 4DBZA 2ZJ1A 3DOJA 4BNLA 3JYQA 2VUTA 3KUXA 2ZYGA 3WOHA 5L9AA 2X86A 1EEHA 1AN9A 2AQ8A 4GVXA 4Z3DA 4EJ6A 4ND3A 3AJRA 4BO3A 1LDNA 3AUTA 1E3WB 1XG5A 2H6EA 4ZD6A 4BNFA 2CSUA 2AE2A 2VOJA 4NFYA 1F0YA 1LI4A 3NDJA 2NQ8A 2B5WA 1P1JA 1R4MA 3ORFA 4NH4A 4W7IA 3G1TA 2CDAA 1X15A 3DC2A 5F1OA 4MIYA 1QLHA 2JD0A 2Y05A 2RH4A 3E5MA 4JP3A 1E1NA 3LC2O 3EZYA 2I76A 3AU9A 4Y98A 1ZCJA 2DUUA 1KC3A 5KKCA 3ON5A 2JKVA 3GOHA 4CQLA 4CR6A 1E3LA 2YW9A 4CR7A 5MDHA 5TQVA 3D5TA 1HEUA 2D3TA 1U1IA 3GN2A 2R6JA 5ADHA 1KIFA 1NWHA 3ANNA 1FJHA 6LDHA 3GVCA 3STHA 4BNGA 1L7DA 1LUAA 2HMUA 2O4CA 3NGXA 1TT5A 4YYZA 4FSHA 4F46A 1SAYA 1PGNA 3DEYX 3TJRA 4LCEA 4ALIA 4WCDA 2E4AA 3JCZA 2Z1MA 4Q3CA 4P4NA 3ZWOA 2IZ0A 4RF3A 4BMVA 5K0ZA 5ILOA 1WWKA 4OOFA 4KUEA 4CLOA 2IE0A 4IUYA 4D3SA 2PD3A 3TOZA 4OYRA 2WE8A 4CM9A 5HTOA 5JYEA 2I66A 1I3NA 1VL6A 1X14A 3FSRA 3EW7A 1Y6JA 3ANMA 2DVMA 3LQFA 4J3FA 4RO0A 1EE2A 3O26A 3AU8A 3JD3A 5CPBA 4FJ1A 4EUFA 4I1IA 4FS3A 4ALLA 5C5IA 2YV1A 3EYWA 3JD0A 1ISGA 4KWIA 4NDNE 4Y6SA 5EPOA 5L4LA 3LT4A 5JFOA 1P77A 2YQ5A 5A06A 3PQDA 5KNLA 2Y68A 3GFBA 3Q9NA 2W90A 2C0CA 3GMDA 4TRJA 4FC6A 5T6BA 3WIEA 1U5CA 1G0OA 2QIOA 2ZIZA 2C7VA 2HJSA 4D46A 2NWQA 2VHVA 2O23A 2WYUA 4FCCA 3KM0A 3E9NA 2OGUA 2P2SA 3C1AA 3KV3O 3T4EA 1E7QA 4Q3BA 2VNAA 4WPGA 1PZHA 2O3TA 1KOLA 3D0OA 3GVHA 3WQRA 5G4KB 1ONOA 2EV9A 5G0WA 1E6EA 3VZQA 4BO4A 3LT1A 2P9EA 4BQPA 1JKFA 4E5YA 1K0UA 2HU2A 3S2IA 3ZV3A 5A5EA 5ITWA 3WQQA 5K6AC 1F17A 3U9LA 1FDSA 2FZWA 3L9XA 3RCBA 3WIDA 3NEPX 3VZPA 3CPSA 5U1PA 1I3KA 3I83A 1YBMA 4B4OA 4CODB 3I9LA 3JTMA 3JQCA 3C3XA 3C24A 4YA6A 5JY6A 3H6KA 1ZXLA 4FGSA 4MVJE 2NQTA 3HNPA 5IXSA 1GQYA 4G65A 3DBHB 4AJOA 5CHEA 3F4BA 3WS7A 3JQAA 4S1VA 2YFQA 5IN4A 1I01A 2RHRA 1BXGA 1PGPA 3KZVA 3E18A 4NBRA 1NYTA 3LDHA 1U3VA 3HDJA 4M8SA 4B7UA 4K1LA 5C7OO 3KO8A 1O95A 3VAZA 4BO2A 5A5FA 5ER6A 4IGEA 1N92A 4JXKA 4EYEA 4ND5A 3PQEA 4IDAA 3KSDO 1YJQA 4NI5A 4WEOA 3GT0A 1K6IA 2FZEA 2DQ4A 1Y9EA 3K96A 4EI2A 3WX0A 1DFIA 5AXAA 4CV0A 3GQVA 3MJTA 1RM0A 1CIVA 3ASUA 4OKNA 1H6CA 3CTMA 4A5OA 2RIRA 2VTDA 2AQHA 3I4CA 2EGHA 2C5AA 3ZNNA 2A35A 4YT4A 4AICA 5A3JA 4UUPA 1J5PA 3K92A 2BGLA 4Y6PA 4WUVA 1DIBA 4JX8A 4NMHA 4YAJA 2VT2A 2Q4EA 2YV2A 4CR8A 4D42A 4E21A 4PGFA 3VPXA 4BO1A 4H7PA 2IZZA 3E48A 3EHEA 1GEEA 4RF4A 3P7MA 1JAYA 1IZ0A 2ZYAA 1EBUA 3D7LA 3Q3CA 4I5GA 3HE3A 4RVFA 5FFFA 4E2XA 1E7WA 1A9ZA 4U6SA 4D43A 3H9UA 1Y9AA 2O2SA 4J90A 1GR0A 4DYDA 5DNAA 1U5AA 4CMAA 3W4KA 1ZK0A 3AOEC 3GG9A 1UZNA 3S2EA 2EWMA 3UAGA 3OJLA 4YRAA 4PLHA 1ISFA 2PKRA 4DWVA 4R5MA 1ZNQO 5F1PA 2YHIB 1RJWA 4GWGA 4JK3A 5GZ6A 1TLTA 2VHYA 5BNFA 5C7IO 4WCFB 2YYYA 1NPYA 2D4AA 4XYMA 2AXQA 3DOOA 3VKUA 1VE9A 4L76A 4MKZA 1F8GA 5JPIA 1KVTA 1GFSA 2RCYA 1XCBA 2WM3A 4DXHA 3GN1A 2O3UA 2AG5A 1Y5RA 1C0PA 2NTNA 1ZXBA 1DLJA 3DQPA 4W9NA 1X7DA 4ZGWA 4HKTA 4I9HA 4OJNA 2UAGA 4D3DA 1KVRA 5I7VA 4WK6A 1VJ1A 3WWYA 5H83A 3MTGA 1EBFA 3EC7A 3DBLA 3DMTC 3HSKA 2HUNA 3SLKA 2CZCA 2RAFA 4CMEC 2JCVA 3WFIA 1VRWA 4ND1A 3NRCA 4CLDA 1J4AA 4CV1A 4GGOA 3UCEA 3ZCXA 3ONFA 4HNGA 3G0OA 1BSVA 4WJZA 2VUSA 5U9CA 1QR6A 3WBFA 2EEZA 1E7SA 3F3SA 2POQX 2FP4A 3ZWAA 4BO9A 4D0SA 2I67A 4J16A 1PU2A 5BSHA 2ZTLA 3I23A 4CM4A 3ASVA 4D45A 3KHUA 1U2GA 3O03A 3JQ9C 2BFMA 2R2GA 5JLAA 1XGKA 4HFNA 1E0DA 3JQ7B 3Q6IA 3PPIA 5KOIA 1E1LA 4AJEA 3FR8A 2YY7A 5TIIA 1U3UA 1Y1PA 4E2WA 5IXYA 1IL0A 1D7OA 2QG4A 3CIFA 4Y6RA 1QSGA 3ZWVA 1D8AA 4FGWA 3DZKA 3IL2A 3GVXA 2GYYA 3K73O 4NU6A 2PFGA 1CQJA 2GASA 4JBHA 1K3TA 4Q3AA 1X1EA 3RUDA 3RU7A 1QYWA 4IIUA 4OM8A 4CPDA 3ITDA 1P1HA 1RWBA 4BVAA 1R66A 4INAA 5JY1A 3PZRA 5G0SA 5IZCC 3WR5A 5K1SA 3GHYA 1CETA 4NFSA 1YWGO 3Q9UA 1GPJA 1L1FA 4DBVO 4GQAA 4NPCA 5JCJA 1PEDA 2P9CA 1PS9A 1NNUA 1Y8RB 3OJEA 3ICCA 4NNJA 1DJQA 5A04A 1A27A 1HDZA 1U7HA 3KTDA 4GX1A 4XIYA 5DULA 5GZ1A 4R9SA 2PZJA 4RPHA 1QYXA 5DZSA 4H15A 5TSDA 4BKRA 1JKJA 4AJ2A 3MJSA 1SOWA 5BSGA 3GZNA 3NX4A 1TT7A 1TA4A 3G3EA 1Y8QB 1QV6A 3GHHA 5DBGA 1MGOA 1O5IA 2WYWA 4NR0A 4KQXA 3NT2A 1NFRA 3OBBA 2A9FA 7MDHA 2BHLA 3S1LA 1H0KA 3PIDA 1HDGO 3VPGA 4IQ0A 2VHWA 4E12A 3PJFA 1VLLA 4WLVA 4XRGA 4AFNA 4JCOA 2EIHA 2GUGA 1B8PA 1ULUA 4OXNA 3L07A 4YJGB 3RKRA 5HS4A 3BIOA 4GSLA 1HL3A 3G79A 3ZU5A 1S7CA 1E92A 4GL4A 2HMSA 