5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
molecule keywords CurK
molecule tags Oxidoreductase
source organism Moorea producens 3l
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
2WD7B 2OFPA 2HMTA 4IM7A 1NFRA 4DLAA 1I36A 1H0KA 4YR9A 1DAPA 1E3SA 3FCOA 5A9SA 3ZU5A 1D8AA 1WLYA 2AQKA 4MVJG 3IOYA 3DL2A 2NACA 3BTSA 3WGHA 1OBFO 1YL7A 1DO8A 1LRKA 3FWZA 1ZEMA 1OMOA 2GZ3A 3GH3A 4DIFA 2QRJA 1JW9B 1VPDA 1KY4A 3ANNA 5DBFA 2DFVA 3WQRA 3WB9A 1NAHA 4IGFA 1KERA 1MG0A 2QQ5A 4JNKA 1N1GA 3QVTA 2NVUB 3NKLA 3ZHBA 3RJ5A 2CDBA 1PGOA 1EUDA 1LJ8A 2PNFA 3L4BA 3HDHA 5BNIA 4Y6PA 2OORA 3LDHA 3GUCA 1H5QA 4R68A 2OGUA 3TL3A 1MX3A 2UV8A 1B8PA 4NU5A 4WPGA 1Z7BA 2GYYA 2RAFA 5L7YA 1NTOA 2YHIA 2X23A 3HQ4O 1LDNA 3QE3A 5TX7A 4BO4A 4CM6A 1TXGA 4YA6A 4CQLA 3L9XA 4WNIA 2WEKA 3VVCA 5CDYA 4CMCA 2PR2A 3N74A 2WWRA 1BVUA 3H3FA 3WBBA 5CP8A 2XOXA 4RZIA 2EKPA 1HE4A 4XYMA 1XDWA 2H63A 4BNUA 2GASA 3ETDA 2AQIA 4YJHB 1DIBA 2YDYA 4CMKA 1JAYA 4UEJA 3U0BA 4MIEA 1FDUA 2ZB4A 5L53A 1YL6A 5JC1A 3V2UA 3BTOA 1NPYA 1PJ2A 1K6JA 5JE8A 4FFLA 1HLPA 3D5QA 1U5CA 1HDGO 3G1UA 1BDBA 2D2IA 4U6SA 1NR1A 4YPOA 3OIFA 1DLJA 1VSVA 2P9CA 3KBOA 4E5MA 3ZNNA 1U4SA 1LDGA 4RCVA 5L95A 2GR9A 2HK9A 2FHSA 4LSWA 4N5LA 3RUIA 2JFGA 4QEDA 2ZTLA 3E03A 3FNFA 2NNLD 2DU8A 3M2TA 3RUHA 3ABIA 1QYXA 5JFOA 4MVJP 2Q50A 5KJ1A 1T2AA 3NT5A 3C1TA 5JBIA 4CM1A 1D4FA 3GLQA 1MG5A 3JYNA 1ZW1A 2SCUA 3TZ6A 2NVUA 4GLOA 1GEGA 5EN4A 1KEUA 2H5LA 3KRTA 4DQVA 2FWMX 4ZU3A 2JHGA 1SB9A 1WWKA 2X9NA 3NUGA 4FOSA 3VPXA 1Z6ZA 4ZRMA 5JW6A 3CKYA 3WMWA 5IN4A 8ADHA 4N7RA 1O6ZA 3PFFA 1RPNA 4TVOA 3PLRA 4GSKA 4LCJA 3VZSA 4XYLA 1AE1A 4CQMA 1YONA 1XG5A 2NTVA 2X9GA 2C5AA 2P5UA 