4Z6KA

Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
345
structure length
345
Chain Sequence
MKAAVLHEFGQSLQIEEVDIPTPGAGEIVVKMQASGVCHTDLHAVEGDWPVKPSPPFIPGHEGVGLITAVGEGVTHVKEGDRVGVAWLYSACGHCTHCLGGWETLCESQQNSGYSVNGSFAEYVLANANYVGIIPESVDSIEIAPVLCAGVTVYKGLKMTDTKPGDWVVISGIGGLGHMAVQYAIAMGLNVAAVDIDDDKLAFAKKLGAKVTVNAKNTDPAEYLQKEIGGAHGALVTAVSAKAFDQALSMLRRGGTLVCNGLPPGDFPVSIFDTVLNGITIRGSIVGTRLDLQESLDMAAAGKVKATVTAEPLENINDIFERMRQGKIEGRIVIDYTMLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
publication title Structure of alcohol dehydrogenase from the antarctic psychrophile Moraxella sp. TAE123
rcsb
source organism Moraxella sp. (strain tae123)
total genus 112
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z6kA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4z6kA01
4CUZA 3KBOA 2HDHA 3JQAB 4YDRA 3V8BA 4DTIA 5K6AA 3SJUA 3MJ4A 1ISGA 4WCFA 1MC4A 3LC1O 3HDJA 4XB1A 3WLEA 5G0TA 2NU6A 4YR9A 1ZK0A 2FOIA 3KEOA 1DSSG 3GVIA 1KEVA 4PZDA 4UVEA 3EHEA 5CPBA 2YUTA 4F6CA 3D64A 1ISHA 1E1MA 2RHRA 1YGYA 4IS3A 2D0IA 1A9YA 2UUPA 2NADA 3S2EA 5BSHA 3NGXA 1V9LA 2HU2A 2CFCA 3HZZA 1VJ0A 4I9NA 1YOVB 1FDTA 3WLFA 4JBHA 5KJ1A 5CPFA 5U1PA 3IJRA 3RUDA 3QIVA 3KV3O 4AJIA 2Q1TA 3HADA 2VCYA 4MVJH 3GN1A 1VLLA 2FZEA 1YRLA 3C3XA 3ENKA 2Q4EA 4CMGA 4JJGA 3GOHA 5AXCA 4PVCA 1C1XA 1L7DA 4BO0A 4OMUA 3FN4A 3OICA 2O3JA 5AOVA 9LDBA 3JQDA 3BMOA 1FMCA 4BNJA 1VKOA 1MX3A 4I5EA 1N9GA 3DEYX 1NR1A 3TWOA 5GY7A 4CMEA 4MKZA 4DC1A 3JTMA 3PDUA 5L7TA 3ETEA 4CMIA 3L6DA 4YYZA 1AN9A 1V3UA 1P9LA 2HK8A 1LDNA 4ZICA 1FDSA 3B70A 2PH5A 5TS3A 1DB3A 1IE3A 4XR4A 5BSFA 4R16A 4IBOA 4GX0A 1P3DA 3CE6A 4FOSA 5L3ZA 1E7QA 2PGLA 2I3AA 3FSRA 1ZKMA 2JFFA 2LDBA 2W2KA 3GZNA 3ZCXA 1ZSVA 5A4DA 3Q9UA 1PZHA 1BW9A 3B1KA 5IXYA 2VYVA 4D46A 1I24A 3BA1A 1GZ4A 3DMYA 3GFBA 4OIMA 1NM5A 5CFZA 1T4DA 1E5LA 1GQYA 4IJWA 4HFMA 2P9GA 2FPGA 2A92A 4IZHA 4B8ZA 2HLPA 4IS2A 3RD5A 2CF5A 1EVZA 3WQRA 2W8ZA 1QORA 3PJGA 2BFPA 3ITDA 1IPEA 3ROQA 3VVCA 1NPYA 3NDRA 4RLHA 5JAZA 3FD8A 3WGQA 4F6LA 3BHMA 5JDCC 2X5KO 4P4LA 3JQ6A 4R54A 1NQTA 1X7GA 4CM7A 3UUWA 1F8GA 2A9FA 4X54A 1B8PA 1ULSA 1SBYA 3NKLA 2O4CA 2Y0CA 4WNIA 1H6AA 1SC6A 3NT4A 1A7AA 1EUCA 1PJ3A 4DBVO 2WDZA 3W6UA 4U0JA 4Y6SA 1DAPA 2ZCVA 3KYCB 4FIZA 2OGUA 1SB8A 4AG3A 2X9VA 4FDAA 1PQWA 4HP8A 5T57A 4F3YA 4QO8A 1NQOA 1E7YA 1NFQA 5MGBA 2JAHA 4XJSA 4BNHA 4DL9A 4L0QA 3L9XA 4YRBA 3DQPA 2WSBA 1LI4A 2FMUA 4BKOA 2GNAA 1EQUA 2DFVA 4Z0PA 3TZ6A 5JO0A 1PZFA 2HAEA 2RAFA 2NTJA 4DC0A 4MKXA 4GX5A 2QZZA 1XR3A 1CQIA 1UDAA 1DBVO 2AEMA 4UUOA 4ZHSA 3KLPX 4CUJA 3F3SA 3ZNOA 1ZK1A 2IEDA 1LU9A 1Q2XA 1KVTA 3JQGB 5JYEA 2GCGA 1SB9A 2F1KA 1EVYA 1U9JA 4YXFA 4PRLA 4WEQA 4Z6KA 5IJZA 2X7HA 3COSA 3FBTA 4M87A 5K0ZA 2DBRA 3LT1A 4QO7A 4IXWA 4EI2A 3IIEA 3VH4A 1NFFA 1U3WA 3W8DA 1P1RA 2I67A 1J49A 2VUSA 4IDAA 2W98A 2YV2A 2CY0A 3B6ZA 3WOHA 5COQA 1PGNA 4CLRB 1NR7A 1ZK3A 5ENVA 1ZK4A 4BNNA 3DAFA 1DO8A 3MJSA 5F5LA 3RC2A 1VI2A 4O0LA 5IF3A 2IEBA 1EBUA 4JQCA 1QYCA 5HRUA 2O7QA 3CINA 4FGWA 3U4DA 1PTJA 4KWIA 3EVNA 4AL4A 2Q3EA 3C1TA 4C7JA 4TROA 4JCOA 2PGJA 5BQFA 1PZGA 4R9SA 2NVBA 3I9KA 4OOEA 2NV6A 4R3NA 3K6JA 1ZNQO 1LLCA 1SOVA 4XQCA 1J0XO 3D3WB 3IUSA 3Q6IA 4I5DA 3ZH2A 2PD3A 2EGHA 4OXYA 5I9LA 1XYGA 3RJ9A 5I7EA 1EFKA 2EEZA 1OC2A 3WFIA 2O3SA 4J91A 3MWEB 3KEQA 3KB6A 1UZMA 1C1DB 2Q46A 3HN2A 3O8QB 5CEEA 4PLTA 1PQUA 4E5YA 3F47A 1OFGA 3M2PA 1K0UA 4ND3A 5JCXA 3OJFA 3DZHA 3AI3A 1IZ9A 2ET6A 1BHSA 3ZDFA 3SVTA 5F5NA 4AJNA 5A5EA 1IL0A 1U5AA 2ZK7A 4BV9A 1UZLA 3DZIA 3QWHA 4RORA 5IN4A 4CLHA 2VOEA 5JXWA 2DTXA 3DZBA 3KM0A 3RUAA 1XELA 4PVDA 1Q0QA 1ZMTA 1WAMA 1NAIA 3KYCA 2DPHA 3L4BC 2D8AA 5IDQA 2WTBA 2IRWA 3Q1LA 1R6DA 4BNFA 1B8VA 5B12A 4L74A 3S8MA 5JMWA 5KJFA 2TMDA 4PG7A 4M54A 3DXFA 3GAZA 2WM3A 3RUFA 4GGOA 5H82A 2Q2QA 1ID1A 2NUAA 1WPQA 3ON5A 1P1FA 1DJNA 4AJHA 4BGUA 4YRAA 4HFRA 4NG5A 1B3BA 2CZCA 4D42A 2YHUA 4FC6A 1BVUA 4YACA 3I1JA 3K2BA 5U4QA 1ENPA 4OO3A 1Y81A 4LGVA 4DQUA 4WLEA 3RVDA 5THQA 3ROMA 5EPOA 1ZEMA 3NV9A 1PJ2A 1LRJA 3JQGA 1EUZA 1ENZA 3E1KA 4II2A 4MVJA 3VKVA 1ZW1A 1V35A 1M6HA 3C24A 3DHNA 3T7EA 3C8MA 1O5IA 1A4IA 1P74A 1FF9A 3IC5A 4N5NA 5JAQA 4XRGA 1PJSA 4EJ0A 2PY6A 5A9SA 4JGBA 4PG4A 2Y93A 2C5AA 1KETA 5GMOA 3LLSA 4AJ2A 2VUTA 2VZ0A 3PRJA 4G65A 1HSZA 4J3FA 3GVCA 3GNSA 4QT0A 4BNXA 1MLDA 2Y1DA 3FWZA 3WBFA 4TRMA 5JE8A 1LEHA 4KQWA 1I2ZA 3PWZA 5A1TA 1T2CA 5C3MA 5C37A 5L95A 3ZWAA 1BRMA 1NPDA 3AUTA 4J1TA 2BFAA 3ANLA 4DXHA 2XF8A 4XQEA 1M76A 1R15A 3D3WA 4KUHA 1DFGA 2OOSA 2RCYA 3PGJA 1J5PA 2BD0A 2BMAA 1MFPA 4E2XA 1Y5RA 3QA9A 3PDJA 3C7CB 4A10A 3C7AA 3O8QA 1I0ZA 5GZ1A 1B8UA 4TSKA 1QV6A 4UEOA 5EQFA 1KVQA 2E49A 2TMGA 2I5PO 3WG9A 1TEHA 3I83A 5TLSA 3DZJA 2RHCA 3H2ZA 5C7IO 4LCEA 4U7WA 2YY7A 2Q2WA 2CD9A 4ZGWA 4RZHA 5KKCA 2EJVA 5FFFA 3SXPA 5CEJA 2UYYA 2I76A 3W4JA 2G17A 1O6ZA 4FFPA 3ZWOA 3GLQA 3S2IA 5H83A 4XGNA 4ND4A 3R3SA 3SBOA 4E32A 1MGOA 4YCAA 4A26A 1GEGA 9LDTA 2QHXA 3X2EA 4FQ8A 2O7SA 1DLIA 4MVJE 1B15A 2P2SA 3OQBA 4R3WA 4XDZA 1O9BA 4BV8A 5DP1A 1AHHA 1H6CA 3HG7A 1L1FA 4U8GA 2NWQA 1ZMOA 4L9RA 3RUIA 1PGPA 4L8VA 1EQ2A 4BMNA 1YL6A 2X0JA 2P91A 4YT5A 2EGGA 1G1AA 3GEMA 3JQ7B 4J1NA 4QEDA 4XRRA 2ZB3A 2CDCA 