3LF2A 2PKQP 2EW2A 5IDYA 3TZQA 1Z73A 3JQFA 3V1YA 4ZN6A 3PYLA 3F47A 1VJTA 1O89A 3EVTA 3L9WA 4L4SA 1VJ0A 4FOSA 4KUHA 4IM7A 4PVDA 3ZU3A 4URFA 4RF2A 1QRRA 1Q7GA 1PJTA 4YAKA 3WGOA 1XSEA 4Z9YA 5EMHA 4EITA 2PLAA 3MTJA 2IEDA 4B3JA 1NPDA 4DC1A 2VWPA 1EQ2A 1R15A 3IOYA 3GVIA 1VL8A 4A0SA 2B4TO 4YT5A 3F46A 4IPTA 1T2DA 2X4GA 1LLCA 3T7CA 4I5DA 3FNEA 4K26A 1PZGA 2BI8A 2RHCA 5FYDA 2ZYDA 4E32A 1QG6A 5T5QA 1M6WA 1OI7A 1JQBA 1WW8A 4LMRA 1U7TA 4XA8A 1GEGA 3V1TC 4GPD1 1EK5A 1SB9A 5B4UA 4U6QA 5I7FA 3JD1A 4YDRA 1R4NB 3GH3A 3WJ7A 3U0BA 2NVWA 4PVCA 2HMWA 1EVZA 4WLFA 5F5LA 3H5NA 4PRKA 1ISIA 5KJFA 3O4RA 4G5HA 4TKMA 4RVSA 1AHHA 4YJFA 2WD8A 3GEMA 1T1RA 1ONPA 1Q0HA 1JVBA 2CF5A 3E8XA 3PHHA 2A94A 3BHMA 4OIMA 1U2DA 1U4OA 2WDZA 5T8KA 2V6BA 3V5NA 1FDWA 1Y5MA 2JD2A 1C14A 3ZWCA 2E37A 2NNLD 2NTVA 1VI2A 4QT0A 1ZFNA 2LDXA 2VN8A 2YZ7A 2B35A 1GU7A 5DT9A 4XYGA 5IN5A 4EW6A 5B37A 3HFGA 1CERA 2Q49A 1WMAA 2E82A 4AVYA 3VH4A 1B26A 2BH9A 4GH5A 1C0IA 4CQMD 4CV3A 2W98A 1V35A 1EUCA 5ENDA 1R0LA 1I33A 3I4FA 4B8ZA 2O3SA 3QWBA 1Z7BA 3AK4A 4DMMA 1JW9B 1B7GO 3P5SA 3GMSA 4R3WA 4BNIA 1QKIA 4AL4A 2UVDA 1F14A 1KEVA 2H9IA 3L6OO 3DL2A 4MVJD 1DFGA 1F12A 2OL4A 3DFUA 4OQYA 4IGFA 5EN4A 5A4DA 2BFPA 1YL6A 3S8MA 1E7YA 4WLNA 2O7SA 1EQUA 2QW8A 3P19A 3B1KA 4BNTA 1PIWA 2HQ1A 2OO5A 4Z6KA 1HDXA 1SB8A 3JQ6A 3FTPA 4IZHA 4RVUA 5J23A 3DXFA 2W2KA 3DO5A 3ZWXA 4CMJA 1I3MA 3DZHA 3EY4A 1KBZA 2O4UX 4LVUA 1T2EA 1QV7A 4A03A 3DBHA 3CEAA 4CM8A 1BTOA 4L0QA 4DYVA 1CRWG 2NU8A 1GTMA 4UVDA 4BNUA 3LC7O 1G1AA 4FOOA 3U4IA 2PH5A 3PZBA 4XJSA 2W8ZA 4DC0A 4C7JA 1FDVA 1H94A 2WD7A 4HY3A 3OICA 1JKIA 1IHYA 4L4RA 3TZCA 1AXGA 5H82A 1LTHR 2PA3A 3ABIA 2CD9A 2FR8A 4EUEA 5AQ1A 3H2ZA 1PGOA 2ZTMA 3I9KA 1ZJZA 1Q0LA 2DAPA 1PSDA 1CEQA 3OMLA 4TQGA 1NM5A 1LSOA 1ENYA 2CVZA 4R69A 2NM0A 2X58A 1SBYA 4RV9A 1H9BA 3H8VA 5TRTA 3H5RA 3WFJA 3BYZA 3GDFA 3UUWA 1ULSA 1GQ2A 1H5QA 4II2A 1ZEJA 2H63A 4AG3A 5A9SA 1PJBA 1UDBA 3AOGA 3FI9A 4GWKA 1LQTA 1YBVA 4GAEA 1B14A 5ES3A 3K8ZA 4NBVA 4D0RA 1N7GA 1GPDG 5IDQA 3QVSA 4WOJA 1UXJA 1NAIA 2ZTVA 2FSVA 4KUGA 2Q2WA 1U8XX 3UKOA 3PEFA 3LK7A 1HE3A 3V1UA 3OH8A 3HWRA 3GGPA 1NHGA 2GZ1A 2XF8A 1DDOA 3GA0A 4J2OA 4BL5A 2JHFA 2OXIA 3OJ0A 2CUKA 5JDCA 4HADA 1KEPA 1PX0A 5TF4A 2D8AA 1W4ZA 4CM1A 2Y0CA 2AMFA 1UXIA 1FXSA 1K89A 2O3JA 5TNXA 1WVGA 1BDBA 3JQDA 1V3TA 4IQGA 1BW9B 2R00C 3VVCA 1O0SA 3QA9A 5B12A 2G76A 1YB5A 3RBZA 2Q2QA 4WCFA 4WLOA 3FPLA 2OP0A 3F1KA 3QSGA 3E5RA 5IDWA 1Z45A 3OQBA 2QHXA 4ZQFA 2E48A 3PIIA 1LX6A 5KKAA 2OBYA 3WGZA 1PL6A 1BXKA 4Q39A 3VC7A 5A9RA 5JS6A 3QLJA 4MKXA 4RQUA 3EGOA 5G0UA 3SVTA 4XR9A 5F3RA 3PQFA 2FN7A 4HWKA 3ROKA 1LDBA 3NT4A 1X7HA 1YB1A 3M2TA 2W4QA 3GUCA 2AE1A 3H9JA 5JMPA 3U4CA 3NJ4A 4WNCA 4WKGA 4OAQA 1PQWA 2AQIA 2Q46A 2UYYA 4O59O 1PJCA 3K5PA 1HDRA 2QX7A 3GGOA 5COAA 3E1KA 4BNNA 3WLEA 4MOWA 3TOXA 3LLVA 3PK0A 4K9DA 1DXYA 1B3RA 1KEWA 1ZUD1 1BVRA 3HADA 2GGSA 1AXEA 4YTEA 3RC7A 1ZBQA 3ZW8A 3IC5A 1NQ5A 4FJ2A 3TQHA 4GBJA 1NQTA 2GZ2A 1XU9A 3U4HA 5U4QA 4R51A 3AY7A 1NWCA 3UFXA 3PVZA 2EF1A 4ESOA 1XR3A 3K31A 2E49A 5JAZA 3VVBA 3KOUA 1MP0A 3JQ7A 4TZKA 2O7QA 4Y9DA 3RUCA 1XDWA 4RVDA 3HDYA 4UUOA 4TROA 1K6XA 5EL0A 2FRDA 3HB5X 3T7EA 4BNXA 1ZK3A 4JGBA 1YOVA 2LDBA 3ZWWA 3HHPA 2IEBA 1UJMA 1ZSYA 4WOKA 3TNLA 5FI5A 3V2HA 1KY4A 1OFGA 2GN6A 2QRJA 3JD4A 4FW8A 1ZMTA 4O5OA 3O8QA 4UVIA 1B0AA 5EESA 2WE7A 2J3HA 4LCJA 1GYPA 1LQUA 3WYEA 1O94A 4HBGA 3ZWPA 4QQRA 3INGA 1YB4A 2ZJ0A 4BS9A 1B8UA 4RF5A 3GY0A 2VT3A 3IP3A 4RPLA 3JQBA 4JJGA 3RKUA 3K9QO 3NUGA 1B8VA 2HRBA 2CDBA 3GDGA 4UVEA 3ZHZA 5KTKA 1EMDA 1HRDA 3AFNA 4FN4A 2C20A 2EERA 1LDEA 4PLYA 5FI3A 1N9GB 1R12A 4O0LA 4Z0HO 4XGIA 3N74A 3R0IA 4ITUA 2ZTUA 3WBBA 3RQSA 1Y8RA 4QO7A 4KP7A 4IQ8A 3B70A 3MWEB 5DF1A 2AQKA 2GR9A 1YS4A 3AUSA 4G81A 5DCYA 3RBXA 4BMNA 4J4BA 1TEHA 1QXSA 1Y8QA 4M86A 4BNYA 5I9LA 1Q0QA 5ENVA 3KYDA 1DIAA 3RI3A 4D79A 2Y67A 4MJLA 4XDYA 1CF2O 4GI2A 1C1DB 2FPIA 2ZB4A 1I2BA 3WSWA 3DBRB 1BXZA 1W6UA 4BO0A 4KTVE 1Z6ZA 1DRVA 5L3ZA 3FRJA 3WGIA 1HETA 2ZQYA 3A4VA 3L4SO 3EUWA 1EVIA 3AI1A 3JYNA 5JCXA 2GDZA 2HSDA 4NZ9A 3JYOA 1I3LA 3HFSA 2D5CA 4CLRA 1HXHA 1DRWA 3PHIA 2CVOA 1GYRA 4O63O 3JSAA 4C7KA 3IUPA 3ZHYA 1VC2A 2WYVA 3D4NA 3I5MA 2O3RA 2WWRA 