3PHHA 4KTVE 4CUJA 1PL6A 1I2CA 4A7PA 3OA2A 5JCJD 2PK3A 3NTRA 5F21A 1U3VA 3KETA 4BNVA 3IAHA 1DDOA 3F9IA 4RL6A 4RVSA 3KHUA 1JKFA 4XB2A 5L40A 4JJIA 3FN4A 4AJJA 2V6FA 3ZWXA 4I08A 2OMEA 1PWXA 3EY4A 5TS3A 5DCUA 5U1PA 1QKIA 5JXWA 4UUMA 3L6OO 4AJLA 1EVZA 4YT2A 7ADHA 1YBMA 2EJVA 3B1FA 4FOOA 4D3SA 3S2EA 4G81A 5IDWA 3KZVA 4J1SA 5IXYA 3PYLA 4NR0A 1C1XB 2JAHA 5I9NA 1KVUA 1VJ0A 2DAPA 2FR1A 3KUXA 3PGXA 2D3TA 3M2PA 4HNHA 4IDBA 1RM5A 4F6CA 2Y0DA 3X2FA 3BMOA 3VHRA 1I0ZA 4RVHA 3LC2O 2I65A 3DMTC 4F3YA 4YT8A 1X14A 4AFNA 4JBIA 1P1JA 1EVIA 5KVSA 1WVGA 3ETEA 1EZ4A 3PLNA 1WXDA 3D64A 1I8TA 4KWIA 5A3JA 1OZAA 3GDGA 1I32A 3IP3A 1E7WA 2W90A 3UH1A 4GGPA 4CM9A 5CDSA 1LLQA 4XRGA 4DA9A 2PD3A 4BL5A 3SX2A 3BMNA 3JQFA 3OF2A 1LSUA 3ROKA 3GK3A 2EKQA 5DDIP 5BT9A 4E5YA 2AXQA 1UXKA 2NU6A 3GMSA 4GMFA 1KC3A 2X5OA 2TMGA 1GAEO 1NFQA 1X0XA 4XR9A 1UXGA 4ESOA 5CEJA 3L9WA 1AHIA 1IHXA 1HT0A 1QG6A 1HRDA 3W6UA 1O89A 2V6GA 1GZ6A 2IZZA 5B4UA 2EG9A 3RWBA 1SB8A 3CXRA 1H6DA 1U3WA 5IDYA 1MC5A 2JD1A 3AY6A 4ZHSA 2O7SA 4NU6A 3WICA 5FYDA 1DFHA 5GZ3A 3AOEA 3B20A 3VZQA 1PQUA 1P74A 4XIJA 2C82A 3Q3CA 3KO8A 2I3AA 4P4LA 1DIHA 4M49A 5T64A 1U2DA 4D3FA 4WLOA 5G4KB 4XDYA 2Q1WA 2NTNA 4PRKA 4EDFA 1W0CA 3W8EA 1HF3A 1GQQA 2EV9A 4CLOA 3CMMA 3GVCA 3OJLA 3ZN2A 3DBRB 3VKUA 4K6FA 1JLLA 2ILTA 2X4GA 3INGA 4TKLA 3RASA 5CFZA 4NHEA 2NUAA 5CAEA 4B8WA 2OBYA 1HDYA 5MDHA 1RM3A 4Z0TA 3DDNA 3CZMA 1MUUA 3AFMA 5FI3A 3AOGA 3BHMA 1N1EA 2BI8A 2VUTA 2Z1MA 1E3JA 4J91A 1HZZA 1KETA 3WIDA 4R9RA 1Y7TA 1IPFA 2FPGA 2CFCA 5I7EA 1KVTA 3RFTA 4KP7A 2OXIA 4L8VA 4RPGA 1ZVMA 2HRBA 5DOVA 5BSGA 1JKIA 1ZKMA 4M55A 4NQZA 2VHVA 4BNMA 1UDBA 4RJTA 1MXHA 1Z45A 1XEAA 1B8VA 