4NNJA 2VRBA 4FN4A 4NQZA 1ADBA 3GEGA 5A9TA 3UKOA 1O95A 2FSSA 3CPSA 5FEUA 2JCVA 3I3OA 4BNIA 3D4PA 1Q7GA 4H16A 3QVTA 1BTOA 3RC7A 4XD2A 4ZJUA 4WK6A 3AM3A 4CV1A 2QRLA 4DIBA 1LUAA 2Q1WA 3PHHA 4J1QA 5JLAA 2CSUA 1R4MA 4TMFA 3GPIA 3V2GA 1LDYA 2AA3A 2D5AA 1W0CA 2IZZA 5L4LA 1WXDA 4R51A 3VTZA 3JD4A 4H7PA 2WD7A 3IP1A 3NDJA 1HKUA 3KLMX 1YB1A 3W4IA 3GGPA 4WLFA 1GY8A 2FP4A 2GZ3A 4G2NA 1ML3A 3PZRA 4D41A 1UDBA 5L40A 2PFGA 3PJEA 1Y9AA 2DUUA 3SLGA 1U5CA 4BVAA 5ITVA 1B7GO 3MCVA 1VL6A 4YPOA 1HE5A 1R0SA 2FWMX 3MZ0A 3SEFA 4YJFB 2ZQYA 4D3DA 5JSFA 2AMFA 3ZV5A 1BDBA 3TJRA 3IL2A 3EDMA 3MJCA 6ADHA 1HDCA 3OA2A 2X5OA 2DBVO 3WSVA 4CM8B 3JQCA 3A28A 2Z5LA 1DHRA 2VT3A 2W2LA 4LK3A 2HJRA 5A04A 3TF5A 1UUFA 2EJWA 4P38A 1YVEI 3QWIA 2UVDA 1H2BA 4J7CA 2B36A 2OP0A 3G17A 4UUNA 3QV1A 4HX5A 3S2GA 4HKTA 1GPJA 1TT5B 3CXRA 4BB6A 1QLHA 4EDFA 3DZKA 3JD2A 4K28A 2HUNA 3DBHA 1B2LA 3FNHA 3RIHA 3WBBA 1RKXA 1QV7A 1GR0A 1UXIA 3ZWYA 2BH9A 3GC6A 3H8VA 3AUSA 1E3JA 3NTRA 3PYXA 1JVBA 4CM1A 3W8FA 2J3JA 4M89A 4RVFA 2EP7A 3QLJA 4DRYA 1W73A 3ETDA 2AQ8A 3GUCA 3ZWMA 1WDMA 1E1LA 4XIYA 1EE2A 1X1TA 3IOYA 3LC7O 1NQAO 3VOSA 3OIDA 4NJOA 4XEHA 1XU9A 4LMRA 5A3JA 3MOIA 1IYZA 3Q9NA 4ONEA 3OETA 1Y8QA 2YDXA 4TKLA 1H2HA 1I10A 4DLBA 1GV1A 1NWHA 5TT0A 5G0WA 3P19A 3CUKA 4AFNA 1Q1NA 1CRWG 3KETA 3GH3A 4NFSA 1NXQA 4PZEA 2Y99A 1OC4A 4J0FA 4NBUA 3V1YA 5COAA 4OSPA 4OOFA 4J2HA 3BYZA 3DFZA 1GYRA 4WOKA 1MG0A 2CDAA 2PGDA 4JBIA 3GNTA 1X0XA 3VZQA 1WNTA 4YA6A 4P8RA 1YL7A 1A5ZA 1XSEA 4HADA 3ZHXA 3FPCA 2R00C 5JDIA 2X58A 2ZCUA 2Q50A 3LC2O 4CV2A 4IDFA 3V5NA 2PH3A 1YL5A 2WE8A 4TVBA 4L75A 1DRUA 2I3GA 4NR0A 2O2YA 2DVMA 1S6YA 2HRBA 3K9QO 4O59O 3QY9A 1UAGA 1O94A 3EUWA 1NX6A 3HDHA 1HDXA 4BO2A 4B4OA 4RDIA 4OXKA 1NFRA 2PZMA 4MVJM 1EDOA 1MXHA 3TZHA 1UXGA 4BNZA 1I36A 1H5QA 3RC9A 3WYCA 2EWMA 3ANMA 3OQ1A 4IMPA 3OIGA 3IKTA 3AI2A 1C1XB 1CYDA 4MIOA 4H3VA 4Y6RA 2VZ8A 3DTTA 4ROSA 4WLVA 4XX0A 5GZ3A 1Q0LA 1HDYA 3KYDA 2QYTA 1T26A 3WSWA 2DTEA 4HNGA 3JYLA 4CMIB 1K5HA 2D5CA 4IJKA 4Q39A 4Y67A 5JW6A 1E6UA 4W6ZA 2GZ2A 3I9OA 4EGFA 3E9MA 3H9JA 3EYWA 4J43A 1DEHA 4RF4A 2O2SA 5FF9A 5DBIA 3UICA 5CAEA 1E3IA 2PTGA 3LF1A 3LT2A 2WYWA 3F4LA 3K30A 1U8FO 3CSDA 3JQFC 4WCDA 1F06A 2W2KB 1V3VA 3GZNB 4KTTE 1SMKA 3SC4A 5KOIA 1BW9B 4E2ZA 3JD0A 1HSOA 2G82A 4J6FA 4FS3A 3I6IA 3RQSA 1RJWA 3ST7A 2I6TA 1D3AA 3RSHA 3WTCA 2OMEA 4FR5A 4A2CA 4CV3A 2B4QA 4NBWA 4E5NA 3QE3A 1D1TA 2GR9A 5COBA 4WE3A 3RKUA 1X0VA 2V6BA 3MWDB 4BKPA 5JC1A 3E48A 4XDYA 1I8TA 2HJSA 4O1MA 2ZATA 3GT0A 3VVBA 1F0YA 4FBGA 1P31A 4UVHA 5A05A 4JJFA 3PTZA 5T67A 3OBBA 2D3TA 1I3KA 1EK5A 2QG4A 5I8ZA 4RQTA 3UGKA 1Q7BA 4Y8VA 1R12A 4RZIA 3U49A 2VHXA 1U2DA 1E3LA 3PJDA 3RC1A 3Q2KA 4AJKA 4Q9NA 3BMQB 2O3UA 3EY4A 5EN4A 3BZUA 3S2FA 4R1SA 3ZV6A 3HUDA 1DIAA 2VZ9A 2O3RA 4DLLA 1YH3A 3PK0A 2HMVA 2AW5A 1EMDA 4CL3A 1LA2A 1KC1A 4R4JA 3B20A 3NDIA 3WGZA 5A06A 1R37A 2X9GA 3RU9A 1M66A 3DWFA 4QECA 2LDXA 2OZPA 1ZUD1 4UULA 4LW8A 3VH3A 2PV7A 3VZPA 1YBMA 2WMDA 3QVOA 3E9NA 3ONFA 3AY7A 5TT1A 3ZWXA 3JQEA 4GLOA 3L9WA 4L4XA 4RV9A 4WEOA 3F46A 2OHXA 5CDGA 4QTZA 3K92A 2AQHA 4HY3A 1EZ4A 1BGVA 1SNYA 2PK3A 1DLJA 4BNWA 3OJ0A 3WB9A 1SEPA 1KVRA 3W8EA 1IZ0A 3BHIA 1E5QA 1TLTA 5DNAA 1H94A 5DCWA 1C0KA 1GL3A 2BFOA 3WWZA 1YO6A 1E3WB 1IHXA 3F4BA 3ICCA 1ZZEA 3KHUA 4OQZA 5AXAA 5BT9A 5JAIA 4B79A 2BI8A 3CIFA 3FNEA 3HB4X 4MP6A 4FCCA 5AXDA 1E7SA 1F12A 5G4KB 1KYQA 4OH1A 4OHUA 5FYDA 3PHGA 1CQJA 5A02A 1YBAA 4Z3DA 5K9ZA 3C7DB 4UUPA 1HE4A 4BB5A 3UOGA 3GRKA 4QXMA 4N5LA 5CG2A 2G5CA 3IAHA 2B5WA 3M2TA 5KKAA 2Q4BA 3STHA 3U09A 4TVOA 3PYMA 1AXEA 4LISA 3FHLA 3RFVA 4AVYA 3IJPA 3W4KA 5DULA 1J4AA 3ZU3A 3Q11A 3D7LA 3K2EA 1K6XA 5AXBA 4B8WA 1ORRA 2I99A 1NWCA 2X5JO 3GRPA 1PZEA 4RF5A 1RM0A 3LU1A 5JY6A 2H1SA 1W4ZA 4Q3NA 1PJ4A 3LSYA 4FD3A 3NJ8A 3D5TA 1Z7EA 3GG2A 3JYOA 1WDLA 3QSGA 2X4GA 4Z9YA 2Y1GA 3ZWBA 4E13A 4BNUA 5L45A 2C59A 4LVCA 3WIEA 2B83A 5DT9A 4D43A 4W7HA 1C3VA 4W9NC 2HMUA 4BNKA 4DVJA 3WNQA 4BNGA 2EP5A 2JCXA 4RDHA 4YT2A 3UN1A 3JSAA 3WS7A 2GGSA 3KO8A 3CZMA 5IN5A 3ZGYA 1QYDA 4CM9A 3GUYA 3ZV4A 3NAQA 3BMQA 4ESOA 2V6GA 1NQ5A 4URFA 4BUCA 1A72A 1UJMA 4Q3EA 3GR6A 4IGFA 1HZJA 4HV4A 2BHLA 4NBTA 4NHEA 3ORFA 2X23A 3OEWA 3GDFA 1NTOA 2W2LD 4GL4A 5JDCA 2ZB7A 4B7XA 2J5QA 2C2XA 4GBJA 4XGKA 3C85A 3INTA 2IZ0A 3MOGA 3TRIA 2BRUA 4IJUA 1X15A 1LSOA 1JLLA 1TI7A 2FHSA 3F5SA 4RPGA 4F46A 1U2GA 1AGNA 1GAEO 2PD6A 2YV3A 2WE7A 5G4LA 3U4IA 3UW3A 1BXZA 3H9EO 4ALNA 3TSCA 3I5MA 4DMMA 1UAYA 4FFNA 4ALLA 4I1IA 4JBGA 4CLOA 5IDXA 3QWFA 2ILTA 4KUGA 3BAZA 3QRWA 4YVFA 2C7GA 3E03A 3HHPA 5DZSA 2XPCA 3WMXA 3HE3A 2X86A 1XWFA 1PJTA 1PL7A 2HMWA 2VHVA 1FDVA 4PN3A 5I8WA 1MC5A 2DKNA 3OHSX 4YT4A 3GHHA 5ILGA 4CR7A 2QQ5A 5A9SB 4GX2A 2DTDA 2D2IA 1KS9A 1E3WA 5EERA 1P0FA 1TB4A 2A35A 2A94A 2QYSA 2R6JA 1RYDA 3LK7A 1Z6ZA 5BNIA 1T2EA 4YWJA 4N18A 4MKRA 3RUHA 5A03A 2I9PA 5G4KA 1N5DA 5ER6A 3DR3A 3AUUA 3NT2A 4GGPA 4I9UA 4N5MA 5F21A 5AQ1A 4C4OA 2X0RA 3DBRA 1VM6A 1UH5A 3CEAA 3RUCA 1JTVA 1IUKA 1AHIA 1QYVA 3GG9A 5CDYA 3PLNA 1Y7TA 5TC4A 3DHYA 3I4FA 1RPNA 3PHIA 3U5TA 4WKGA 4L4RA 4ILKA 2GN4A 4DREA 4PLZA 2PD4A 2I65A 4CUKA 1QP8A 3KUXA 4XYEA 3UCFA 4FJ1A 3AWDA 5EESA 2I66A 3FR7A 4YJGA 2VOJA 2AEJA 