3WDSA 3PFWO 1TI7A 3WGYA 3VHRA 3LC1O 5BNTA 3LT0A 4OSPA 4PN3A 1MXFA 4R01A 1V3VA 5CDYA 3S2FA 4RZHA 1XU7A 1VKOA 3QVOA 4DQXA 2DT5A 2I9PA 4OMUA 3ROQA 1YDEA 2OBNA 1GV0A 4BKUA 4QTZA 3HG7A 2YQ4A 4TKLA 3BAZA 5I8ZA 3VDQA 1EVYA 1LBEA 3F5QA 2HK9A 5EQDA 3PGXA 3WWZA 1XLTA 3PHJA 1LLUA 2DPHA 3WGHA 1A7AA 3ONEA 3BMOA 4IIVA 4OQZA 2GD1O 4IDCA 3RFVA 4BGVA 2BLLA 3AM3A 5L7YA 3COSA 3F1LA 4HX5A 4RGBA 2RH8A 4Z0TA 3RAJA 4Z9FA 1OZAA 3ZU2A 3PDUA 3GNSA 3IUSA 1LSSA 3QVWA 5DP2A 3GEDA 4A27A 4B4UA 1WLYA 3HDHA 4Z3KA 1DC5A 3E9MA 1P74A 3KYCB 4QX6A 5BT9A 4ND2A 1PJ2A 5C3MA 3I6QA 2VYND 3BTUA 4IXTA 4UUMA 4GMFA 4JP2A 1DIGA 1GZ4A 4KMSA 1B2LA 5KJ6A 1KS9A 1U9JA 1AHIA 3GC6A 2Q1UA 4YACA 5JAIA 1GADO 4XB1A 3LU1A 3ZH2A 5T57A 1F8FA 3UCXA 1ZSNA 1N8KA 3FNFA 4MO2A 2X9NA 1GYQA 2WTBA 5G0TA 5KJEA 1YJ8A 3ZV4A 4DPLA 3WMXA 3H5AA 4BO6A 1P44A 3QVTA 1I2CA 3PJEA 2D5AA 4J4HA 4CQMB 5JC1A 1EFKA 1T2CA 3KB6A 4QXMA 4XD2A 2E6UX 3OJOA 1NQOA 3GEGA 4PG7A 5CAEA 1JU9A 3KXDA 1I2ZA 2EG9A 2WEKA 2JL1A 1H6BA 2QRLA 3A14A 4ALKA 3Q0EA 4FFRA 1A9YA 3VH1A 2YHUA 1Y7TA 2C5EA 5G4LA 2I65A 3ONDA 1DIRA 4BV9A 2DBZA 4OKIA 4E5NA 1ADFA 4QFDA 1EK6A 5MGBA 2I3GA 1VSUA 3NGLA 4J0EA 4YJHA 4WECA 3X2EA 4ZICA 2FR0A 2VUUA 4XIJA 2IDZA 5AXDA 4IJKA 1P1IA 1T2AA 4N5MA 4CMBA 4MP6A 4CLXA 3LVFO 5LDHA 4GX5A 2A4KA 2PGLA 2Z5LA 4I8XA 3RUFA 3W6UA 4J4TA 5CDGA 1Y81A 1M2WA 2B37A 4DA9A 4YCAA 4MP8A 1LSJA 1ENPA 1HF3A 3BMNA 1YE3A 3WSVA 1UZMA 1E5QA 5C37A 3DAGA 1HE2A 2J8ZA 3LSYA 1YXMA 1CDOA 3LT2A 4ONEA 4BUCA 3F4LA 2PKQO 3RASA 1MC4A 3H3FA 3RFTA 2HDHA 3WTCA 4Q3EA 4AJ4A 4CMIB 3CH6A 1YONA 4TWRA 3AM4A 2Q4BA 2OMEA 1C0LA 1EDZA 3OFSA 4IZIA 2GN4A 2DKNA 3BHJA 1JWBB 4FR5A 1L7EA 1PJQA 1HZZA 9LDBA 1DC3A 3OQ6A 4KQWA 4NBWA 4TSKA 2YV3A 5C7LO 2HKIA 2EHDA 1P1KA 1DOHA 2X8LA 3A06A 3UGKA 4QECA 3TPCA 1X7GA 1R0SA 9LDTA 1UH5A 4ALJA 4DMLA 2CMDA 1J49A 4LRTB 1G0NA 4YAEA 5EQFA 1E6WA 1E7MA 1S6YA 4PFJA 1IZ9A 1ISJA 1NPTO 4I9UA 2PR2A 1HDCA 4J7UA 2GF2A 1CYDA 1DC6A 1PTJA 3D3WA 3L4BC 3OM9A 4CM6A 2B5VA 2B83A 3QWAA 1BRMA 4J1SA 4WGGA 3TFOA 1LU9A 3KEOA 4LMPA 4XGKA 5EJ2A 4J0FA 3VOSA 5I9MA 1KVQA 1XELA 4RJTA 5FWNA 3NKLA 3AW9A 3H4VA 1A4UA 3AI2A 3LZ6A 1I24A 2QYSA 1U3WA 4CMKA 4IJWA 4XQGA 2WSBA 8LDHA 4KTTE 1NTOA 3GRPA 3ZW9A 3R6DA 4IS3A 5K6AA 5TT1A 4MIOA 4NK5A 4CUKA 3RVDA 1BW9A 1SCUA 2BF7A 5F5NA 3KSZO 3C85A 4W99A 5T67A 1R4MB 1LLDA 3FN4A 4ZRNA 2HMVA 1YKFA 4OL9A 5IJZA 1LC3A 4PLZA 4W4TA 4MP3A 3PWKA 4R1NA 4BNVA 1ZKMA 3LLSA 1BDMA 3ST7A 3WJAA 1T25A 4GVLA 5IDXA 4DIFA 1H9AA 2V6GA 4ALNA 1Q1NA 4RPKA 2BFOA 4NQZA 1E1KA 3OJFA 4YVFA 3CZMA 4XYBA 1HYEA 1NHWA 1I8TA 1WAMA 3AY6A 3DHEA 1ADBA 4UULA 4YPOA 3GAFA 3HJAA 2DPGA 1X0XA 2RBEA 2SCUA 3ROPA 4NJMA 4IMPA 4B3IA 3UOGA 3H7AA 1NX6A 2X5OA 2FWMX 4IJVA 1TT5B 4PZEA 3G1UA 4QEDA 3ZWNA 4IINA 4N5NA 4KDFA 4DVJA 4DTIA 5AXCA 3OIGA 5CP8A 2FHSA 1I10A 3E03A 1JN0A 2HJRA 4GLLA 3BTVA 4U0KA 1UAGA 3R3SA 4B7XA 3DTTA 3FBTA 4O1MA 3LF1A 4CLOB 2Y99A 3K6JA 4CLHA 3B20A 2PD6A 4BNKA 3PDJA 5FF9A 1E3WA 1WP4A 1OBFO 5DP1A 3VDRA 3DDNA 5JDIC 1ZSVA 1FMCA 1KEUA 4ZQEA 1I32A 3H2SA 5IFLA 3SJ7A 2P68A 1V9LA 4HP8A 3CKYA 5ITVA 2DM6A 3O38A 1LRJA 3ETEA 4AJHA 4PG4A 4B4VA 2B4QA 4F3YA 4LSWA 2JAHA 1ISHA 3WYCA 1MXHA 1DB3A 1KYQA 3INRA 4AJLA 2IXAA 1ADGA 1NVGA 3CINA 4DQUA 1SMKA 4RLSA 2P4QA 4WNIA 3C7DB 1YVEI 4N7RA 1PWZA 1EZ4A 4NG5A 5L4NA 1HKUA 1P45A 2W2LD 4FPXA 4XYEA 3AOEA 3SX2A 1UXGA 1IPEA 3QWHA 4BKQA 1RPNA 4YT2A 1XWFA 3L6DA 1BGVA 1C1XB 1P1RA 2AG8A 1HYHA 1GV1A 2VRCD 4M89A 1DC4A 3MZ0A 1LRKA 3RUHA 4E5PA 5DOVA 5I7EA 2GZ3A 2FR1A 3JQ8B 2EKPA 2XXBA 1WDLA 4JLWA 4NK4A 4OGWA 3EZLA 1LC0A 4H16A 4XB2A 5KVCA 5ICMA 1IUKA 2F00A 1MC5A 2J3IA 4JJIA 2VHXA 5TX7A 1YL5A 4I08A 4RVGA 3SBOA 4M1QA 4BMSA 4LW8A 2VQ3A 3GNQA 1D4FA 5CDUA 2X1HA 3QV1A 5H81A 5L45A 2PV7A 3VPFA 2HRZA 4MDHA 3NV9A 1I30A 2D1YA 2P9GA 3DBRA 3EDMA 3DMTA 3GGGA 3KBOA 2UUPA 3AUAA 3HQ4O 4CMEA 3F9IA 4BO7A 1XQ6A 1T24A 5HM8A 4M55A 1LLQA 2HK8A 3WLFA 1P9LA 1GUYA 4KWHA 1DEHA 4Y8VA 3JQAB 4I5FA 2ET6A 4MVJP 4RPJA 1M66A 2YDXA 4A26A 4IXWA 4NU5A 1FDTA 1BXGB 3OSUA 3W8EA 3ZN2A 4B7CA 4W6ZA 2DUWA 4M87A 2HAEA 2JHGA 1QYCA 2CDCA 3JYLA 1DSSG 3MJCA 3RSHA 4BB5A 3JQ9A 2B69A 2DTDA 4FIZA 5G4KA 3PRJA 4J49A 1YO6A 1VKNA 3DHYA 5DN9A 2NVUB 