3M1LA 5HRUA 3WGOA 1NVGA 4RDIA 1PX0A 2FY8A 3WNVA 4L4RA 2O4CA 4E31A 1UZLA 2GO1A 3WGQA 3I9KA 3ANLA 3WYEA 3UFXA 1KIFA 1DIAA 2G1UA 3CE6A 4BKOA 9LDTA 3H2ZA 3IUPA 3ENNA 3OJ0A 4RQTA 1NFFA 2VYNA 3VH4A 3VC7A 2VHXA 4CM9D 3E48A 1LQTA 4R3NA 1LC3A 1TB4A 3MTGA 4PLGA 3OJOA 3C85A 1EQUA 5T5QA 4HNGA 4IS2A 3HDJA 5KJ6A 1GV1A 2DBVO 4XKJA 1M6WA 1ZMTA 1GD1O 3BYZA 4BNTA 2YW9A 3P19A 1HDCA 5HWSA 2E82A 1U28A 1QR6A 3PWSA 4NNJA 3RJ9A 2HMSA 1YBVA 2LDBA 3K9QO 4WEQA 3O03A 4J1NA 4BNGA 3QY9A 3UCFA 1GFSA 3EAGA 3WDSA 4FFPA 3Q0EA 4R1SA 3O26A 4HP8A 4J9UE 4R1TA 1GUFA 4YQYA 3CEAA 4CR6A 2RCYA 4B4UA 1ISHA 4I9NA 5LDGA 5JNLA 3D4NA 4DPLA 3E5RA 4GQAA 5HTOA 3JD4A 5COQA 3WS7A 1DIRA 3GVHA 5B4VA 3AM5A 1GPJA 3DO5A 2FSSA 1NWCA 2VYVA 3DBVO 3CMCO 1NAIA 4BMNA 4IINA 5AXBA 4EEXA 3K96A 3F1KA 2FZEA 3F5SA 1E0DA 3AM4A 5AXDA 5AQ1A 3SLGA 2OBNA 1NYTA 1G0OA 1ZZEA 2W2KA 3D5TA 4GGOA 4Q3CA 2Q45A 4BHTA 4J1QA 1P0CA 4A73A 4J16A 1QXSA 1H2HA 4RO0A 4L75A 2WYUA 4I5FA 3ZCXA 1KBZA 4N5MA 1P1KA 3I6IA 2ZK7A 4ZA2A 3U4DA 1MFPA 1YQDA 2H9IA 1P1IA 4QO8A 3K6JA 5L7TA 5I9LA 5CDGA 3DZGA 3KSZO 4IXTA 5HS4A 1O0SA 1FK8A 3R3JA 2OUIA 4FBGA 2RIRA 2GRAA 3F4BA 3HG7A 1SEVA 4PVDA 2PZLA 5G4LA 4Z3KA 5HM8A 4XQ9A 1RM0A 2DLDA 5ENVA 3BTUA 1T24A 3DB2A 5LDHA 4RORA 3HJAA 3WTCA 2IXBA 4YACA 4IMPA 4CODB 1DC3A 3INRA 3IQDB 4DMLA 1JKJA 1UAYA 4P8RA 2I76A 1B14A 4O6VA 5K1SA 4KMSA 1S7CA 3F46A 1LLDA 3GGOA 3WJ7A 6ADHA 3QVOA 4FJ2A 5ITVA 1R6DA 3WWZA 4IJWA 3A06A 3KEQA 1E5LA 1EVYA 4HKTA 2GSDA 2PH3A 1HSZA 1DHTA 4BNZA 1SMKA 3OFSA 4MP3A 2J8ZA 4XQCA 4EEZA 2X7HA 3GR6A 5EMHA 1QLJA 2VN8A 1LC0A 4LGVA 3RAJA 3AI1A 5A4DA 4TZKA 1ISIA 1EBFA 1TI7A 2OOSA 3JQGA 5JPIA 4AJEA 4JJFA 4FN4A 3Q6IA 4MOWA 