1ZJYA 3CZRA 1GZ3A 3G1TA 1K6JA 4P4NA 2EXXA 1NASA 2GF2A 3PFFA 4M86A 1VKNA 2CMDA 1WP4A 2JD2A 1PS9A 2NACA 5T8KC 2UAGA 4ZQHA 3BTVA 4EYEA 5IAAA 1F17A 1Y8RA 2OP1A 5BNFA 5LC1A 1GUZA 4YJDA 4B3JA 5KJ6A 1K2WA 3QHAA 4A5OA 2EKQA 4A27A 5ICSA 4UREA 4RF2A 1ARZA 3SX2A 5B4UA 1ISFA 2Y1EA 4MJLA 3ANNA 2JAPA 3DONA 3RFTA 4NU6A 4ZQFA 1AE1A 1BVRA 1PL6A 3DMTC 1PJCA 1CJCA 3PVZA 4BO1A 2PKQP 4J9VA 1MV8A 1XCBA 2GN6A 1YJQA 1PS0A 3NEPX 3NT5A 4PLFA 4GKVA 1O0SA 2CNBA 5IZCC 2PKQO 2J3KA 2GASA 2C07A 4R41A 3T4XA 1HDRA 4CMCA 5HBRA 2J5KA 3INGA 4ALKA 1ZEJA 3OF2A 4KDEA 2QZ9A 3PXXA 3WX0A 3DOOA 2IODA 1E1KA 4PLWA 5G0SA 3OFSA 4Q3DA 4IY1A 3IP3A 3ADPA 3PIIA 4RVDA 1QRRA 4CPDA 5JFOA 5BR7A 4FC7A 2WEKA 1PJQA 2X8LA 3PQFA 4ID9A 4IM7A 3VDRA 1GUYA 3AFNA 3FI9A 1ZXLA 4FW8A 1Z73A 4R1TA 4W4TA 1EEHA 1LLDA 3WGTA 3I9JA 1E6WA 1CIVA 2XXBA 3LQFA 4II3A 4MVJF 1R4MB 2RH8A 1HDOA 1H6BA 4D44A 3AM4A 2CUKA 3GVPA 2AEFA 3D4OA 1WWKA 2AXQA 2WD7B 1IB6A 3I9MA 4JP3A 1EFLA 2Y0EA 3RJ5A 4YJHA 3NGLA 1LDEA 2Y0DA 4CM6A 5L9AA 4IDDA 4PLPA 4CR6A 2BGMA 3H3JA 3P5SA 2VHZA 1YB4A 4FFLA 4BGEA 4IXTA 1ONNA 4RLSA 1GADO 1YXMA 3HFSA 4HFNA 3OSUA 3FTNA 1BG6A 1GZ6A 4IDBA 2EW2A 4JK3A 3UVEA 4BIIA 3DC2A 4MP3A 4U6QA 3WJAA 2HK9A 5FI3A 2F00A 5DOVA 2V65A 4K1LA 4BNYA 3DB2A 3OJLA 1ZO8A 3DL2A 4XYMA 1ONOA 5HWSA 4Q3CA 2O50A 1K6IA 3FPLA 4IDGA 4PG8A 2RH4A 4NBRA 2JD1A 2P68A 3KOUA 3WWYA 1T2DA 4ND2A 1ISJA 2E48A 4UUMA 5DP2A 4E5PA 2VWQA 1Z75A 3VPHA 3ZNPA 3KRTA 3DBHB 1DIRA 1R0KA 4LRTB 4AJLA 1YBVA 4K9DA 5KNLA 3E9QA 4BNVA 1E77A 3OJEA 5ER9A 2Y67A 1NAHA 1GEEA 2RBEA 3PJFA 1V3TA 2Y66A 3LDHA 4JNKA 4UEKA 4YEDA 3BIOA 4J16A 1T2FA 4Z0TA 5I9NA 3WJ7A 3Q0EA 5F1PA 1PU2A 3PWKA 4PLVA 5B4TA 1E3SA 1YDEA 4DPLA 1KEPA 3FRJA 4LSMA 1Y8QB 2PKRA 3QQPA 1C0LA 3G0OA 5F3RA 1LRKA 3D5QA 1E92A 4GI2A 1GPDG 4BQRA 4CQLB 1LJ8A 1A71A 4K6CA 4TQGA 1ADCA 1UP4A 2D59A 1ZIDA 4PLHA 3TFOA 4UEJA 4DQXA 1ENYA 1DAOA 1F8FA 2ZB8A 3H3FA 4PG6A 5EJ2A 1V0JA 3WGHA 1HE3A 1XQ6A 3QVXA 3ZN2A 5ES3A 1H9BA 1YONA 1BWSA 3Q3CA 3AOEA 3UCEA 3QW2A 3LVFO 2J5RA 2JHGA 2VWPA 1SO8A 4J4BA 1CDOA 1UZNA 4J4TA 3QJ5A 2O3TA 3QWAA 5JPIA 4CQMD 3JCZA 2C5EA 4E31A 2VTDA 3WGYA 1DFIA 2P9EA 3JV7A 1JA9A 2DC1A 4CM9D 4J7UA 1VSVA 2ZB4A 1N7GA 4YBZA 3ZWVA 3DTYA 2R2GA 4NIMA 2Z1MA 1PGOA 2W90A 4F45A 3EK2A 4EUFA 1ULUA 3TPCA 5CDUA 2SCUA 4DIOA 3ADOA 4IPTA 5JCJD 4PG5A 1DIHA 3KYDB 1VL8A 4EW6A 1TT7A 2PZKA 5KJCA 1WVGA 1KVSA 4FSHA 1A9ZA 3GHYA 1KVUA 4RPHA 3GPDG 1E7WA 1I3NA 2WYVA 4ZQBA 2Q99A 3DFUA 3GK3A 3JD3A 3DBLB 1M75A 4B7UA 3WGOA 4J7XA 2BELA 3EVTA 4RVGA 4DGSA 1U7TA 1FK8A 4FFOA 3C1AA 4R1NA 5C7OO 4XQGA 3GNQA 1NHGA 2ZTMA 3L77A 3K31A 1PX0A 5T5QA 2GDZA 1E6EA 3H6KA 3R6DA 4MO2A 5JC8A 2V6MA 5B37A 1IHYA 3ONDA 3JYNA 3TN7A 4A03A 4E4YA 4FJ0A 4N7RA 2WJPA 1NHWA 3BTSA 4YAEA 4BL5A 1PGJA 2X22A 2DBZA 3OP4A 1PJLA 4CM5A 4KQXA 3TQHA 2X9NA 2HO5A 4UVGA 3EZLA 1ZSNA 1UP6A 5HS4A 2BKAA 1E0DA 3UCXA 4IMRA 4MINA 1XHLA 4Y6PA 1E1NA 3NTQA 4LMPA 4AJ4A 4ZN6A 4AJOA 3GVHA 1GCUA 1NNUA 3ZHYA 3H5NA 1I30A 1XU7A 1KY5A 2YFQA 5KTKA 4CQLA 2Y1OA 1LSUA 1YKFA 1B0AA 3VPFA 4WNCA 5GZ6A 3RBVA 1N92A 3JQ9C 4O6VA 3VHRA 4OXNA 4BO3A 5ILOA 3RKRA 2P5UA 8ADHA 1XIVA 2ZYAA 2YDYA 3QWBA 4XKJA 4EUHA 3MJTA 1D1SA 1OZAA 1Z45A 5CDSA 1PGQA 3ZV3A 3WNVA 5CG1A 2JFHA 4WASA 4E12A 3PP8A 1EUDA 3ICPA 4DYVA 4BMSA 3RI3A 1T24A 4C7KA 2A4KA 1HETA 4JN6B 2D1YA 4HBGA 5JAMA 2X6TA 5L53A 1U3VA 1LC3A 1B26A 5T6BA 1HTBA 3V2UA 4E0BA 2P5YA 2PLAA 3U3XA 3FF4A 4W99A 3CMCO 1WMAA 1CERA 4NK5A 4CLEA 5IFLA 4BOYA 1E3EA 4A0SA 4CMBA 2R00A 3OECA 1GYQA 3I4CA 1HYGA 3K73O 2FZWA 3H9UA 3JYPA 3TZKA 4IQ0A 4R01A 1NVMB 2C29D 2H5LA 3RCBA 3KSDO 4XQ9A 3DAPA 3GQVA 3RBXA 4DQVA 4YAJA 1K3TA 4J49A 3EMKA 1ISIA 2GPTA 2NTNA 4U6SA 4N54A 4Z9FA 2DLDA 2PZLA 1NYTA 4E3ZA 1O89A 3DBLA 3LYLA 2J3HA 5A3VA 3HWRA 4EEXA 2C20A 1BSVA 4YQYA 2AQKA 1SPXA 3NX4A 4J4HA 1HWYA 2HSDA 4XR9A 1N1GA 2Y1CA 4TKMA 3V2HA 2IYPA 1QKIA 3RUEA 4JX8A 2C7VA 3D3EA 4NFYA 3JD1A 4AICA 3HDYA 3JQ8A 3ABIA 3ASVA 4D79A 2FN7A 2WYUA 1DIBA 3DDNA 1ZJZA 2BF7A 1GDHA 1VJ1A 1LQTA 2AG5A 1CETA 1UP7A 1QYXA 2VYNA 3AOGA 1ENOA 1JDJA 3GVXA 5JY1A 2H63A 1DC4A 1P1IA 3WIDA 1M67A 1U8XX 3EW7A 1PS8A 4XCVA 3V1TC 2EERA 3QVWA 3JQBC 2OFPA 3A1NA 5DCUA 2NQTA 4MVJG 3ROKA 4UAGA 3L4SO 4ZD6A 4E30A 1KEUA 4TRRA 5TRTA 2NU9A 3N7UA 2JKVA 4JXKA 4LRSB 5JMPA 4D3SA 1XEAA 1X7HA 3VZSA 1PR3A 4PZCA 3ZWWA 4NZ9A 1MFZA 4CL8A 2YZ7A 1ADFA 5KVQA 3E6AA 4GSLA 2YFHA 3IDSA 1ZXBA 1A7KA 4GSKA 4CMJA 4E5MA 5C7LO 1IY8A 3HDQA 4QFCA 3UHAA 4WPGA 1G0OA 4Y98A 2UUOA 2UDPA 3MTJA 5K6AC 1VJTA 3K5PA 4B4VA 1ADGA 1A4UA 1NPTO 2Q49A 4PIVA 4WCFC 5KVCA 3O26A 3PWSA 5HA5A 5JS6A 1C14A 2NVUA 3KXDA 4OM8A 1ZSYA 3MJVA 1WZEA 2J8ZA 1LDGA 1R4NB 2CVOA 4AJ1A 4M8SA 4E21A 2OL4A 4ZQEA 4BGIA 3FBGA 1DC3A 4R9RA 5IXSA 4CLOB 5ENDA 4HUJA 1YWGO 2XAAA 1DRWA 3L0DA 2GZ1A 1KBZA 3LT4A 5LCXA 3FWNA 3F6YA 3ENNA 5TQVA 3TOZA 3TZQA 4HXYA 1FDWA 1OI7A 3ITKA 1EBFA 1MA0A 3AFMA 4WLNA 4D7AA 2J3IA 2D4AA 4GWKA 3CH6A 1LNQA 1B16A 1X1EA 3RFXA 1I2BA 2O3QA 4NFHA 3TDKA 2IE0A 3PEFA 1K89A 2IYOA 2BGLA 3O03A 2GO1A 1NVTA 1LC0A 3K8ZA 3BTUA 3BMNB 2C2YA 2B37A 4RPJA 4W82A 5F1KA 1BXGB 4UVDA 4MIEA 3WQQA 4CMEC 1Y1PA 1N8KA 2VNAA 3M1AA 5LDHA 3MJEA 2YHIB 3GZ4A 1P0CA 5A9RA 4KWHA 2C54A 