5HA5A 2Q1SA 2PD4A 1PQPA 1LNQA 5L53A 4P8RA 4S3MA 4YBZA 2G82A 1R0KA 4M49A 5JC8A 4LSMA 2TMGA 1WXDA 4N18A 3VPSA 5CEEA 2VZ9A 4DQVA 1E7RA 2G1UA 3RFXA 4PZDA 5L7TA 3DZIA 5KVQA 1QYVA 4BNMA 4P4LA 3DB2A 2P5UA 3HN2A 5DOZA 1MG0A 2AEMA 3C7CB 2D0IA 1D3AA 1PJ4A 1C0KA 1O9BA 3FHLA 3OIFA 3UXYA 1X1TA 1W8DA 5IZCA 1AUPA 3I3OA 4R16A 2FY8A 3ETDA 4YQZA 1JDJA 3PGJA 2GCGA 1DLIA 4QUKA 2JCXA 1W73A 1SOVA 4MPDA 4FB5A 2GNAA 1YQGA 3B1FA 1K6JA 4ZQHA 1I36A 1M6HA 3JQGB 3RC9A 4E33A 3F6YA 5A02A 4P22A 3C8MA 1Z75A 2ILTA 3EMKA 1YRLA 4DGSA 1RM5A 5TC4A 1C3VA 4PLWA 1SEPA 1E3IA 3VTFA 4CQMA 4QFCA 2QYTA 1NVMB 4ZJUA 2GSDA 4UEKA 5LCXA 4BGEA 3FD8A 5THKA 2V65A 4TVOA 4PLTA 4XX0A 3FNGA 4GKBA 3ZHXA 4YQYA 4EEZA 4DLLA 2H1SA 3V2GA 2HCTA 3ZNPA 2IODA 5LDGA 3RUAA 4Y67A 2ZCUA 2VYVD 4MVJA 1NFFA 1UUFA 1EVJA 1WDMA 1OC2A 1ZJYA 4DRYA 4IY1A 4MKRA 2Y93A 3DBLB 4XQCA 4RDHA 3QWFA 3PXXA 1YGYA 3D5QA 1N5DA 4JROA 1DPGA 3R3JA 1BWSA 4CMHA 3U09A 3ZZNA 1T26A 1WNTA 4CMCA 2PY6A 4E3ZA 3GDOA 4PLGA 5I9NA 3JV7A 1A72A 3MCVA 4CM4B 3TL3A 3OF2A 1EUDA 1YQDA 2YHIA 4BNWA 3D3EA 4IDFA 2HK7A 3CE6A 3NT5A 3ZNOA 5L95A 2I5PO 4HXYA 1X13A 1UDAA 2V6FA 4I9NA 2Y1CA 4L9RA 4PLFA 4GGPA 4CUJA 1FDUA 4E2ZA 1CQIA 4NFHA 1SPXA 1P0CA 1XYGA 2FPPA 3JYPA 2QZ9A 3S55A 2ZB7A 1T4BA 1PR3A 2I99A 4H3VA 1MA0A 1U28A 1DAOA 3BMCB 3WICA 1MV8A 2XAAA 3FBGA 3ZNQA 4EGFA 1MX3A 4GLOA 1NQAO 1NBOA 2CFCA 3RC2A 1PWXA 4E0BA 3AM5A 3IDSA 4ALMA 1PR9A 5DDIP 3WGQA 5DBIA 2P5YA 5A9TA 4R1TA 2EP7A
chains in the Genus database with same CATH superfamily
4NH0A 4YMIA 1GL3A 2J5QA 4KXYA 3QHAA 5KNCH 1P0FA 1T3HA 2C99A 3WRYC 2IZ1A 4US2R 2Z5VA 5HE8A 2BBWA 4L4ZA 3THXA 1N5MA 1WCXA 1UCFA 4X3OA 4EJMA 5GP1A 4XQ9A 3P0IA 4FSDA 3RSGA 4E14A 3JPWA 2A9VA 4LWQA 3VDMA 4HO1X 4GP9A 4AO6A 3X2FA 4CMGA 2HLHA 3G17A 4ICIA 4IIGA 4LJ8A 3WL4A 5LXTA 4ZAFA 5I8WA 2CSXA 4R6XA 3KQLA 1V8DA 1NT4A 2NO7A 3QUTA 3C6YA 1A77A 2PNFA 1SVMA 1U8CB 1NOKA 1BG6A 3F74A 2OXCA 3L77A 4M83A 1OH5A 1SN7A 1JRLA 1P80A 2G6BA 1YAJA 2WZBA 2HU7A 2XCQA 2ZTSA 5JAHA 4XEUA 4EG8A 4TSRA 3DULA 3A9SA 3IE0A 2V7WA 3QQPA 3WHLA 2MYUA 1U1DA 1P31A 2YDYA 1KAOA 4ZO6A 4DDWA 1IHUA 2XAUA 3RFUA 2RK3A 1UDWA 4NLLA 5EIOA 5C2JB 4BJ1A 2JLZA 2NTYC 2D06A 4KAFA 1ZLYA 1S9HA 2DFDA 2GHRA 2VL7A 2ZUTA 5KX5A 3D6UA 1UJBA 5L7WA 3RUFA 3VDNB 2XD9A 3OOSA 2YJ4A 1R5NA 4QUIA 3A9CA 4JBYA 4LG1A 1DG3A 2JLUA 3UK6A 1KMHA 1P1CA 4UVGA 1OGJA 2I3BA 1ODSA 4OMFG 3V3TA 2X22A 1NQUA 3IQIX 4HFMA 1CJSA 4EATA 2V3CC 3LE8A 3F6PA 3B52X 4CCAA 3SVZA 3AJAA 3AHHA 3TL2A 4DUPA 2XOKA 5I4BA 2ZI5A 3O4VA 4ZO9A 1PG5A 1DFHA 3KHSA 3U4DA 2WHYA 3ABSB 4N5HX 3VNQA 3ZV6A 3DFMA 1M1ZA 3MSXA 4YCCA 1K8XB 2AA3A 1ZCFA 3KEQA 4ZOAA 4LV8B 1T4CB 4EG0A 2DPLA 3BT7A 1ZN7A 2CLKB 3PEWA 5IAOA 1EGAA 4CEHB 4PQYA 3G2HA 4L6AA 1XP5A 3EXHA 2C9OA 5K20A 2VXBA 1G5QA 4A6EA 1HNWB 1NJ2A 4OJKA 3D64A 2Q3DA 1KC1A 3L1IA 2CXOA 4XCXA 4BMYA 1YASA 4ER5A 5CT9A 3MQFA 3RYTC 2EJVA 4J9UE 4BIMA 4IVQA 2HU5A 1GCOA 3FKQA 4PCVA 1IM2A 5EWLA 2P5SA 2GAJA 2QSJA 2DR2A 2IE8A 1VFPA 3H9EO 4CM7A 2HL6A 4JJFA 4W9NC 3W6NA 4B6QA 1XLVA 4ZT3A 5L3SB 1QO7A 5A7GA 3WNDA 2YX1A 2Z0MA 4C87A 4AX4A 1Y37A 5A0FA 1HSZA 2M98A 1VKZA 1CEEA 4XR4A 1G3IA 5E7JA 1MLDA 3GDWA 5B7NA 3C3MA 5F7OA 3QI2A 3R1IA 2Y1LA 4FW9A 5FTLA 3GLFB 1ZVVA 2OKCA 5F76A 5D01A 5KVVA 1DTWA 4D82A 2J45A 1IG3A 3NCHA 4BRUA 1G6HA 3X43A 5AKEA 2VATA 1EIZA 5TR9A 1X94A 3RJMA 2B3TA 1IXSB 2JDID 4AZ0B 3RO7A 4L73A 2XKBA 3CEJA 1QFSA 2GWRA 1N1MA 3QEMA 3LOPA 1H2WA 2IPMA 4HFJA 4MQMA 3FG9A 4RENA 5AKHA 3RUIA 3T9CA 4BIIA 5H59A 5JJ5A 1X7YA 3A0UA 3C1OA 2IY7A 2NT3A 2XVMA 3OIDA 5MHTA 1C3XA 2PS9A 1SCDA 3LKBA 4X5OA 4PWYA 3PPVA 1Z5GA 5E2IA 2SECE 3T8YA 3LHKA 4YUXA 3TLGA 2FX2A 3K94A 4ZAWA 1A9RA 4INZA 2R4TA 3CSSA 5ELXA 2F9FA 2ZSUA 4J1QA 1VQ1A 3Q1KA 4NENB 3BE4A 4QO8A 1MF7A 1E0SA 4Q4HA 4R05A 5B3JA 4EFKA 2RGEA 3ZZ1A 1RM4A 2OECA 3EGVA 3R0VA 4GLFA 4PG5A 4R8MA 4TL7A 3ITKA 1PW7A 1FTYA 2MSWA 3KLMX 5TLSA 2DJ5A 2C4MA 4RTNA 4R68A 2J33A 1EG7A 1R0ZA 1M0SA 3KZNA 3G59A 4ERNA 5LQMA 4HGPA 3QOXA 2GO1A 2QTAA 1GL9B 3P4UA 3ROMA 1IAQA 1V11A 3JQRA 2YOGA 1TC1A 4PO1A 4BKPA 5C4IA 1R4NA 3L7OA 4AWXA 4RC9A 2ZT7A 3NHWA 1KSFX 4Q66C 5BURA 4EFNA 5JASA 1KZ9A 1J8QA 5ALNA 1D1TA 2X2OA 2AWOA 4Y0NA 4HUTA 1IBKB 3IERA 1N2EA 