5EIOA 4IPTA 4GSLA 4NPCA 4IS3A 4HFJA 1PJTA 1PGNA 3RFXA 4J90A 4NJMB 4I5GA 4U8GA 1TVEA 4IIVA 5A5EA 4YTEA 4WNCA 1WDLA 2NTJA 2NWQA 1IE3A 1PL7A 3LVFO 3PDJA 1DHRA 2RH4A 4G65A 5T8KC 3L6EA 3DTYA 5F3RA 2GN9A 4J6FA 5IF3A 1ENYA 1J0XO 1F17A 1UH5A 3DHNA 3NDJA 4WCFB 1W4ZA 3GOHA 3ZWMA 2UYYA 1BMDA 4S1VA 3IKVA 4I5DA 3WGGA 3I9JA 4FC7A 5L4SA 1YB1A 2YQ5A 4D3DA 4KDFA 3ZNQA 4KUGA 2CY0A 2PZKA 5L7WA 2CF6A 3OM9A 2Y66A 2PLAA 4BGIA 4DQUA 2PKQP 2XF8A 3L77A 3GZ4A 3L6DA 4Z9YA 5T67A 3T4XA 3U09A 4NDNE 3GGGA 5A1TA 4CV2A 1E7RA 1TLTA 3BHJA 4FCCA 1LDYA 5ITWA 1U3TA 4E33A 3HFGA 1E3IA 1Y8QA 3R0IA 2DVMA 4OJNA 2D8AA 4J0EA 3STHA 4HWKA 5COBA 4HUJA 1ONPA 5BR7A 1XA0A 2O3UA 4R5HA 1BXGB 2BGLA 4I5EA 1IPEA 5GMOA 4EUEA 4IDAA 1VE9A 2HMVA 2VZ8A 5F5NA 1WDKA 3ICPA 4IXWA 4OXKA 1V35A 5KJFA 3TF5A 3Q9UA 5F1PA 3SJ7A 3ASUA 3WGZA 2ZTVA 2NU7A 1HE3A 5IDQA 3PEFA 3ENKA 4D46A 4LW8A 3LYLA 4JN6B 5TSDA 1V3TA 3C1AA 3I3OA 4W9NC 3PIIA 2P4HX 4QO7A 1SCUA 2QRLA 2B36A 2R00C 3ZV4A 4LMPA 1ZCJA 4B4VA 2C54A 4M87A 3PJDA 1CEQA 1PJSA 2GN8A 4R54A 1ISJA 3LT4A 1JTVA 1X15A 3B70A 5TC4A 1M67A 1OFGA 2HO5A 2IYOA 4MIOA 3H9QA 2OL4A 2F00A 3FHLA 3OECA 2EP5A 4XDZA 1CETA 3V1YA 2DTXA 4C4OA 3UF0A 4IDFA 2YDXA 5T6BA 3WQSB 4ND2A 5TNXA 2Q1TA 3GPDG 5JAZA 2H1SA 3CIFA 1LLCA 3FBGA 3P2YA 4UEOA 3HFSA 5I8ZA 1IZ0A 3TQHA 1VJ1A 2P4QA 3BMCB 4BVAA 4K26A 1Q2XA 3AUUA 5H81A 1ONNA 3AFNA 3DAFA 1CRWG 3VPGA 1BXZA 4TRMA 1V0JA 3NT2A 2NSDA 4O5OA 3H65A 1IB6A 4ZQHA 3LC7O 4AJ1A 2Q4EA 3U3XA 3O38A 3K5PA 3EVNA 2C29D 1LSJA 1LSOA 3MWDB 2AG5A 4IDCA 5JDIC 4D0RA 2UUPA 3JTMA 3A1NA 3H7AA 1LA2A 2YHIB 1E5QA 4FDAA 2QIOA 3GPIA 1AXEA 4M54A 1NWHA 2B4QA 2ZATA 3QVXA 5KJCA 1PL8A 2ZB7A 4NFSA 4CQLB 