1JAYA 3CKYA 3DBRB 4EUEA 1YQDA 2FR0A 2ZYDA 4OAQA 1GFSA 1LDBA 4J2OA 4CM4A 1DIGA 4NDNE 3GAFA 3DO5A 3UH1A 5EINA 3AM5A 5TIIA 2P4QA 3E18A 1C0PA 2FR8A 2C0CA 5B4VA 3HJAA 3H7AA 3QVSA 4O63O 4QUKA 3FCOA 4Z0HO 2JD0A 5HS6A 4EJMA 2YQ5A 1MB4A 4MP8A 1U4SA 1HXHA 4GLLA 3FR8A 3KTDA 5H81A 4FOOA 1MG5A 2VN8A 2XOXA 4YJGB 4E2YA 4GPD1 2W4QA 2Z1NA 3ZW8A 1JVSA 1RM5A 1PIWA 4EITA 4RJTA 2ZIZA 2DBQA 4QX6A 1WZIA 3P2OA 4CLXA 4UVIA 2X0IA 1HZZA 1P1JA 3MEQA 5FWNA 3ASUA 1EVIA 1GYPA 1LBEA 2YV1A 2EIHA 3U62A 2VQ3A 3WYBA 4DUPA 4CQMA 5I7SA 4PFJA 1Y5MA 6LDHA 1Y8RB 4L4SA 1Q7CA 2ZTUA 4MVJI 3NTOA 5IZ4A 4D3FA 2VTEA 4U0KA 3U4HA 3OEYA 4ALMA 4D45A 1XGKA 4WLOA 4ND1A 2QRKA 4KOAA 5DOZA 3PLRA 3AY3A 2NVWA 3S1LA 4EEZA 1N1EA 1KIFA 3O38A 1LSSA 4ALJA 4W9NA 2H9IA 2X0NA 1W6UA 5JCJA 5G0VA 3BTOA 3ONEA 1HL3A 4KP7A 1JAXA 2Q1SA 4ZVVA 1DJQA 1BXKA 3MTGA 3SLKA 3WDSA 4CM3A 1PR9A 1R4NA 5L4SA 4KTVE 2VT2A 1CF2O 4KUEA 4PCVA 3LZ6A 2ZKLA 3HB5X 1T25A 2X1HA 3KZVA 3JQAA 2BLLA 1V8BA 3ZWPA 1GQ2A 4EBFA 1LDMA 3HN7A 4GVLA 4I08A 3TL2A 5JNLA 5J23A 4CODB 1JKIA 2QRJA 4BMVA 3WTBA 4BNMA 4BGVA 1DPGA 4XGIA 2B4TO 1LXCA 3E5RA 2AE2A 1D4FA 1HYEA 1RWBA 3NYWA 1Z74A 3G1UA 1KC3A 4S1VA 2EF1A 1MP0A 1ZH8A 4QSMA 4O5OA 4CV0A 1I01A 1PQPA 2V6FA 3GMDA 3ZU2A 4KZPA 1LSJA 4Z9XA 2HMSA 3WMWA 3BMNA 3AU9A 2FRDA 3IS3A 1BXGA 2WD8A 1VPDA 5L4NA 1GU7A 1YOVA 1RM4A 3H5AA 2AQIA 2V7PA 5G0UA 1EK6A 4YJHB 2B4RO 2YW9A 1HLDA 4YAKA 4FPXA 3GEDA 2YHIA 3OH8A 3OA0A 4IQGA 4TRJA 3VKUA 1OBFO 3I52A 3K96A 3H65A 2VWGA 2ZTVA 4GMFA 4BNLA 3EGOA 3OIFA 4I8XA 5KVVA 4P4GA 1EE9A 3L6OO 1PL8A 3WXBA 4JIGA 1LLQA 2HK7A 1QMGA 1S7CA 5EIOA 4ZQGA 1UXJA 5ITWA 3L07A 4OYRA 2NSDA 4ZRMA 4A7PA 1OAAA 2CDBA 4R5MA 3PPIA 4AJEA 1GUFA 4J90A 4WLUA 2VRCD 3GY0A 1YQXA 1HYHA 3I23A 5TX7A 7MDHA 5T64A 5EQDA 1GV0A 4OGWA 3ZNQA 2DU8A 3VPXA 3NUGA 1I3LA 1T1RA 3CMMA 1UDCA 4G5HA 4B4UA 1RM3A 1C0IA 2XXJA 4DIFA 5TGDA 2G1UA 3B1JA 1ONPA 1I3MA 2FSVA 2VWHA 2GD1O 3LT0A 4L73A 1U4OA 4WGGA 2DT5A 2NU8A 3A9WA 1Y6JA 4IDCA 2GRAA 2P4HX 2ZYGA 1F14A 4LVUA 4BS9A 5T8KA 3RAJA 4RQUA 1QG6A 2FY8A 2FR1A 3BHJA 1UXHA 2CF6A 3KYBA 1ZBQA 4W7IA 4YAIA 3PI7A 4JROA 3NRCA 5HTOA 1U7HA 3BMCB 3EZYA 7ADHA 3Q2IA 1B14A 1VC2A 3AW9A 3AUAA 3G79A 4CR8A 2VHYA 2NNLD 3A14A 1SAYA 4BO6A 1QLJA 4KDFA 4BNTA 3VC7A 2VYND 4I9HA 2G76A 3L4BA 5C5IA 3QP9A 2AG8A 2ZJ0A 1MUUA 2HMTA 3DMTA 1HDGO 3HSKA 3OM9A 1H0KA 3D4NA 5CP8A 3RBZA 5BSEA 5TSDA 4GAEA 4XA8A 5DCYA 3ZZNA 2NM0A 5IZCA 2H6EA 2JFGA 4OKIA 4YT8A 5BSGA 1FDUA 1P44A 1DDOA 3G3EA 1TA4A 4IGEA 4NMHA 1O8CA 3UFXA 3ZWCA 3RASA 4WUVA 5JYDA 4ALIA 3FTPA 3IUPA 1NBOA 1X7DA 3IQDB 4NI5A 1XA0A 8LDHA 4HFJA 3PHJA 3OJOA 5IDWA 4IDEA 4B7CA 4J1SA 4QQRA 1LX6A 1KY4A 1DHTA 4BKRA 2NTVA 4JP2A 4Z3KA 2OBYA 2HKIA 1SCUA 1GTMA 1CWUA 4XJTA 2C82A 4JJIA 4CLRA 4INAA 1Y9EA 2YJZA 2Q45A 4I5GA 2Z95A 3PHLA 1HEUA 3VAZA 1JWAB 3ZWNA 1VRWA 3VH1A 3KSUA 1JKJA 1LTHR 3W6ZA 5F1OA 4GVXA 2VHWA 1DRVA 3EC7A 3ETGA 2OUIA 4R68A 4EJ6A 1QR6A 4B3HA 1UR5A 3M6IA 2EG9A 3BXXA 4CMHA 2E82A 1E7RA 3PQEA 4ND5A 1X14A 4LN1A 3DZFA 2Y68A 5DDIP 3FNGA 3H5RA 2IDZA 4RO0A 1TVEA 1HDZA 1UXKA 4BHTA 1HT0A 2VUUA 3PFWO 3U4CA 2NQ8A 3E82A 3FNFA 5TF4A 1B3RA 3INRA 2GUGA 3P2YA 1U3TA 3DOCA 1H6DA 1PWZA 4PRKA 3WQSB 1C1DA 2JJYA 1QSGA 1BMDA 4G81A 3F1LA 1T4BA 1YS4A 5EL0A 3DBVO 3RU7A 3B1FA 4BQPA 3ZHBA 4CMAA 1I32A 3U9LA 1P1KA 4XYGA 3GDGA 3AJRA 3PQDA 5CDTA 4RF3A 5DBGA 4I5FA 4ITUA 2OBNA 1DC6A 2FPIA 4FFMA 5IDYA 5KIAA 2EV9A 3A06A 2UV8A 3BMCA 1I2CA 4D0SA 1JWBB 1V6AA 1ISMA 4HWKA 1FJHA 3W1VA 5KWEA 4OJNA 3KSZO 1P33A 3H9QA 1JQBA 2GLXA 4M49A 1PJBA 4IINA 2O4UX 2OORA 3DHEA 3GDOA 4PLCA 2P9CA 1U28A 2E37A 2E4AA 3LF2A 4H15A 2G0TA 3M1LA 3O4RA 4WECA 1GCOA 4IIUA 3TFQA 1KERA 2BFMA 2DQ4A 4RVSA 5CHEA 3WR5A 1IOLA 4K26A 3VH2A 2FPPA 2POQX 3AOEC 5JO9A 2VYVD 1A27A 1CEQA 2ZJ1A 2ZQZA 4Y9DA 2ZTLA 3A4VA 4GKBA 3RWBA 4FFRA 1KOLA 3ZW9A 1QYWA 3F5QA 3DZGA 3VZRA 4ZU3A 3ZHZA 4B4WA 2DPGA 3PZBA 1PEDA 3EAGA 5ICMA 1WW8A 5IG2A 4J9UE 5I9MA 4MIYA 3OQ6A 2Y1FA 3GA0A 5B1YA 5U9CA 2NU7A 4BO4A 4IUYA 1R66A 5DF1A 2B69A 1XKQA 4OQYA 1DXYA 3D0OA 5KVSA 3H2SA 1PSDA 3L6EA 4RVHA 2BI7A 4E2WA 3CTMA 2EKLA 1G6KA 3RROA 4HNHA 4S3MA 4GX1A 1AUPA 4OKNA 3PIDA 4MOWA 1R0LA 1TXGA 1MXFA 1JW9B 4R5HA 2Q1UA 4YQZA 3ULKA 3TL3A 3AK4A 4XYLA 3HFGA 3JQAD 4ZRNA 4NH4A 3TNLA 4D0RA 5KCZA 5BNTA 1Z82A 4PLYA 2QX7A 5L7YA 4DPMA 2PNFA 3IKVA 3I9LA 2BGKA 3LLVA 4NU5A 3UAGA 5A5FA 4CLDA 3SC6A 3D1LA 3I6QA 2GSDA 3JQ8B 3WICA 4EZBA 1EVJA 4RGBA 2GYYA 4BO8A 4GWGA 1XG5A 5DBFA 3PYLA 1HRDA 1HLPA 2Q2VA 2HQ1A 4PGFA 1R16A 1WMBA 4B3IA 4WJZA 1HF3A 1XQ1A 3T4EA 2PR2A 3E8XA 3WGIA 2VNSA 3R1IA 3VPSA 4A73A 3AI1A 1H93A 3AY6A 4NPCA 4NJMB 4Q3BA 4BO9A 1GD1O 1PWXA 3G49A 3IMFA 3GN2A 4AJJA 3R3JA 1YE3A 3GMSA 1DFHA 3KVOA 1M6WA 2EW8A 3R0IA 3PGXA 4NBVA 4Q3AA 1U3UA 4DPKA 4IQ8A 4CMKA 3OMLA 3VTFA 3VDQA 2GERA 4DA9A 4IZIA 3F1KA 1BDMA 2AE1A 4P22A 3TOXA 3UF0A 1JKFA 4NK4A 5L51A 1Z7BA 4M55A 2HCTA 2WWRA 4OL9A 2IXBA 4E5KA 2DAPA 1OOEA 4BKUA 1N2SA 4RVUA 1I33A 4WOJA 1JU9A 2GN9A 1XDWA 1AXGA 4MVJP 4RPKA 4RCVA 4TZTA 2NVUB 3I9NA 4XZ3A 3H9GA 4DBZA 2PWZA 2B5VA 3S55A 5JDIC 1D8AA 1VSUA 4K6FA 4AJPA 1I5RA 5TNXA 3ZI0A 5AYVA 3H4VA 2QIOA 4RPLA 3ZU5A 4E33A 1W8DA 1XLTA 1LQUA 2O23A 3JQ9A 4J0EA 