1E1MA 3KYIB 2A84A 3AHDA 1Q44A 3KK0A 3BZUA 4UQOA 3V7UA 1DIHA 5KDOA 3NC1C 2C3UA 3NTOA 4UHCA 3O4JA 2VDPB 4PFQA 2K2QB 4HNHA 2CV1A 2NLOA 2EFYA 3EAGA 1N2SA 1PZEA 2W2KB 3FOCA 4K1XA 1JSCA 4TRRA 4Y6QA 1IYZA 4J0JA 1L7MA 4S2EA 1BMDA 4ROSA 3IR6A 1WSBA 3ABZA 2ZI4A 3HFRA 2J85A 2WIJA 4YROA 3RF6A 5ICCA 4FOLA 3L7NA 1UQUA 2G5CA 4LOAA 1OXXK 4MMYB 1E4YA 4PM4A 4RV4A 1U2RA 4PC1A 4IV5A 3NATA 4H6PA 4RXMA 4R1QA 3TMAA 4DUGD 4F06A 2CLFB 4H4DA 3EVGA 3K6SA 3R7SA 4AQ7A 3PQ2A 3R0ZA 1IRIA 3M6VA 4KR2A 3BL8A 2DEUA 5COBA 3BWBA 3GIDA 3AF1A 4BUJA 3LY5A 1N32B 4BU0A 1FE8A 2O48X 3R40A 3C6KA 1NL3A 1Z8DA 3H4TA 1BRTA 3KR1A 2QTTA 1N2CB 3I0NA 4GZMA 3BMQB 1JPNA 2UZ1A 4MV4A 1HPLA 4OCZA 3ZTTA 3NRJA 3ORSA 4PNZA 1PV4A 3ZTWA 2Q0QA 4KQ1A 4DLNA 2AGVA 3GLQA 4NFLA 4JXZA 2RHLA 3CKMA 1YK1A 2HJVA 4RIHA 4HV4A 3B3QA 3LYHA 2ZATA 4BMXA 2QE7D 5TGDA 1DMRA 3DZJA 5HG0A 3C1TA 3GJRA 2F1KA 1BCSA 1YS6A 3CLSC 2FSGA 2VSXA 1E2DA 3HVHA 3RIXA 3IKLA 5HKKD 3U44A 5JU6A 3MYYA 1A7KA 4NZMA 3HP7A 3MWYW 4F6LA 2EXXA 4YRNA 2IW1A 1GG9A 2A9OA 4DVGA 2Q2VA 5A9SB 1Z4OA 1U0EA 1V95A 3DEKA 3DD5A 3M1IA 4UOQA 3KETA 3ZHOA 3WGGA 2IYOA 4UDNA 2C2WA 5DO9A 4PSAA 3BXEA 1BXRA 3MJHA 4IXDA 2J3JA 2ZRHA 1BDHA 4D44A 1CWUA 3AETB 2A30A 3EUAA 1FPMA 2FQWA 3L8GA 1Z7EA 5JSUA 4BPRA 4UE2A 3AV0B 1XKTA 3TNJA 3U16A 1MTOA 2JZCA 3AXTA 1KYTA 4QEKA 5A4AA 3GGSA 4B6SA 2F1JA 5IVKA 1Q0RA 2VA8A 4EG4A 2XUOA 3FETA 3IS3A 1GU1A 5L40A 4DIOA 4MGZR 4O2AB 1OGIA 4PCAA 2Q5QA 4Q7EA 2YUTA 1DHTA 1GG5A 4N03A 2AJ8A 2OFFA 1P18A 2PL9A 2R7KA 4JX9A 4E4YA 5CNKA 5E6SB 3GO4A 1UBCA 5EERA 3CLUD 1B15A 1V6CA 1TF5A 1CR2A 1Q0PA 1RAIA 1RI2A 2VZEA 1HG1A 3BJEA 4FQ8A 4PV7A 4G8DA 4IJUA 3RRFA 4I50B 4BQEA 5JJCA 2NSLA 4FWIB 2Y1DA 2AVDA 2ACEA 1P0IA 4DCJA 1DO8A 4QYIB 4DLVA 1RKXA 3VKVA 1N3YA 2BMWA 2J7PA 2OCKA 5HCUA 3R7WB 3T61A 3GAAA 3B3AA 3DB1A 3IQXA 4QXPA 3TSWA 5AJXA 4CJXA 4R0MA 5BV7A 3OIYA 2D1RA 3QX8A 5T3UA 4C7OB 2HGSA 5D7NA 3K30A 5KB3A 2ZRLA 3AGPA 3Q1LA 4EY8A 2PBZA 4F5EA 5JANA 2J6HA 3DWGA 4LJSA 4QYTA 4MVJM 1KJ9A 5BSRA 3VTKA 1YGPA 4CKEA 1U3GA 2BT4A 2WLSA 3K0KA 2WNHA 3GLHB 4JJ7A 2ZSKA 2NYAA 4YMHA 3DOFA 1P5HA 1PTKA 2C82A 2YR0A 2ZOSA 3INTA 5EIBD 1YCDA 4MS4B 1GAWA 1Y3HA 4IIYA 4D0NA 1CY6A 2AZXA 4J1TA 2OP1A 4C5CA 1YACA 1C50A 3HXTA 1Q17A 2MT9A 3P0EA 3WLSA 4PIMA 4ZREA 1KETA 5TS3A 1T8RA 3DPSA 1VA4A 1V2GA 4ER7A 2XUFA 3CN7A 3OEWA 3K6RA 1TQDA 3O8LA 4XXHA 1EDEA 1G5IA 2QD3A 4ZXFA 1KSJA 4JNKA 3HRIA 3RJ5A 1Q7BA 2X0RA 3LYUA 4IH4A 4FMDF 3RBVA 3NJRA 3SEFA 1MZPA 1M75A 4MWTA 3W1VA 4LQDA 3VR1A 2A0KA 4R4JA 1JP7A 1W36D 2GESA 3QWIA 5EVJA 1JJ7A 4OY3A 5CNMA 3WB1A 5EJAA 4CQNA 1XDGA 3G8CA 5F3DA 3IKMB 4X6LA 3D02A 1X8KA 5AQEA 1T3LA 3DWIA 4HEHA 1IMOA 4W1SA 1S2MA 4WBNB 3KLPX 2CLMB 4PLCA 1KAMA 1ZC3A 4V2UA 4EMUA 4WK2B 3K8YA 3KS9A 1ULHA 3WK5A 3ILHA 3ODPA 1QE0A 3TM4A 1A0OA 1VIAA 1HZJA 2CJWB 1U94A 3C6QA 3IAHA 4MUNA 4X00A 5A71A 5TPWA 3RK1A 1CG6A 3VTAA 4DY6A 6YASA 5CCXA 1OD6A 2I62A 3BMCA 3FCXA 3B1ZA 3OHSX 3SJUA 4KFRA 3CCFA 3FPFA 9MHTA 3ORQA 3C7AA 3QVVA 1RLIA 1HMPA 4PX2A 4HEA6 5EKXA 4A6PA 4H3HB 1MAVA 4RQTA 2WABA 1MJHA 1QIFA 3AT1A 2GPWA 3KVOA 2BFBA 4JJAA 1EX7A 2AUTA 1SIWA 3A36A 821PA 1RZ3A 4JR2A 2PGJA 2QB5A 2CK3D 2NO9A 1Z0ZA 3N3BC 4C0LA 1XU4A 1ZM3A 1U8YA 3I9V6 2IU6A 2A5DA 1HQKA 4CI0B 4AY2A 2WG2A 4PZCA 4QJIA 2AR7A 3Q5EA 2UXDB 1EHCA 3LM8A 4OHWA 4HR7A 4BQFA 1W5FA 4DEXA 5JCPA 3NW9A 1RWQA 2IPXA 2WIAA 2WHPB 4NZYA 1M1NB 1LFDB 3T7RA 1WJGA 2DC1A 4WQMA 3GOQA 1YBAA 4R2HA 1FMLA 1V5FA 5FNVF 3UC9A 2JJYA 3QIVA 3UJHA 1Z5PA 1JVSA 5EE0A 4DIDA 3WBKA 1QH9A 4KQFA 1BHSA 5IH7A 3LLMA 4F86A 4F8EA 3KYDB 1XVTA 1SNYA 3DJFA 1IULA 4OHPA 1AE1A 1NM5C 3R7LA 3G02A 2DTXA 4PQFA 3NWBA 1AX9A 2QJFA 4LFAB 1QGUA 5F12A 3ZKWB 4PRLA 2CNBA 4TV9F 1IJKA 3AUUA 3ZY3A 3THYB 1VI5A 1MO2A 2J07A 3A2MA 4CG0A 3OOYA 2WJWA 3BAFA 4E30A 3WKBA 4UTVA 13PKA 1X77A 4IDHA 5IBPA 1LVGA 1OF1A 4Q1FA 3S7TA 3KYBA 4DDTA 1UODA 1KEZA 1P2GA 2O2YA 3FNQA 4AK9A 4CLRB 4H3KB 2IXBA 1XJWA 3ZDFA 4B6EA 3RGGA 3W5AA 4I8IA 4D25A 3PC8C 4NU8X 2JEYA 2C5BA 5A3RA 4HLUC 5CJPA 1OC4A 4OQMA 3EB9A 1MORA 4EVSA 2JGFA 2C7RA 2IGBA 4G85A 5CHYA 3FPBA 4AP9A 5ICFA 1T43A 4QE3A 4K40A 5C8VA 4PIVA 1MFPA 1N9GA 3L1KA 1Z4KA 1QGED 3NS7A 5BQFA 4UTOA 4D41A 3RRXA 4MCAA 