3ZDFA 4QXMA 3TWOA 4EJ0A 3ONDA 1RYEA 1X1EA 1ZIDA 1EDZA 4IY1A 4JCOA 4GBJA 4B7XA 1P1FA 4BKQA 4R3WA 5B12A 3U5TA 2AEJA 4BKPA 1HWYA 4AJ2A 2HSDA 1C0IA 3NX4A 2VT3A 4R9SA 3D4PA 4GMGA 4O63O 3LF2A 4DC1A 3C24A 1AN9A 4IQ0A 2Q4BA 4LK3A 4HFMA 1J49A 2PV7A 4F6LA 4UVDA 4ALIA 4E2YA 1XHLA 2R6JA 2Q2WA 3OETA 4WLNA 4WE3A 2GN4A 4RVFA 3WLEA 3DC2A 1LU9A 4J3FA 1GR0A 1WNTA 3ST7A 3V5NA 1LX6A 1Y81A 4U7WA 1SOVA 3VDRA 1GDHA 1PJLA 3C3XA 1B3RA 3FD8A 3NV9A 2Y68A 3FPCA 1B0AA 4Z6KA 3IJRA 4NBWA 4W6ZA 3H4VA 2Y0EA 2PTGA 5JAMA 1M76A 4XGIA 4UULA 3NRCA 4S3MA 3BMCA 1NR7A 1GCOA 5ILOA 4GWGA 4R69A 1O9BA 4JROA 4LSMA 4RPHA 4XRRA 5K9ZA 2D5AA 3JYPA 4J49A 5A5FA 4CUKA 1ULUA 1GADO 2G0TA 2YQ4A 3GDOA 5L45A 3H8VA 4CL3A 1H6BA 3E9QA 3BIOA 3KEOA 1ENOA 3AW9A 2YJZA 1JQBA 1DC6A 4U0KA 2EP7A 3G0OA 3K30A 2IEDA 5GY7A 2HK7A 3A9WA 1XU9A 3KM0A 3ZHZA 5TRTA 1ZH8A 3GNQA 1ID1A 3PGJA 3V1TC 1NP3A 3RC9A 4YWJA 4B7CA 4NJOA 1UR5A 3EZYA 3DOCA 5A9RA 3KTDA 1GL3A 3S8MA 2BELA 1A27A 4CQMB 2HMUA 3TFOA 1E3WA 3P7MA 4FFRA 1F8FA 4BGUA 4PLFA 2BHLA 3V2GA 1E1NA 1CF2O 4DGSA 4ROSA 5U9CA 3ANMA 4M89A 5DCWA 4KOAA 4R41A 3DWFA 4RVDA 2CVQA 4DBZA 3JQBA 3BXXA 5AYVA 3IKTA 4C7JA 3PYMA 4HFNA 2I6TA 5FFFA 2IXAA 2I67A 4EJ6A 3RU9A 2D59A 3GZNA 2BMAA 4ZD6A 3CSDA 3QWBA 1DRVA 5TIIA 1QMGA 4E5KA 4RF4A 2E37A 1PJQA 2ZKLA 4Z9XA 1PJBA 3VVBA 3BTVA 3EK2A 3OSUA 4DBVO 2ZJ0A 4MVJM 2NQ8A 3PYXA 1N7HA 5A9TA 3FRJA 1PWZA 3E8XA 1I24A 1XLTA 4BMVA 5KVCA 3ROPA 1A5ZA 4W82A 1I33A 3BMOB 5EERA 4EI2A 4LVCA 4P4NA 4W9NA 1CERA 4BNXA 2O7QA 4ZICA 3VPFA 1YQXA 4NBUA 5THQA 2R00A 1FDSA 1VLLA 4Z0HO 4GWKA 1P77A 3BMQA 3KSDO 2IODA 1D3AA 2V7PA 4A2CA 4D42A 3BMNB 2O2SA 4YB8A 5CPFA 5JDCC 3ZV6A 4WLFA 4FQ8A 3GRKA 