4WCFB 2GN8A 4MDHA 3JQ7A 4YAGA 4GH5A 1ZVMA 2AHRA 2VRCA 4L76A 1X13A 2EHDA 3UXYA 1DC5A 2PA3A 1ZK2A 4FGSA 5I7VA 2YYYA 3N58A 4JLWA 4U5QA 2HRZA 1H9AA 2Y05A 3N74A 4ZA2A 1NVGA 3F9IA 1LLUA 2E6UX 4RL6A 5THKA 1GQQA 1G0NA 4FB5A 4IJVA 4DYDA 1T1SA 5AVOA 4TZKA 1E7MA 1EDZA 5I7FA 3T7CA 5KJEA 4XIJA 1D7OA 1YDWA 4CM4B 4BO5A 3AU8A 4OSOA 3X2FA 5HM8A 3BMOB 3WYEA 4TWRA 1RYEA 2B0JA 1HE2A 1N9GB 1P45A 3JYQA 2DFDA 2RIRA 1OMOA 2EKPA 4GQAA 1QXSA 4YJFA 1JN0A 3GFGA 3GGGA 5FI5A 4BO7A 1M2WA 2DUWA 4KMSA 1DOHA 4GMGA 4CM8A 2QW8A 4DMLA 1VE9A 3ZU4A 4CJXA 1ZCJA 4DWVA 3WGGA 4MPDA 4XB2A 5TJ9A 2JHFA 2J6IA 5JBIA 1LRLA 3JQFA 4BKQA 1YB5A 4QFDA 5ADHA 3O9ZA 4TRNA 4NJMA 3HNPA 4E6PA 4PLGA 3GGOA 1SEVA 3TZCA 2CVZA 1YQGA 2JCYA 4MVJD 1TT5A 5EMHA 3ZNNA 4XWYA 4CQMB 2DM6A 3U0BA 2OXIA 1P1HA 1FXSA 3DOJA 4DLAA 3WFJA 3SJ7A 4YB8A 5L7WA 4R1UA 5MDHA 3P7MA 1SZJG 3HQ4O 1ZFNA 1Q0HA 4XYBA 2CVQA 3C1OA 1NP3A 2B35A 3DAGA 4YTEA 5G2OA 5CEFA 2PZJA 1YJ8A 3E5MA 1P77A 3JQBA 4LCJA 3NJ4A 4YRDA 4IIVA 1T2AA 1WDKA 2YQ4A 1WLYA 1IULA 4FJ2A 2IXAA 1N7HA 3V1UA 5LDGA 1J6UA 1VL0A 5TJHA 3VPGA 1SOWA 4LSWA 1U1IA 5K1SA 2O48X 2JL1A 5DN9A 1L7EA 2NLOA 1IPFA 3ROPA 3GF4A 4M1QA 2OO5A 2IZ1A 1KEWA 4R69A
chains in the Genus database with same CATH superfamily
5A4IS 4U00A 1CFJA 3V8BA 4OI1A 3SJUA 3MD9A 2C94A 3VSBA 3LWBA 4E7PA 5F7JA 2Z8ZA 4Q02A 2B9EA 3GJRA 1TYDE 4XB1A 3BXZA 3MC1A 5G40A 1BOFA 3EZ9A 5CH3A 1GTSA 1POXA 3OZCA 1V41E 4Z4GA 2N9UA 5JCZA 3KZ1E 3GVIA 1KEVA 1JIVA 2CV0A 4UVEA 3WYGA 4KPFC 3TAUA 1UBEA 4NULA 1D04A 1ISHA 1Y9DA 4IS3A 1LWOA 4LECA 4RANA 1E5XA 3DWEX 2VAMA 2GK6A 5BSHA 3LLMA 2OESA 2ECPA 2UZIR 2HU2A 2CFCA 1ZD3A 3MMPA 4JA2A 4ND7A 5TVGA 4YRFA 3SZMA 1FDTA 2QRQA 3DUFA 3MLBA 4R0NA 1KAGA 4WA7A 5SY9A 2XXAB 1R6XA 4ZYUA 1VE6A 3L02A 3M89A 4MV6A 2VSFA 4WOBA 5BN5B 4JEIA 5C81A 2PXXA 2Q1TA 4UZFA 1CPYA 3GN1A 1U6KA 1KKUA 1YRLA 3ENKA 2Q4EA 2WIBA 4F6RB 3GOHA 2YJ5A 1IHPA 3AEZA 5DI3B 1U90A 3OM8A 2OCGA 2GBCA 2H57A 1X1BA 3OICA 4EARA 3ZD9A 2JIZD 4AQDA 4RKRA 1HA3A 1FMCA 2XJ4A 3LO5A 1MX3A 3QLVA 4I5EA 4DLUA 1X1QA 4KC0A 1Q5PA 2HWXA 4U2GA 3REGA 4BU1A 1XZPA 2B4AA 5CVJA 1NYQA 4MUAA 4OBXA 1ZYUA 4V3BA 2B99A 1GPKA 1DAMA 3BWYA 3UTDA 2L19A 1T0IA 1KI9A 4IUDS 4YYZA 3TQTA 4BDSA 3UJNA 5IUKC 2H48A 4MVWA 5CT6A 1W581 1O2DA 1II9A 3B5EA 3FB1A 2AZMA 4LSGA 4MWZA 5EKDA 2PH5A 3Q6MA 4UCXA 2AI2A 1LBIA 1V9SA 1L7AA 4LV5B 4IBOA 2VAWA 4XFKA 3S2UA 4FOSA 1SURA 1G42A 3JWPA 1E7QA 3P2MA 3T4PA 5AO9A 2P69A 2HYDA 1ZKMA 2NSHA 2XT9A 3HXMA 3G0DA 3ZCXA 2HLDA 2R62A 5A4DA 3RYTC 5A4MS 5I8PA 3IA2A 4KXMA 2VYVA 3M3HA 4A8JC 4MWTA 2QP4A 4OIMA 5CFZA 1NM5A 1RP7A 2X13A 3LRPA 3GP8A 3AL0C 2EFJA 3O8BA 1I0LA 1AXRA 1E4YA 4NBSA 1BA2A 3KDAA 4FR2A 3M81A 4BX2A 2A92A 4AIIA 4C7XA 5ABPA 1GQOA 5F52A 1Z68A 2CF5A 1EVZA 2YV5A 1GLGA 2XUPA 2WSLA 1B73A 1JH8A 3MWDA 4I4TA 3GRVA 1QORA 3DBIA 3PJGA 2BFPA 2FPWA 1IPEA 1TL7C 4GOMD 2OHOA 3NDRA 3ROQA 3DLPX 4OG2A 2WNHA 5ECWA 2BFEA 5FEMA 3WGQA 3U1BA 4H7JA 4HCJA 4LV6A 4YLEA 1EWVA 2DB3A 5LN1A 5JDCC 2QYHA 4F56A 2QG9A 3LPLA 3M4XA 1NQTA 3UUWA 3AYXB 3D6NB 2A9FA 3DQQA 3D8UA 3TJZA 1XQXA 3DKVA 3NKLA 2JGLA 1JIKA 4OX9Y 3ITEA 2WMOB 4PPGA 2GJAA 1IHDA 2P5TB 2RCNA 1IY1A 2XH8A 3CW9A 1WCYA 4GZMA 3GA5A 1TVKA 4DBVO 1KDPA 3RJMA 4UHHA 4TTSA 4FMCB 1V3QE 2QTBA 4U0JA 1AD2A 1UKVY 3F6BX 1FFWA 3KYCB 5E1DA 3EXFA 3PDHA 1RXUA 4HP8A 5AVTA 1P39A 3W5SA 4F3YA 2EFDB 2YQZA 2QORA 2ZR8A 2JAHA 4DL9A 3NRBA 1J21A 1W0JD 2Q2NA 3L9XA 1DPFA 2J3DA 2WSBA 4RGQA 3O2JA 1ONBA 5BWLA 2GNAA 2DFVA 4PIMA 4QGHA 3AVOA 2TMYA 1KZHA 1MMFB 5ITSA 3GIWA 1R88A 1D6JA 1UDAA 2AEMA 5ICFA 3P27A 4ZHSA 2BZSA 2NO7A 1O7JA 5IJAA 4C0HA 4ABTA 4PICA 3UEOA 1M1XB 4EUSA 2PBRA 2IEDA 4X62B 3B8HA 3BSYA 1MDBA 3F74A 1L7NA 2ZJ3A 4LQDA 4YDQA 1Y8CA 1A8PA 1G2OA 1I6MA 2WB4A 3G9XA 2X6RA 4TL8A 2VNJA 5JYEA 5LM3A 3R5KA 2PUBA 2YRFA 3HA5A 3R3XA 4OUDA 3RT7A 2QPOA 1IPHA 1EVYA 4G9BA 2P78A 2QGNA 3DM5A 3E3MA 4PRLA 1GQSA 3NXSA 1CS4C 3TQCA 1MF7A 3GX1A 2NP7A 1T29A 3R6TA 4IXWA 4QO7A 2XUZA 2A9JA 4EI2A 5ICGA 3KYJB 3ND6A 1XZKA 3H5OA 2WI8A 3W8DA 3BCRA 1TJNA 2I67A 2VEOA 4IDAA 1RU3A 1MAHA 5BOSB 2CY0A 3B6ZA 4P53A 4XCQA 1SCUB 1WO8A 5FBKA 5JSYA 2J41A 4UARA 1FFGA 4CLRB 2GWRA 5ENVA 4ZZ1A 1T3TA 1TM7E 1NJ8A 2DPLA 4HDCA 4GWLA 3THYA 2VLIA 1A3CA 4O0LA 1VGQA 1EBUA 4JQCA 3ELBA 4NYIR 5HRUA 1FS4A 1DIOB 1SG6A 5FLKA 5GONA 3U4DA 2FPRA 2B6HA 3VA7A 1XMOB 3SQOA 1BCRB 1YMQA 3AEQA 2XV1A 2PGJA 1ZD1A 2OYCA 5KYNA 4R9SA 3RRNA 5IVIA 4B87A 4E1AA 3Q15C 1I3OA 4NICA 3DE7X 3K6JA 5LXTF 1ZNQO 4DRZA 5IYZA 5FWAA 2GVDC 1E60A 3IUSA 4I5DA 3ZH2A 3SIWA 3V33A 4IEFB 1ATIA 3PFIA 4OXYA 3GFQA 4YH1A 3SNHA 5LYYA 4QXQA 1RRMA 1SCNE 3WFIA 2QMEA 3KB6A 3DGFC 4HSEA 1VE3A 1G8MA 2GM9A 2Q46A 3NHBA 3O8OB 3ZE9A 4PLTA 1CR1A 1N2ZA 2OVFA 2QA5A 3MVEA 5CB4A 5HZGA 2VP2A 3F47A 1D07A 4N01A 4EHJA 4Q5IA 2GAJA 4GOKA 4P3KA 5IEJA 3QLTA 2BM0A 3AWIA 2ZRFA 3OCJA 4Y6LA 4S1NA 3ZDFA 1BHSA 4P33A 1WDWB 4PWZA 1LNSA 4GOJA 1UBHS 1NF3A 4H1WA 1N5RA 1SUWA 3GNLA 3ISTA 1Z5NA 4RIHA 1GPNA 4HDNB 3ZDRA 4TYQA 4RORA 3QWHA 1CEEA 2ZUEA 2VOEA 4MW6A 2UZ1A 3DZBA 5CRIA 5BR4A 1SBIA 1N78A 3QEMA 1ZMTA 3FPKA 1WAMA 1NVAA 1KNXA 4ZVUA 2IVZA 4M1ZA 4ENRA 1V43A 2HT1A 1TKBA 2D8AA 3I04A 1IMOA 1OF1A 1ZCAA 1KPIA 1PR0A 4HB4A 