3V8VA 4EZBA 1S7GA 5SZKB 2PYIA 2PPLA 4NICA 4PG6A 4ZHQF 4NDZA 4RH0A 2VJQA 4QU0A 5IAAA 2J48A 1RPTA 4L6IA 1JLRA 1X0VA 2C5HA 3IYLW 2J9ZB 3MINB 1VYHA 3I61A 1RLTA 1IFXA 2BFCB 2E4ZA 2X0IA 3FPAA 3KXLA 1C7JA 3OCYA 4QYMA 4F9EA 1OW3B 1BNCA 4WCFC 1KAGA 1Z34A 1W49A 3OPVA 4J76A 3A9WA 4JJKA 3TJZA 3BMOB 3LL7A 4A16A 3KZCA 1QCZA 4Z9AA 1C1DA 1LTKA 5HQJA 3MELA 2ZEJA 4HWRA 4CL3A 2E4WA 3DAPA 5DI3B 3M6MD 4AT1A 4PGHA 4EI7A 2ZRCA 4M0MA 4HRAA 4G5FA 4ZMRA 1Y6GA 1Z16A 1TKRA 1QQBA 2O8DA 2X0FA 2W2VA 2XWJI 3ENWA 3UY4A 2B4RO 5JCOC 5BMVB 3UUGA 2JGEA 4AJ1A 2Y1FA 4UZSA 3UH1A 4BVFA 3OHPA 4KLRA 2B7CA 4L95C 4PSUA 4XLTA 5DLDA 3T9DA 5FDFA 3PR3A 3UHJA 1PJSA 2H4HA 3ZR4B 4DSOA 4U2FA 1VI6A 3FKSA 4UD2A 1ZJ6A 1PV2A 1KARA 1GNTA 2AIRA 4H6WA 4LVCA 3TNYA 4YEDA 5JYDA 2XNCA 1JEYA 4O4LA 2R60A 1LCIA 1X74A 4GMXA 3JRNA 1EXNA 5EIEA 2X41A 5SYNA 4N3BA 4QHTA 1KRWA 4YXFA 5K8VA 4M9UA 1TKBA 3O92A 3FPCA 2ODPA 4FBLA 3LX5A 5CUQA 5HYVA 4PFSA 2QL9A 2IOFA 1PK7A 2AFHE 5CVVA 3E3LA 2C77A 2YINC 4H7IA 4FFBA 4E4TA 2ATEA 3SZUA 3EMBA 3H84A 3C15C 3M6WA 3D4OA 2OO7A 3CZQA 4KGXA 4ANFA 3RBAA 1Z15A 4YRDA 4N6GA 4M7RA 3RANA 2QL5A 4E22A 1G1MA 5B57C 5LIPA 3V7FA 1AQJA 2J67A 1RJ9B 3BB1A 5KX5F 4LF6B 1FJ2A 4HVCA 4EPRA 1AUXA 1E6MA 2XNDD 5DSZA 4GEGA 4R2MA 4TTSA 2DYKA 5FPQA 4EF6A 3VV3A 4DWOA 2BEVB 1WA5A 5JE8A 2HTFA 4P3XA 1J1ZA 3BICA 4ARAA 2TYSB 3BCUA 4EDFA 3QLVC 3JARA 2VHZA 5GM2A 4UFPA 2VPXA 3GPIA 1OT5A 1FRNA 3U5ZB 3MGGA 4FONA 2QMYA 4LXUA 4JGGA 2ZYHA 1EVKA 1CUZA 2AYZA 2DBVO 3JQBC 3BFVA 4BB6A 1W35A 3MGBA 3H5IA 3MPUA 5DIFA 3NOOA 4X7PA 3T3EA 1QWSA 3EF3A 1MW8X 3BMNB 5LZ8A 2JJ8A 2AFHB 2Q50A 1SZPA 2OFXA 1TJYA 2GJ9A 2XYRA 4JYBA 5CCBA 1ODTC 5IM5A 4C6TB 4FFLA 3TM5A 3QE4A 1JLLA 2IUSA 3OZRA 1FX0A 1V25A 3EXG1 3CT6A 4F5DA 1XTIA 3M8KA 3MSCA 4R41A 3IPCA 4HMOA 3OCWA 3RYHA 1E66A 1PP4A 3UAZA 1E3EA 4Q7KA 2WUFA 5LA6A 1N78A 1IY2A 4HYYA 1QTRA 2CVQA 1E61A 2ZB8A 2JLWA 4DS3A 1E3TA 5KYUB 1NP3A 3ENKA 1NUTA 2EP5A 1M1YE 2P4HX 4L4XA 3WLIA 4PYJA 2QVCA 3ICPA 1ZQ9A 4WZBE 2HO5A 4RGVA 4GZLA 1WCIA 3C5WP 3Q98A 2GCPA 2X4IA 1ULTA 2BTEA 1LPSA 2JBAA 2VDRB 1XWIA 3ZWBA 3KJZA 3N6XA 4KVGA 4M0CA 2B9VA 4Q01A 3FI0A 4RA6B 3U5TA 2P2LA 3H9QA 3OHMA 4EPYA 3ZLUA 3GVPA 4FBMA 4MWBA 1OWMA 1G8GA 4BVJA 4ZMBA 4LF5B 2ECFA 2WFZA 1JDZA 3M5CA 2X9GA 5C53B 3LQYA 4AD8A 4WGFA 5AKZA 4YJ2A 4LBZA 1E96A 3WGLA 1JEQA 3CH5A 3TE7A 4BY9E 5K03A 2NPFA 2WVJA 2QVZX 2X7HA 4Y2TA 1VPEA 3D3WB 2I71A 2R1VA 1NDUA 3F7TA 5TQ0A 3HK2A 2NACA 1ZEMA 4B3FX 3LPDA 1E2PA 3FTCA 4WTOA 2C2OA 1PGQA 2PTGA 2Q2NA 1OAAA 2Z9DA 1K86A 4PPNA 1EXMA 4Q6WA 5LXTF 3R6LA 3RRZA 1RCFA 3TW6A 4DR1B 2H1CA 1B3BA 2XUDA 2Q3CA 3QLUA 4RVHA 4DJJA 1WHTA 2UXCB 4C0SA 1D2AA 1JHRA 3DM9B 1YB6A 4D4IA 3LP6A 2P6OA 1K5DA 1SC6A 5BSEA 1C3JA 5DASA 4L4YA 1VHJA 2CNKA 5A1TA 4JR0A 2FEPA 1ZIDA 1BMFD 1CX9B 1P9RA 1XLTC 2X5XA 2HBQA 3LJKA 3O6VA 1TVMA 4J43A 2HPVA 4R98A 2JK1A 3RYFB 1OMOA 4DIUA 5ICSA 5BYBA 4CIYA 2O8CB 3OEYA 2WIDA 1PYGA 4G2NA 1L0BA 2JAOA 2YNMC 4I6EA 2R0QC 4B8WA 3HUTA 3T34A 5GY7A 2P9YA 1O94D 4CODB 4TYWA 1PLJA 4OBBA 3ZV5A 1IY8A 2J6CA 1KF0A 1HE4A 3KPYA 3PXEA 4PYMA 2O7VA 2JGDB 1GG8A 2OV3A 1GCUA 1L5YA 2I7VA 1N0VC 2JH9A 1G5HA 4C04A 3LQ2A 3IP1A 3U26A 4C05A 2VTKA 4DLBA 1JAXA 1HT0A 4JBIA 4L78A 3WTBA 3ZVKA 4W9RA 2VDOB 4PBRA 1X1RA 5FWAA 3FOZA 1IN8A 3TRKA 4IOJA 3MBIA 1M33A 1XQ1A 2AG0A 4DA4A 2PWPA 2QM0A 2YWCA 3FHOA 3M1AA 1A9XA 3OQMA 4LTDA 1D4OA 3GZNB 1E79A 3IXMA 1BVUA 1PL7A 1LXCA 2BFEA 3CXRA 3U7QB 5CG1A 2VWHA 4XUDA 2PZFA 2YFHA 3WLKX 3D8RA 4LVOA 5CLIA 2FNAA 2FUKA 1N36B 3IO5A 3HMKA 1G7CA 2AC4A 4P86A 4PR3A 1JECA 3JYQA 1D6SA 3TR5A 1YR6A 2ZYGA 1YR7A 2DWOA 4FFVA 1NUHA 1XUOA 3BDIA 3FF1A 3IP7A 1UMDB 4JT4A 1M34E 1EEHA 3SSNA 3NWOA 3VZDA 1AN9A 2X9LA 1IBLB 1MAAA 4GVXA 1OXUA 4Z3DA 4EJ6A 3QKWA 1ESCA 1K97A 4GZ6A 4W5NA 2EKDA 3TDNA 1XG5A 5I9IA 1FW8A 1PT5A 2AE2A 2VDQB 2IHZA 1AS0A 1N2XA 1P1JA 2NQ8A 3ORFA 4W7IA 5TS2A 2WI8A 4DCPA 3NVKI 1DQPA 4HI0E 3BCSA 3DC2A 5F1OA 3O94A 2B1JA 3HZHA 3MS7A 1JNXX 3PDHA 4PZPA 5KNCD 1CY4A 4URXR 1H85A 2JD0A 3L0ZA 4CFSA 1Y9JA 4WESB 5J4YA 1BAPA 2H65A 2Q9BA 4NARA 5LZ5A 3O2JA 1W88A 4IOKA 3TGPA 1SD1A 2I2BA 3ZEAA 3HC7A 1IIRA 1U0HC 1ZL0A 3GQBB 1Z63A 1SCJA 2ZUWA 1BO6A 4CR6A 1L5ZA 4LYYA 1TJ3A 1ZDMA 