1W36B 4BNFA 4EZIA 1TU3A 2ZRJA 3GRFA 1H69A 4WW0A 4WZBB 3I9V1 3S8MA 4X6XA 3ZXYA 4DAEA 4F3NA 5JMWA 3D8NA 1BH2A 3DEKA 4PG7A 2KWIA 3BL8A 4GGOA 2IYSA 4BV2A 3ON5A 2FYTA 2NUAA 1WPQA 3PE6A 4C89A 1P1FA 2NPIA 4BGUA 1MAVA 3K9LA 2B1IA 2CZCA 4G5SA 2RHHA 4D42A 1YIDA 1WHSA 3GLFE 1QWSA 1AQYA 5HIMA 3K2BA 4D9FA 2XDAA 3QPDA 4G4SP 4FEYA 3Q40A 1Y81A 4RSMA 4LGVA 3KEFA 3TIXB 3NIFB 3ROMA 1ZM2A 4RSGA 1NRXA 2AZTA 3F97A 1KP3A 1X1CA 3KHTA 2MU1A 3UK6A 1KMQA 4QUGA 2CFRA 4CQNA 1QH9A 1CY1A 2M98A 3CNEA 1U6IA 3DGEC 1O5IA 5JAQA 1FF9A 4DLXA 3F5FA 2UZ4A 4HXFB 4HUQB 1OLUB 1YR2A 4X63A 4DLYA 3VOBA 3A26A 5GMOA 4IIXA 1TK9A 4MR9A 3IHTA 1K63A 4DNQA 2VZ0A 4YPFA 1X7XB 2E4YA 3JWHA 3OE7A 4W5RA 1FFCA 2AG6A 3PC4A 1A2OA 3GNSA 3KS9A 1RWKA 3RVOA 3KQVA 4HRXA 3WBFA 4HLUA 2BCJQ 3UAZA 3NIGB 2CMHA 4GXTA 4ZU1X 2HIAA 3DEHA 3V9AA 4B3RB 4KQWA 4XLLA 3H42B 2REQB 3JRNA 3VX4A 3VNRA 1L7BA 3D5EA 1PWEA 1QO0A 1RYZA 3FFBA 4FLMA 2QQFA 1WCIA 4QQNA 6AT1A 2H00A 3L49A 1EZ1A 3EN0A 3IE1A 3AEUA 3EWNA 3FMIA 3HYNA 4JT4A 1RYNA 5CNJA 1BRMA 3OIWA 5FBWB 5L95A 4CL0A 4J1TA 5D7BA 2BFAA 3ANLA 1Q1BA 3GMIA 5FLYA 3IKLA 4J2TA 4YRJA 4NMLA 3LQRA 4UATA 4XQEA 2W42A 4KUHA 3E1SA 3MCTA 2VP5A 3CNLA 3PXUA 4FW9A 2NO1A 3OTWA 4NCBA 4O33A 1J5PA 1XZQA 1U2TA 2EIXA 3CCCA 4X8MA 4LJ8A 3TSOA 4DUZB 2XZPA 1WU8A 4UPEA 5HUJA 1ZGZA 1MFPA 2BMAA 2JGJA 3EAQA 1LBTA 3TBHA 4E2XA 1XKLA 2MINB 4PY2A 3ZD6A 5JECA 3O8QA 1I0ZA 1QH8A 3L4EA 4S05A 2QTVB 2P5SA 4YXWA 4A2PA 3CJTA 4HYYA 3LFTA 3H5LA 4NU8X 1ZJ5A 3FE2A 5DM2A 2TMGA 5CB6A 1C0EA 1TEHA 3ASYA 3H5VA 3X0DA 5DNUA 1G7TA 4PX9A 5FBZA 4KSYA 2QD5A 5C7IO 4LCEA 2TMKA 3EBLA 2IJGX 2YWDA 3ZXXA 4AWAA 2O06A 2D5LA 4ZGWA 1NBIA 1P2TA 2EJVA 4OHOA 3TGWA 2JCBA 2UYYA 4BLPA 1EPUA 2R7NA 1J5EB 1I2AA 2VJLA 4CHTA 1UQUA 1C4XA 1U7DA 3ZWOA 1SU8A 1KK1A 4RD2A 3S2IA 5EP4A 2PS3A 4X6LA 2VSQA 2VXCA 2YIMA 3C7TA 3DPUA 2RB4A 3T7KA 3SBOA 4I1VA 4YCAA 4A26A 1PQYA 1ZI6A 2G28A 2IYXA 2X6QA 1FLDA 2CN1A 3LDGA 4WT7A 3X2EA 1TJ4A 4C0XA 1U28C 2JW5A 1YB7A 2LPMA 1B15A 2P2SA 3A4LA 3CNBA 3O4GA 3DMFA 4R3WA 4BV8A 4YV2A 5DP1A 3IP7A 4U8GA 3SF0A 2NWQA 4DGQA 4ENTA 3FHCB 2BVNA 3RUIA 1CUVA 4H27A 4BLOA 4DJAA 2HLDD 4BMNA 2ACWA 4DRXA 5AHRA 5JROA 5K20A 4S12A 3A6LA 3UXEA 2HHJA 2IP1A 4FOTA 4D9NA 4FYVA 1JFRA 4QYSA 4QSHA 4AO7A 2AYXA 5HCUA 4KPUB 4M0UA 4O02B 4Y1EA 1ESZA 1LV7A 1VPVA 2P91A 3R09A 2EGGA 4V02A 4YT5A 5E7JA 4AG5A 3E9EA 1ULHA 4EAQA 4ZI3A 2B8WA 3R7AA 1M1YA 2ZB3A 3GP3A 1EAMA 3I01A 4NNJA 4NQZA 3NC1C 2ZW9A 4PSKA 3GEGA 2WKWA 3SJBA 4EI8A 3UKOA 2DJIA 5A0FA 4UCWA 3GYBA 4W9MC 2C83A 3JZFA 3AR8A 2FSSA 1IONA 2Q8NA 4MPRA 4WXRA 1TJYA 5HDBB 3EZ6A 5FEUA 5KSYA 4F9TA 1M6EX 4KQCA 4RJJA 5G1OA 1Q7GA 4H16A 2DEUA 1THTA 2J3QA 4L02A 1PR2A 3ZHSA 3RC7A 4EJ2A 1IXYA 3HBMA 4JI0B 4UD2A 4PAGA 4EFKA 1WD5A 1X1AA 1A97A 3EEYA 4FONA 4BQQA 4HT3B 4ZOBA 3UQZA 1SCJA 2GA8A 2PZFA 3AG5A 5JLAA 2CSUA 1VRCA 3VKWA 2MDTA 3GPIA 4F8YA 3O7WA 1D2RA 3MSXA 3UG7A 1DJPA 1C9YA 4FKZA 4R51A 2WPDD 1XNHA 4RXUA 4YUVA 2JH8A 3CR7A 4XQ0A 2WD7A 3IP1A 3EGCA 3NDJA 1YB1A 3FPEA 4WLFA 2OENG 3LJKA 2J9FA 1BE6A 3JYHA 4QPDA 3D2LA 2QX9A 3CEJA 3PZRA 3GWZA 1SKUA 1UDBA 3LVRE 6NULA 3KTAB 3OZEA 3TSAA 5HUQA 2CW5A 3BJEA 3GUVA 3D9QX 4LBWA 4Q9DA 4W63A 4XX0B 1TCAA 1VMDA 4JI5B 4AMYA 3V7WA 3RWOA 1WR8A 3ADCA 4AB1A 2VJPA 3ED1A 4D3DA 5CA1A 4QBTA 1SCDA 2AMFA 1TCVA 3L0IB 4QASA 5SV2A 1JJFA 2WMYA 3OLQA 1COZA 3OQIA 3UBMA 4DUGD 3NH6A 2YVQA 4EO4A 1F1JA 1HDCA 2Q0SA 2X5OA 2DBVO 3HFJA 3OA2A 4OIFA 3WSVA 3UMYA 2PG3A 2XIJA 4EL5A 4MX8A 5K01A 1Q20A 2X4DA 1RJGA 2H4HA 1CCWA 1UUFA 1PT5A 2D2VA 4F5YA 1LQ2A 2UVDA 4HWSA 3MJHA 4J7CA 2J9GA 4ML3A 3BJMA 4TX1A 2JGRA 3QV1A 4RTKA 4UFOA 3S2GA 3VR1A 4LBVA 2X77A 1GPJA 5EZ6B 5FULA 3T1NA 4X93A 2IC5A 4KFSA 4E5DA 2GD0A 2WU0A 3IERA 4QXAA 3FNHA 1HK7A 1XB2A 3K5IA 1RKXA 4DLPA 1QV7A 5KC9A 5ESRA 5FBVB 5BQPA 3BWDD 4IO1A 3AUSA 2YL2A 1JVBA 2P6MA 3A1DA 3D7KA 2GT1A 3MWYW 5LOVB 3W8FA 4DRYA 2WWGA 2Q9CA 2DR2A 1FNMA 3HU5A 3ETDA 4I1UA 1I1OA 2B9VA 3C5CA 3ZWMA 1WDMA 3GJ3A 3S7ZA 1M0WA 1O5OA 2EHJA 2H1RA 2HQOA 1Z63A 3E2PA 3DOEA 5D8DA 3OUTA 3VOSA 3ND8A 3OIDA 4NJOA 4N3AA 4XEHA 4J0QA 1AIPA 4EHBA 1JFFA 3MOIA 2OGTA 5BRNA 3NEJA 2X40A 1XQYA 1CVRA 3GT7A 1Y8QA 1RQ7A 1WBJB 4DLBA 4CZ2A 2OCBA 5KTNA 1YQQA 2DWCA 1FBTA 3ZHRA 1LGYA 1XD8A 1Q1NA 1Z17A 2XR1A 1OXVA 3HEMA 4PZEA 1T8TA 2Y99A 4ZQCB 2LW7A 3JY6A 1FRFS 1W4CA 5E95A 5JNTA 3V1YA 1N32B 1DT5A 3MQ2A 3DFZA 2IY9A 1DBIA 1DV1A 2FPLA 4FB4A 3H83A 1M34A 1ICEA 2P2LA 1GGEA 2RHLA 3TPZA 3G59A 4JBIA 1OT5A 1YI0A 2VATA 3ADBA 4B3MB 2WP8J 3AHFA 3NHMA 2OO7A 4G4IA 1T6XA 1X0XA 3VZQA 1IG3A 1WNTA 4HL6A 4BMXA 3MWLA 1YL7A 4LYHA 4P8RA 1A5ZA 1XSEA 4LGYA 3F4KA 4HADA 3ZHXA 5CURA 4Z9BA 2C7OA 3FPCA 3RSQA 2G0NA 2R00C 1M2HA 5JDIA 4E11A 3FUUA 1Y1TA 3W2HA 4G4JA 4B47A 4CV2A 1UODA 1AY0A 2P9YA 2PSSA 4ZWNA 3T5AA 3QX7A 4B35A 3R3YA 5KX5B 1DRUA 3WLIA 1ZMXA 3RS4A 4Q6WA 4ENSA 5CVVA 4DADA 1QWOA 2HRBA 5LP6A 3L1IA 1KFCB 2ZKIA 1O94A 2G06A 3DMPA 3HDHA 1QAOA 5L3SB 4QG7A 3T1VA 3PWTA 1PBTA 13PKA 4UZEA 4ZIRA 4RDIA 4OXKA 4YRIA 1NFRA 3ESDA 3TZHA 4MLZA 1OX5A 4BNZA 1H5QA 4ZO4A 2P0AA 3PIRA 1J2JA 4OFZA 3T3HA 1XO1A 3WYCA 3NU1A 3R3HA 3OIGA 1JQEA 4MLCA 1OASA 4WOCA 5GVSA 3EF1A 2RMKA 4DNOA 4WLVA 5GZ3A 1HDYA 5IKXA 