4RD4A 2ZSHA 5TQVA 1XL0A 2D3TA 2PWYA 1GZUA 3QI7A 1ESZA 1XNHA 5ADHA 1WKCA 2YZGA 8ABPA 1ILEA 1FJHA 1A98A 1QC5A 6LDHA 4ZI7A 5CDHA 3O91A 4KYTA 3STHA 4U9HS 4NV0A 3WOHA 4W5QA 4BNGA 3RTAA 1L7DA 2HMUA 1F8UA 1REQA 1OVMA 2X40A 4FYXA 1FS4A 1M34B 1Q1AA 4M9XA 4A91A 1H5NA 2ZSBA 2JFNA 1W19A 3GJSA 3IDAA 4GHWA 4C2TA 3AILA 2HR1A 1EK0A 2XODA 1XOIA 4GMDA 2R65A 3I9V1 1L9KA 4EWLA 1JQ5A 2I8LA 4CLOA 2ZUUA 4GIBA 1KZ6A 2IE0A 2RHOA 4IUYA 3TW4A 4D3SA 5JECA 4KN6A 4BB9A 2JIMA 4Q1VA 1E2KA 4URWR 4MX8A 4A8TA 2IKSA 4CM9A 4CN9A 3C3PA 5E6RB 1TYEB 1VL6A 1X14A 5D8DA 1DS6A 3ANMA 5K8JB 3O26A 1GA6A 1L5HB 5FUQA 1SURA 3F7NA 4FZRA 1AB5A 3GRCA 3AU8A 3JD3A 4CHGA 4MQEB 4D4MA 1IQRA 1T0JB 4F4DA 4PGGA 1F1BA 1BU5A 5ERGB 5KNDA 3AHFA 1XK6A 2WTAA 1GTVA 2FN9A 2YV1A 3D7SA 2BGIA 1KMQA 1G8MA 2NSJA 2ZSDA 5D5QA 4F85A 4Y6SA 4NDNE 1FNNA 3DC7A 1SKUA 5HF8A 5L4LA 3LT4A 4YJ2B 2B21A 1VXRA 1ZGBA 1P77A 3MT9A 1KTVA 3QKSA 4GE3A 3PQDA 5K0LA 3RABA 4AM8A 5A4KA 2WWIA 3KDAA 2ZJZA 1D0IA 3PLAE 2W90A 2C0CA 3GMDA 3T5BA 1MNAA 2VHJA 4Y0VA 2YMMA 1QS0A 2C7VA 2A59A 3FLMA 5LBTA 2VHVA 4AROA 3QLTA 2A5LA 2BOVA 2V4UA 3ICOA 3QKRB 4FCCA 4FS8A 4O2LA 5KINB 4OP1A 3P97A 2P2SA 3C1AA 1HA3A 2VH5R 2J9YB 3T4EA 3C5VA 2PLRA 4YRCA 3VU9A 5REQB 3I05A 2G04A 5SZHB 2EGUA 2EFCB 3H42B 4CTJA 1QRDA 2WSMA 5IBQA 5AW6A 4G0UA 4C7MA 4G41A 4BTEA 3H99A 1FA9A 3LT1A 3V42A 4KIGA 2QTZA 3ZY4A 1L3IA 3JXEA 2ZYWX 1G20B 4MKFA 1K0UA 2GK3A 3GGDA 5A5EA 3NASA 4Q3OA 5ITWA 1Z4PX 1BQ4A 3CSUA 3K5WA 1QUEA 2D1SA 1F17A 5ALDA 5FQOA 1QIIA 3VUEA 2O1EA 1E0JA 2C4WA 5GV7A 1JF8A 1XBTA 1M8KA 2CJFA 1E2UA 4YJ3B 3OX2A 1TM5E 3EG9B 4G4GA 3PC3A 1JFLA 1XDSA 2HJ9A 4Q4AA 4ZCLA 3I8OA 1NLYA 3MTQA 1C3OB 1R2QA 4Q16A 1XNQB 1NNEA 5KTNA 1Z26A 1SVKA 2WJHA 3IT0A 1FSPA 4LHXA 2J0EA 2BSAA 3JTMA 2QQ0A 2OLJA 2QZJA 3C24A 3H6KA 3LBFA 3LW8A 1ZXLA 2AF3C 2C61A 1NKSA 3NWPA 3PVSA 3QIAA 4Y30A 1GQYA 3RREA 3V7NA 4EKDA 3CRW1 3F4BA 3PQ7A 3A27A 1GTJ1 4IF4A 3AQ4A 4UU7A 4F7WA 4RHTA 2YFQA 2BR5A 1AXRA 2OESA 1YFKA 2QUZA 5B5SA 4Z4HA 1W5EA 2RHRA 1T2NA 1BXGA 2FUCA 1LFAA 4JB8A 4LY0A 1ZD9A 4CIAA 1FTWA 2QP9X 3S3TA 1U3VA 3IHKA 4B7UA 3OX4A 1CP2A 1RLUA 5JH7A 1O95A 4BO2A 4H35A 1C8KA 1AKWA 4JXKA 4EYEA 1V7PC 5EXTA 4IDAA 3KSDO 1YJQA 1Z0UA 2QUJA 4AY3A 3MNFA 3GT0A 3NDBB 2XT0A 3NNNA 3FDJA 4IILA 3SXUA 3RUPA 4LYAA 4CEIB 1QV9A 2BFFB 3QE0A 3WX0A 1XHEA 1WX1A 4QGGA 5B58T 1NUPA 3MJTA 1QHFA 2PZ8A 4KE9A 3F3KA 3ASUA 3CTMA 4BMDA 5IJAA 1YVPA 2X2EA 3F7MA 4XX0B 4M0DA 2IFTA 4JDPA 4N0EA 3SX0A 4A0GA 1BMQA 2QOEA 3QNMA 2IBTA 2I6GA 4JX8A 2EW1A 3CCBA 4RANA 4YAJA 3EXFA 2Z3VA 3HDTA 4CR8A 4E21A 4TV9B 4D42A 4PGFA 2BKXA 3KAPA 4EYSA 1OY1A 1ZD5A 3TUJC 2A1UB 1NIJA 1BGXT 4RTLA 3DTVB 3R5HA 2WHXA 1GKLA 1F4PA 1JAYA 3D6FA 4FILA 4LKOA 4TS4A 1VMEA 5DNWA 3Q3CA 1ACLA 2J3EA 3H19A 3QU9A 3ADCA 1I4OA 3N2NA 2ZYVX 2OK7A 2VBFA 4E2XA 4EI8A 5B3KA 1OH8A 1WABA 2WG0A 4J90A 3SOZA 4DYDA 1U5AA 3RTCA 3W4KA 4NCHA 2I1WA 4PPGA 3AOEC 4JCCA 2YJ6A 2A9JA 3STWA 1O58A 2AX3A 3W5DA 3IUYA 2HA0A 3UAGA 1WBJB 1TJNA 3OJLA 4FNOA 3AR8A 4R5MA 3FRHA 5C51B 3GWGA 1BH6A 2DWPA 4JK3A 5GZ6A 2VHYA 4IDOA 2VG8A 2PNJA 5BNFA 5C7IO 4F72A 5KOJB 3AGQA 1VHTA 1G9XA 1NPYA 1QVRA 4XYMA 1UIRA 4LX0A 1MO3A 4MICA 3VKUA 4EHKA 2MYNA 4NG4A 5LOVA 3BFKA 1YI0A 2RCYA 3NIDB 5FO1A 1G18A 1XCBA 1ODJA 3ERCA 3ESBA 2AG5A 4HX9A 5F51A 1C0PA 1CRQA 2FFRA 3D5EA 2WY2D 3DQPA 4B32A 1KA9H 1U6IA 4JOCA 2AOUB 2QLLA 2BSXA 3MRXA 4PY2A 4ESOA 5IJ9B 2UAGA 3O82A 3EGIA 1KVRA 2ZI7A 3A1VA 3NEJA 2FSPA 1N6IA 2I8CA 5H83A 2BKLA 4C0AC 4ZEVA 4I8DA 3R5JA 3NFYA 4YREA 4DLSA 4LDNA 3DBLA 2O8FB 2GQ0A 4ADSG 2PM8A 1BKSB 2RAFA 3Q72A 4LZPA 4TS9A 4TWZA 5LM3A 2AKEA 3NRCA 2B2CA 3D7KA 1GUAA 1ZCAA 4GGOA 3ONFA 3T3PB 2KE5A 1RAFA 3OIVA 3G0OA 3UCEA 2D1QA 3NFRA 2ZZKA 3OTIA 4MUIA 2LPMA 3LX6A 2EEZA 2WU0A 1NVVR 2FP4A 3QF7A 3ZWAA 2V0CA 1A9TA 3IQFA 3IAUA 3NLLA 4N5IX 4DXDA 3R3YA 3RPEA 1PU2A 5LFAA 3I23A 4BMOB 5EJ5A 4O4LF 2G72A 4M99A 3LHDA 3EZFA 1NVAA 2MINA 3O95A 1HM5A 2IYFA 3UFXB 5HK9A 4BMCA 3R3WA 3KLNA 1U99A 3O03A 4L08A 3JQ9C 4J0QA 5FPYA 2QAJA 5JLAA 4ZYLA 4JC0A 4HFNA 5FWXA 4UOEA 3W5BA 4RTQA 3CLSD 1A8QA 4FGLA 1Q3HA 4AJEA 3FR8A 2YY7A 5JS1A 4ZJYA 3UBMA 1CHDA 3NBXX 2YFKA 4Y1EA 5BV1A 1U3UA 2F17A 2YYAA 5TIIA 1QHSA 3PNVA 