4XJXA 1UT5A 2D1SA 4MCJA 3ASZA 3AHCA 2DTEA 2RB5A 1M2VA 1Z8FA 5SY6A 1OGJA 3ZD8A 1J8DA 3B5IA 421PA 4CMIB 4COKA 4EVQA 5JW6A 4W6ZA 4BMZA 4CETA 2GZ2A 2GK7A 3ACDA 3FROA 3L7OA 1E2BA 3U13A 5TMDA 2HF8A 4UTPA 4OX9B 5CAEA 3SZRA 1GG2A 2R5FA 4TS4A 2JJ1A 5FFNA 3A9RA 5FOVA 3WRVA 1E2DA 5JH7B 3CSDA 1W4LA 2JARA 1OI3A 3D7RA 5A6VA 2P90A 2Z2ZA 1V3VA 2VSYA 4R84A 2WV7A 4X97A 1BW9B 1HFWA 1AVTA 4WESA 3NBUA 1PN3A 1F9EA 1FJ2A 3A36A 4J6FA 3O4HA 3RF6A 1U9CA 1RJWA 1VA5A 3P0RA 4NBKA 4K5QA 4DMCA 4DWWA 3BB1A 3KJHA 3M33A 1M6VB 2IPNA 1L3BA 4P98A 4A2CA 4CV3A 3RGGA 3TG2A 4UTVA 1TUIA 2EBHX 3ZVMA 1V11A 4OY3A 2ZSFA 3T41A 3OX3A 4G67A 2GILA 1X0VA 621PA 4BKPA 4O1MA 4CT0A 2FK7A 1KEKA 3C45A 1PK9A 3BCHA 5BRAA 1FXWA 3KLOA 3VISA 1WZUA 1UZUA 4L22A 4NNPA 1OR8A 4YCLA 3VR6A 4JJFA 3PTZA 1MRZA 1Y4SA 1MR3F 1N5JA 4QPCA 1GKIA 3OBBA 4EYGA 3FFXA 1FEZA 5I8ZA 1K6EA 1KMNA 2FGKA 2IP2A 4WK4B 4Y8VA 3U49A 1VMIA 4RZIA 1W46A 3QTLA 3ER9A 2VHXA 3R2JA 3SSOA 1TO6A 3PJDA 3SYLA 4JWTA 3AL2A 2G5TA 4Q9NA 3RRMA 3EY4A 5MN5A 3BZUA 3S2FA 1JNXX 2P3LA 2O3RA 4UQPA 4M0PA 1V5FA 3PPVA 3D02A 4FOPA 1SXJE 4PYNA 2P62A 1A8SA 2Y9PB 1LA2A 1NW9B 4W1QA 3MPUA 2OCKA 4W1PA 1VMKA 4MWGA 3STXA 3NDIA 4AZVA 2GXAA 4BBJA 5DIZA 4ZHQA 5IVKA 5A06A 1R37A 2BKXA 1F3LA 1JP7A 4UU0A 1XLWA 1Z8HA 2X0KA 3DDZX 3PNSA 4MRMB 1MOQA 2CL5A 6PFKA 1TMGE 3GD7A 4O5AA 2OZPA 3E53A 4UULA 4LW8A 3WLNA 3VZPA 1YUBA 1AT1A 3I30X 3JQPA 3EGWA 5KTPA 3E9NA 2FN4A 1SXIA 3B9BA 4X8OA 3B1WA 1BMTA 1T8SA 2JGDA 1VLQA 3JQEA 1QZ3A 3Q41A 3DT8A 1IZYA 1ES9A 1CQIB 2FN8A 4UHFA 4Y2SA 2RAPA 3N6RA 3FZEA 3KQKA 1JIUA 2K7ZA 2IE8A 4C7BA 4EY8A 4QTZA 3TLJA 3PUYA 3Q1KA 5LL6P 2VCHA 4X3PA 4EUNA 1YULA 5JOQA 1DEAA 1W35A 2NSLA 3R9WA 1RI1A 2JJ2A 4YUWA 1LVGA 1O6BA 3OT5A 4TXJA 1HQKA 2R97A 2R8BA 1SEPA 1DXOA 4LI3X 3MMZA 1TUBB 2NGRA 1IZ0A 3CF4G 4D5EA 4ER6A 2V0NA 5JZSA 3ZZUA 2EG5A 4HGNA 5DNAA 1O97C 3A4NA 1IHXA 3F4BA 2PUEA 2F67A 2HSWA 3B52X 2Z43A 2JFXA 1AQIA 4OQZA 2GBPA 4BU0A 2VJMB 4Z4HA 2IUFA 1Q7TA 3ZGVA 2XMBA 1UPBA 2PGNA 2FW9A 4BZXA 3FNEA 5AW9A 3WISA 3HB4X 4MP6A 5AXDA 2QN3A 3WNBA 4B73A 1U2PA 4LWQA 2AD5A 4PZ9A 4DQLA 3MW8A 4ZCMA 1CQJA 2F8TA 1YS9A 4JHLA 3TM5A 5K9ZA 4UUPA 2R7LA 5AK6A 4MHTA 1HE4A 1EZZA 2PNJA 3GRKA 4PRZA 4N5LA 5KMGB 2G5CA 3IAHA 1U2SA 3SQMA 4Q4LA 4AG6A 3HN6A 4TVOA 5AK3A 3V8NA 2C58A 3IVGA 5H5JA 4ZVQA 3IJPA 2FB9A 3QPWA 3BSFA 5F7OA 2BFBA 4DBLC 3D7LA 2CHQA 2ICAA 4GMKA 1ORRA 1JNYA 1YVDA 1WP9A 4WINA 4JB2A 2XGGA 2AYZA 5TXGA 1EB9A 4AKIA 1RM0A 5TQ2B 4C07A 4LYYA 1JHOA 4XSGA 3B6EA 3VYTB 4GQIA 4W5QA 3KDPA 1YA8A 3LSYA 1M74A 3EULA 4WY2A 1JIQA 3AB7A 4DLKA 2WVJA 4CIAA 1Y3AA 2RAUA 4YMTA 1NLMA 5HM6A 4B85A 2AXPA 2QLBA 2X4GA 2ECKA 2Z4SA 2KB0A 4Z9YA 3J80A 5L45A 3NH9A 4G1UC 3HMKA 2G9RA 5DT9A 4KPYA 1F2TA 3O90A 4W9NC 2G08A 2L2QA 1SD5A 4MCHA 4TYPA 3TI9A 3WNQA 2MJLA 4A8JA 1REQA 2W2TA 3BQMB 4I4TF 5JAOA 3RARA 2HIGA 4FSDA 2BGTA 2XECA 3L01A 1XDBA 3C15C 4FZ3A 4L28A 3ZGYA 3OLCX 4MQ4A 4QXOA 2V6GA 4NARA 1Z13A 5BMVA 3EXHC 3RJTA 1UJMA 2ORVA 1FMLA 1HURA 2IKSA 3L1HA 4M8NE 4YONB 4JLAA 1RRPA 3WADA 1DCFA 3R7WA 3ZIDA 4DCGA 2D4HA 5SY4A 3CH7A 1UEJA 3GFVA 4URZR 1IUPA 4ZVSA 1X7ZB 4X7PA 4B7XA 5JDCA 4XGKA 3VU0A 2IZ0A 1E2KA 1GTL1 1PX2A 4K8RB 4BV3A 2JIPA 1X15A 2RGXA 1JLLA 1TI7A 3SR3A 4RY9A 4NLLA 4F46A 3LQ2A 1ZHFA 4MRPA 1GAEO 1EJ0A 2AOTA 2PD6A 3B89A 2WE7A 3PC7A 4JLKA 1S2LA 4K1XA 5T4HA 1Y3BE 2W71A 3UW3A 4RTMA 1D6SA 4DMMA 5FADA 4G9GA 4PYQA 4FFNA 4I1IA 3RWMB 5B36A 4X24A 1RI2A 1D9XA 1JEEA 3EF0A 5F9FA 5EXXA 3QWFA 1EI9A 4M60A 1VL2A 2H4JA 1FMFA 2YXNA 3K15A 4CEJB 1L5WA 5EPUA 3E03A 4POOA 3HHPA 5DZSA 2RGRA 4M9QA 5B2ZA 1RAIA 2VXYA 3HE3A 4QUEA 5AJUA 4OXXA 3TOVA 4YCSA 5I8WA 1A8UA 1RHQA 3OHSX 3ZTYA 5ILGA 1OXXK 3HYSA 5JSFA 5KTRA 3TSWA 3BGDA 2H18A 5A9SB 5DGIA 1E3WA 1DADA 1L5YA 3CZQA 2SKDA 3PC3A 1W36C 1TZCA 1Z4OA 4KXVA 3M7IA 1WB5A 2CYCA 3RIEA 1T2EA 5EA2A 2HB6A 3HHEA 1DC7A 8ATCA 4AURA 4M53A 5A03A 2DT8A 3U61B 1DTEA 2P9QA 3IEVA 4DIDA 5G4KA 1N5DA 5SZIA 1G17A 3UZUA 5KTSA 5F21A 4IDPA 1O6GA 3E58A 2QL5A 3CEAA 1VHTA 3U7QA 5KO2A 5AI4A 2N1BA 5CXQA 5BSRA 3OT4A 4Z4FA 1OA1A 1NJ2A 1WW2A 1VG1A 5CDYA 1Y7TA 2ID9A 3B9QA 5TC4A 3I4FA 4LWZA 5FT9A 2JFOA 4L4RA 5DLDA 4HUTA 3HTXA 2LIPA 1CK4A 4O2LA 2N0SA 5GONF 2PD4A 4CUKA 2IK8A 3U44A 1OI2A 3KUXA 5JS8A 3OTQA 4REMA 1VRVA 4RKEA 5AHWA 3AWDA 4C2UA 5EESA 1C4OA 2HCJB 1DKUA 3LZDA 2QVBA 4N6GA 1HYQA 1WXWA 3TOCA 3KNZA 4Q6BA 5FA6A 1F4PA 3UT6A 3WBKA 4QGSA 1AB5A 2AEJA 1UZAA 3BXOA 2O2CA 3LW8A 4QPZA 5EMJA 5IYZF 4P4NA 1VXRA 5E2IA 1I1HA 3BF8A 2CB0A 3PFFA 1TD1A 4KW7A 5FAXA 4JYMA 3UUEA 1F48A 1VKNA 4CIWA 3UPTA 1AB6A 1J00A 4EMSA 2MT9A 2JD2A 3G6KA 3O2NA 1PFUA 5JEEA 2PIAA 3LX5A 5C53B 3JWJA 1PKXA 2QPAA 1X80B 1SN7A 5HK8A 1BN7A 1QG4A 1VSQA 3QLEA 3BTVA 4MUIA 4RXTA 3CRQA 2QTZA 3HVRA 1MO4A 2C4MA 4XJVA 3TB6A 5CB4F 5DTRA 1QAMA 3W2IA 1F17A 3P4YA 4OHWA 5CLJA 1Y8RA 2AFVA 2HNAA 1DX6A 3AR7A 4Q00A 4GMHA 5FNVB 3WNDA 4B3JA 2RGAA 4RACA 4F04A 3LX8A 4A5OA 1KO4A 2EKQA 5HW0A 5ICSA 1NBEA 3HMQA 3LIPA 3SX2A 4G0OA 4NMXB 1BROA 4GPTA 3VPBA 3V4RA 2A0WA 1ZR2A 3W3ZB 2HJWA 2G7ZA 2PS0A 2ZSIA 3P20A 4GPZA 4NU6A 4B83A 3NOVA 4C4ZA 5M3BA 1AE1A 3QG5A 1BVRA 1N75A 1OJ7A 1X77A 1FP6A 2IIBA 2XVMA 3PVZA 2GJKA 1U8AA 3SF8B 4IFBA 4J9VA 1MV8A 2I54A 4X20A 4Z2YA 4WBNB 1YJQA 5H3CA 4DMFA 1Q21A 1O0SA 1N8NA 5UKDA 1Y48E 1FY2A 2GASA 2J3KA 2JNWA 2PKQO 4M98A 5GGYA 3R76A 4CF7A 3QE9Y 3AF5A 4PBRA 3V4SA 2ATIA 2J5KA 4NWIA 4PQYA 1ULAA 3N53A 3UT5B 1GPBA 4RWEA 2JLRA 1ETHA 3UMJA 4Q1VA 3K72B 4GI1A 3F7MA 2YVLA 2PUDA 3H2IA 1THZA 5JUWA 2IODA 5G0SA 4DG9A 5TQJA 3W5HA 3OPVA 4Y2TA 4IY1A 3IP3A 3PIIA 2RGNC 4CPDA 1WZ2A 1VYHA 1R8QA 3PQFA 1ZA2A 3R8CA 5CMLA 4MTCA 3VR6D 4ZCRA 2GFQA 1E6MA 5JXIA 2O2IA 4P2GA 2PQ2A 2Z09A 3HPRA 3H17A 5D51S 2H4WA 4HAIA 1S3IA 5J59A 4KL8S 4BFSA 3RK0A 1RE1A 5FFMA 2CFTA 3RSCA 5C8YB 3R9XA 4QYIA 3C3DA 1CIVA 1RCTE 3KELA 1CHDA 3C3AA 3LQFA 4NPHA 5H3LA 3T35A 3ZU6A 4B6FA 2RH8A 1SUFA 4DN6A 3DWIA 2JJMA 3QVKA 1G8FA 4KG7A 2Q29A 2HF2A 3VO8A 2AEFA 2XX3A 1EFRD 3BXPA 3D4OA 5FOUA 5A2GA 1GU1A 1S96A 1TZMA 2Y0EA 1G291 3HJGA 4Q7MB 1LDEA 2Y0DA 1BHJA 4HRVA 4IDDA 3RIXA 2ZAOA 4EG0A 3FZQA 4JJ8A 1TZKA 5ALOA 4EA7A 1HYBA 3N2LA 2E9SA 3L93A 3FNQA 1PEYA 5HILA 4O4HB 4JUBA 1GRVA 4PHTA 4Q24A 3TDMA 7GPBA 2VH5R 2W6CX 3HFSA 3I0ZA 3OCUA 3OSUA 4PN7A 2RK3A 1BG6A 2E87A 2VR1A 4IDBA 2HDNB 3WL6A 1O5TA 1WCXA 2G88A 2GEKA 4MW7A 3DUWA 3SQLA 4M9RA 1EEXB 2HK9A 1U0NA 3V48A 2EJCA 4X95A 4S2UA 4BNYA 1KS2A 3H19A 5EE0A 2C61A 3DL2A 5EKSA 3G2NA 4RHCA 1ONOA 3GXOA 3OZVA 1UEIA 1QCCA 2O50A 5FTLA 1JPNA 4YAOA 2RH4A 4Z7NB 3TLBA 3EC2A 2P68A 1KIMA 1FLNA 1LH0A 4RX1A 3FG9A 3SNKA 4CGYA 4RESA 1T2DA 4PQEA 2E48A 2OGZA 3QKSB 4IJ6A 4WZZA 5DP2A 4YMGA 1B6SA 2IPXA 3CBGA 3PUWA 1A4RA 1CLUA 3ZNPA 2DQYA 3KCQA 3Q8LA 4Y9TA 1R6UA 3QXJA 4TXLA 1H8HD 721PA 2CLLB 3GLHB 4DM3A 1HH4A 1T5HX 3OJEA 2OE2A 2XAUA 3BH7A 5ER9A 3ECSA 4D4GA 2COEA 1X19A 1U02A 2RBEA 4MTLA 2H5EA 3DHWC 2D54A 1A76A 1V3TA 2MOKA 3AUXA 3AGQA 1OX4A 2QRVB 2VHEA 1RLOA 1V71A 3D2AA 4QTXA 5BQ3A 5A3RA 4S2EA 5BYAA 2R1TB 4KR0A 1PZXA 4YEDA 1Y1KE 3WB2A 1I7DA 5I9NA 2OQVA 3GAAA 1E8NA 2OORC 1FUUA 4DLZA 1FB5A 5C4GB 2A7XA 2FEWB 2F4VB 1GGVA 3F8WA 1YDEA 2H9YA 1AG9A 1JTEA 2C2OA 4QWWA 4N8SA 4V0LA 3G0OA 1RBZA 5F3RA 5AT1A 3SHQA 1LRKA 1T43A 3D5QA 3F98A 5DM60 3TNYA 5AK0A 4GYYA 5JV5A 1LJ8A 1I1QB 1WPXA 3GGCA 1A71A 4WNAA 2HBQA 2JBAA 5CIWA 5AM2A 3JZIA 1DTSA 2D59A 2FOXA 3O9MA 3TFOA 2D5IA 4FK8A 5E6UA 1DAOA 2XZTA 2ZB8A 2GJSA 3H3FA 4PG6A 2IHYA 1H2RS 2R25B 2G5PA 1YU6A 4NAVA 1A7JA 1XWIA 1SA0B 3K0EA 3G2HA 1CQXA 5ADUS 1XFDA 1P6UA 3FMGA 3J7AC 2I4LA 1T13A 1H9BA 1YONA 2A6PA 3N0TA 2ZI3A 5KQLA 4E7OA 5KYXB 2I9KA 4C0WA 2VWPA 1SO8A 3PENA 2DKFA 3FM9A 5AKHA 3UMGA 3W79A 5HQ3B 4J4TA 2XKAA 4PO1A 4Q66C 5JPIA 3MWFA 5EIFA 4E31A 1TEVA 1CVLA 1YR7A 2FEAA 2P9EA 2BHTA 2BEUA 3JV7A 3O47A 2IS1A 1T10A 3AR9A 2WFLA 1VSVA 2P8SA 2QSUA 3L0PA 3AP1A 4LZZA 2GHTA 5CNMA 2VJYA 2DHEA 4K87A 2POCA 2YMPA 4YBZA 3DTYA 1KY2A 5HF8A 4NIMA 1D5WA 1QCDA 3GCWA 2W90A 4X60A 2QVZX 3BE4A 3EK2A 2YC2C 1ULUA 4F45A 5CDUA 3WKBA 5H9WA 4ENPA 2FW7A 1H2YA 3NOOA 4QPNA 1Y1QA 4JJAA 2LCQA 5C5EA 5JCJD 3SQXA 4MR8B 1BC5A 4BNDA 1TIBA 2VHJA 2DWOA 1XCPA 1LZLA 1H8ED 1TT7A 5KJCA 2C4HA 1FSFA 4FSHA 2CWDA 2IPAB 4G36A 1KVUA 4H6VA 3CHYA 4YRCA 3UK0A 4RPHA 4TWIA 5FO1A 5P21A 4B4DA 1L1EA 2WYVA 3R5SA 1B8NA 2PYIA 3AHEA 2F1OA 3C70A 1G38A 2Q99A 1ZW6A 2QY9A 3EGVA 4HWPA 2JK1A 2REXB 1E4VA 4UW9A 2CZGA 1YFZA 4PR0A 5CXSA 4ZEVA 2BELA 5CA1F 3KFLA 1U7TA 1QGUA 4X91A 3C1AA 4Y0VA 5C7OO 2QBYA 4FI3C 5HJ2A 5TDHA 1NHGA 3TIFA 1XRLA 3WNZA 5K3OA 4YCBA 1YCFA 4F1JA 4WVLA 3HYCA 5T5QA 3C3WA 4QELA 4AF6A 4C2AA 1E6EA 5JU6A 4UNQA 4MO2A 1HLGA 1RYMA 4OP2A 2FFJA 5B37A 3C6KA 3AQ4A 1IHYA 2IZ6A 3CR8A 2Y4NA 3FPHA 4KREA 4FJ0A 3BL5A 4N7RA 2WJPA 5CLFA 1JI0A 4Q9IA 1NHWA 5MFZA 5L3VA 2PU7A 3WLOA 3DFMA 4LE2A 3K0AB 1SBZA 4HNVA 3WGLA 4F4IA 1P60A 4K6KA 3AF3A 1RHJA 1ORWA 3DOHA 1AUVA 3U7IA 3UGQA 4AROA 1Z4QA 4C6TA 4KQXA 5KQRA 5BR8B 3EZLA 3DPIA 4EG5A 4QU5A 4AO6A 5DSXA 3WHLA 2DERA 1YK0A 1FYVA 1US8A 3TZEA 4Y6PA 3QX9A 3A1WA 3JS5A 4ZN6A 2WIKA 5IC4A 3GVHA 2BZ1A 5GJWC 3S68A 3H5NA 1V7QA 1NNSA 1SC9A 4YP1A 1NKSA 1KY5A 2F9MA 3FDZA 4BFUA 4HYQA 4ZDJA 3C6BA 2H2HA 1E9VA 1M1NA 1HDEA 3CR3C 1CDEA 1MC1A 4KN6A 3EJ6A 1W4BA 3TO5A 1Q17A 1XLTC 2FCAA 3EGXA 3P2KA 3X1JA 1Z4KA 5IKPA 1QPBA 1RWWA 4PSDA 4O6VA 3R5JA 4MQ6A 4OXNA 2VSOA 4YCDA 3QQ5A 1QCZA 2VK4A 3KR9A 2P5UA 4TTJA 3RKRA 1Y5NA 2ZYAA 2Q0XA 4XKJA 3BN3A 1R2QA 1ZVJA 1YZUA 2A9VA 3MJTA 1TPZA 2G83A 1XZFA 1DQNA 1Z45A 4DUYB 1PGQA 3A0UA 3C3KA 4DKXA 5ED4A 4C7OB 5FTJA 1T5BA 3F49S 3PP8A 3A25A 3ICPA 2RHJA 4X90A 4MRSA 1U7PA 4JKIA 1E5TA 1NJGA 1KFJB 2HN9A 1WF3A 2ODNA 1HETA 3OIVA 4JN6B 4HBGA 4DJDC 2UZ0A 1DZIA 4TTRA 3ECCA 3B3FA 2W9XA 1IBMB 1LFDB 2B0CA 1JPJA 1CUYA 1OFIA 4QBHA 3QY0A 1NT4A 4R2HA 1QS0B 2JHCA 2PLAA 3G8AA 3N39C 4X8LA 4W99A 5TB5A 3TLCA 3CMCO 4C6HA 5IFLA 5JQGA 5BWBA 2FN3A 2WZBA 1GUBA 3WGJA 4MZXA 3TIGA 2R00A 2YNMC 3F6CA 4LRQA 3TBFA 2CJYA 3WO0A 2GQ0A 3OHPA 4NMMA 3C74A 2Q28A 5E6RA 4O1IA 3H9UA 3L8GA 4B2PA 2JFPA 3ORSA 1SFRA 2KYRA 2ZRNA 4BVKA 3LL4A 3ETJA 2ZYIA 3HKDB 1XEWY 3QNMA 3RGWS 4I3GA 4QODA 3KSDO 4XQ9A 3W6NA 4Y2JA 3QELB 3I42A 3W3AA 4LI0A 1K3TA 1F1BA 2DPYA 2NYRA 1TX4B 2HZBA 2WWXA 3KKPA 2NTNA 4U6SA 2A8YA 4Z9FA 2DLDA 3P96A 2PZLA 4EPWA 4E3ZA 4G0YA 2EX1A 4HH0A 2P1DA 2CJFA 1DAFA 3IUMA 1GTJ1 4KX5A 3SBDA 4BFXA 4EEXA 3NMUF 2DFLA 4J4HA 5EZ5A 2OFWA 4JSYA 3TPFA 2JAUA 2HNKA 2ZT7A