3WNZA 4BCBA 3VUFA 2CBGA 3ZWVA 1ZUWA 4FGWA 3IL2A 4E5VA 3AVXA 1Z2CA 2BE7A 3K0AA 2RJ3A 3ASYA 4YP5A 1GTL1 3S2UA 5MN5A 4JBHA 2EBWA 4Y2YA 5CITA 2YWFA 2WZDA 1T9KA 1Q6YA 4B48A 4BU1A 5CM9C 3WIVA 5KX5B 1GT91 2I54A 5IAKA 2VNHA 3WK8A 1Y98A 4LNAA 4TXNA 1A97A 2BGJA 3C1UA 3ZCSA 3DZDA 4M21A 2PSSA 3UATA 4ARZA 4BVAA 5HSGA 4J0HA 1VYUA 3E9ZA 3PZRA 1KHTA 3TSZA 5ABPA 2Q3MA 3BRSA 5EA2A 4YP1A 2HPAA 4QNRA 1Y3DE 2W2NA 1ES9A 2JI8A 3OT1A 1Z8HA 1TOAA 3MGCA 1T5TA 3CIOA 5KUTA 2JGJA 4X20A 5JCJA 4K6GA 2P9CA 3PRKE 4YN3A 2EQBA 3OJEA 1Y8RB 4K3UA 1VHWA 1PZMA 3ICCA 621PA 1EFUA 3CE9A 5AJHA 1MB0A 2OFOA 3KTDA 2HSZA 2PX2A 3L18A 3P0HA 4G3XA 5CLLA 3OEED 2OQVA 6AT1A 4U4AA 5DZSA 1SJ9A 1MR3F 2OHOA 3KLBA 5TSDA 4XWOA 1J0AA 4AJ2A 5LJLA 1TA9A 1SOWA 1M2FA 3NX4A 4UDXX 5LLSA 4GMHA 1ADJA 1J90A 1DV1A 1ZR2A 2XB9A 1D1QA 1QV6A 2C88A 5JWRA 1K06A 2XGGA 3EXHB 3GHHA 1F38A 1DQRA 2MTBA 1MGOA 2WT4A 2WYWA 4NR0A 5LA6F 2ZLBA 4KQXA 3ZDZB 1BCRB 1DBRA 5J1TB 2FW9A 2VXCA 6NULA 1IOWA 2X3UA 3DUFA 4A0FA 3LDGA 2BHLA 2GHTA 3S1LA 1H0KA 4QUHA 4IQ0A 1F1JA 4O3FA 3NBQA 1RQGA 3PJFA 3FY4A 4MCJA 2VP2A 1WB4A 3TTWA 2FP3A 4F2PA 2GPSA 2ASVA 2HJHA 2LXNA 1I2AA 3H2KA 4AFNA 3AVTA 1Q92A 1IZ7A 2BTQA 4G84A 4KVAA 3FROA 4MQUA 3U56A 4IH1A 4EGSA 1D2NA 1L1RA 4WINA 4GI7A 3NIGB 5ALQA 4PONA 1L4MA 1XZEA 1RZUA 4P08A 1F9AA 3BIOA 2ZSFA 1W5BA 5DHUA 1RHUA 1GSOA 1HL3A 1K2VN 3DEZA 1YQQA 2HMSA 3LF2A 3VYTB 1ODIA 2XTJA 4FWBA 3MUOA 1RWNA 3V1YA 1B1CA 1VJTA 1W29A 5ESRA 4HB0A 4NEHB 3G5TA 2GB4A 2Q5LA 1VJ0A 1GU0A 4L4SA 4BYGA 2P5TB 3EPRA 1WOMA 3HR7A 4ZCTA 3PKJA 4QU5A 1XSEA 2ENWA 5E9JA 1XA3A 4YRKA 4HPXB 1FC0A 3K0BA 4B3JA 2O2DA 1UK7A 2QUAA 2RHDA 3BA6A 3NBUA 2GCOA 5BSTA 3DOEA 1UC4B 3SNKA 2VBGA 4BZZA 4R71A 1TM7E 4A0SA 3FMPB 3F46A 4Q4HB 4IPTA 3LUPA 1SXHA 3ETHA 4CW7A 1T2DA 1SVIA 4M76B 1H65A 4LXXA 2E5FA 1SVNA 4H6VA 4RVOA 3FNEA 3RSLA 5FH9A 2BI8A 2ZYDA 5DW0A 5B7PA 3NEAA 1M6WA 5T5QA 1SU4A 2LKDA 3M9LA 2CEAA 4LMRA 1PFVA 1U3DA 2D13A 3DDOA 3A9VA 1U7TA 4QULA 4V02A 5ESDA 2IYUA 1Z0SA 1V11B 2WV9A 4FX2A 2RAUA 3RV4A 5BNZA 2WM2A 3JD1A 4IMIB 1R4NB 4BC0A 3U0BA 1UM9B 4XB6B 3VXKA 3HXLA 1XX6A 2HMWA 4PVCA 4WLFA 4PRKA 4V0OA 4GPEA 4U2GA 2ZZMA 2IXGA 3O4RA 1PAUA 4TKMA 2MYPA 2DHDA 2PMEA 1AHHA 1EYZA 1QOQB 5HXAA 4X92A 2WD8A 1ZGGA 1DRJA 3IJEB 1T1RA 4EJSC 1XCMA 4N3CA 5DWDA 4FEYA 1BJRE 3E8XA 4OIMA 2BJWA 1R0RE 4IKOA 3V1NA 1ST3A 2V6BA 4ML3A 1RBYA 1Y5MA 3ZWCA 2NNLD 3HTXA 3NIBA 1EFPA 4HH3C 1ZFNA 2IC5A 1B6RA 1L4NA 2C2KA 1GU7A 2GA9A 3RVLA 4XYGA 1NJFA 1C7FA 4DA8A 4E08A 1CERA 2WR8A 3QMWA 2ZRIA 3QPDA 1XQWA 3K6SB 1EIWA 1N5LA 1AQIA 5I5GA 4AVYA 4OAPA 4W5WA 4GH5A 2FWPA 1C0IA 4LRXA 1T4GA 1IBMB 2E7ZA 3PQ5A 1N3LA 4JVLA 4K0KB 1W75A 4M46A 4LRYA 3A8TA 4UNRA 2B98A 2FX3A 1B00A 3H17A 3I4FA 4B8ZA 4QGSA 1DAKA 2O3SA 5K45A 4PNEA 1JW9B 2QV7A 4IH9A 1EP2B 3GMSA 4R3WA 5AOBA 4BNIA 3FX2A 4ODIA 4UNSA 5L8VA 5BN5B 3ZQKA 1FNDA 3A0RB 1U8UA 1X7ZA 1OJLA 4FK8A 1L4HA 1DFGA 4Q00A 5IAJA 1F12A 2OL4A 4C3OB 4ZZ1A 2K7FA 5LD2C 3ESQA 5A4DA 1YR1A 3S8MA 1EQUA 5LQCA 1ZGCA 2Z98A 4BNTA 1PIWA 4PC6A 3A3KA 3EA4A 2YWBA 1C41A 2BUCA 5IAGA 3RW9A 1HDXA 5JBQA 1SB8A 3UWPA 1SQ5A 1PNQA 3FTPA 5F5XA 4IZHA 3EFEA 3UYKA 3CVXA 1XXHA 3SJBA 1BXRB 3NBMA 1T34A 4MQFA 1Q95A 2WKRA 5J23A 4RMGA 5DISB 2FG7C 5GM1A 1E1CA 4MK4A 5SY6A 3IQGX 5ERYA 4ARUA 5M34A 1P29A 3PPWA 5G1NA 3EY4A 4ZI7F 3U6KA 3WNCA 2A88A 3L4KA 2F3QA 1KQ3A 4LVUA 4TQGA 4OQNA 3A2KA 3CEAA 1TIKA 2HZBA 4L0QA 4DYVA 3WLAA 4XCQA 2NU8A 3B5JA 3PI6A 1YUBA 1AVTA 4UVDA 1W6RA 4WKCA 2PH5A 2QMHA 4LX8A 4MVYA 3SC3A 3KZKA 2W8ZA 3TKYA 2Y9MB 5LB4A 2BZSA 4REQA 1TLLA 5B55A 3ESRA 3B6EA 1SKAA 4IO0A 5DYWA 3OICA 1HDEA 1AXGA 4GF5A 2PA3A 3CNEA 2FR8A 4JHXA 2F8SA 1DKOA 3PFNA 5AQ1A 2ZW9A 1GRNA 2FXIA 3EXHC 3A37A 1XTVA 1UPUA 1I7PA 2Q8NA 3D2CA 1YRBA 2JRCA 3HRKA 3I2HA 3MTDA 4NECA 2J59A 4ARCA 4YX9A 3PF9A 5LU9A 3DDZX 3FFBA 1ZOIA 3MT8A 1ZM7A 2P65A 3O2QB 1L1QA 2F4NA 4D8TA 1N5IA 4KRYA 4F93B 3AKZA 3L05A 5AW5A 3B51X 1PKXA 5FB3A 3TPZA 1EJ6A 3FI9A 1D2EA 4K9KA 5G41A 3GCXA 3CLTD 1Q3KA 4G0ZA 5ES3A 5ESXA 4G0WA 4GXNA 4X1OA 4TKVA 4CKWA 4D99A 1E2IA 1OI2A 3MUFA 2ISSD 1DWQA 3EGDB 1GKKA 3NIWA 4R2WA 4CKEB 3ISVA 4DMFA 1QB8A 2FSVA 1GPUA 3NBFA 1U0LA 3PEFA 3F96A 4B6JA 5ELMA 1H3EA 2O0KA 1JDSA