1CJCA 2FZWA 1RJWA 3LT0A 3Q9NA 3VTFA 1NQ5A 3HSKA 1KS9A 5AXAA 4BNKA 4FPXA 3PQDA 5C37A 3I9MA 3MZ0A 3GUYA 4UUPA 3RUCA 3BAZA 3GRPA 4YEDA 5ICSA 4LN1A 2EW2A 4PG8A 2C20A 3DMYA 3OQBA 4CMJA 1YRLA 1TEHA 3DBHA 3PQFA 4ZN6A 3NJ4A 4GAEA 4QX6A 3KXDA 4TWRA 1C0KA 1ZFNA 1XSEA 3WWYA 4ALMA 4NFHA 4HX5A 3U9LA 2Z1NA 2ZYGA 5HS6A 1P1HA 4II3A 4N5NA 4IJVA 4FJ0A 4GX0A 2CVZA 4TMFA 3RD5A 1B7GO 1PZHA 5EQFA 1M2WA 4IDDA 5IZCC 4NFYA 1HDXA 1A4IA 2QYSA 1K6IA 5DZSA 4CLOB 5TQVA 4RDHA 1E6UA 5JDIA 1WPQA 1DPGA 1ZEJA 1QORA 3H9EO 3K92A 3WR5A 3W4JA 4I1IA 1PS0A 4CMHA 1QV7A 3C7DB 4DWVA 5KCZA 2CDAA 5JSFA 1RYDA 4QFDA 2YUTA 3VDQA 3ZZNA 3PP8A 1YL5A 3FR7A 3ZI0A 1Y9AA 4J9VA 4CM5A 1H94A 4QUKA 3OA0A 1PGPA 4EUFA 2AW5A 5ILGA 3W6ZA 4B3JA 1DEHA 1VKNA 3DQPA 1YJQA 1UXJA 4UREA 4J4TA 4WEOA 2Q46A 4PG5A 4D0SA 1JVSA 2AE1A 1RM4A 3HZZA 5L9AA 1HSOA 2EIHA 3RUDA 4PLHA 1LEHA 3KYDA 3ITDA 2VWQA 4BNYA 2EEZA 4YXFA 1R4NA 3GAZA 3PWKA 1E7QA 3NGXA 4L76A 2C07A 2BFOA 1ADCA 1Q7CA 5DP2A 2BI7A 3RC7A 2B5WA 2Y93A 5G0VA 4D45A 2IEBA 4AJIA 4BV8A 1EUZA 1LBEA 5C5IA 4Q3AA 4UEKA 4YBZA 1B8UA 4H15A 3JD3A 2X9VA 3ZW9A 2O50A 4CLXA 3DBLA 4LCEA 2A9FA 1I3KA 4E4YA 1XCBA 3S2FA 1GYPA 2F1KA 3WSVA 5C7IO 5KVVA 4XQGA 4D7AA 1YKFA 3C8MA 1ADFA 3ZH2A 4BO2A 4CV1A 4PLYA 3GVPA 2WYVA 3K8ZA 5CDUA 4E2WA 4CQMD 1U1IA 3DZJA 3V8BA 4EZBA 1P9LA 4NK5A 5JS6A 2RHCA 4RVGA 1ZUD1 3HB5X 2NM0A 1YB5A 1KC1A 2Y1FA 1YQGA 3DEYX 2DPHA 1X0VA 1QSGA 1HTBA 3BZUA 2P68A 5BSHA 4AJKA 5ADHA 2HK8A 3MOGA 3PTZA 4UUNA 4WUVA 1CQJA 5LCXA 3RROA 4NH4A 1DLIA 1QRRA 3E6AA 5MGBA 1KVSA 1EUCA 1Y9EA 3FTPA 4FJ1A 4MKZA 3RUEA 1LDEA 3F47A 1MB4A 4J7UA 3SEFA 4BO1A 5I7FA 2W2KB 9LDBA 1R15A 3VKVA 3PHJA 4QTZA 3PZRA 5T57A 3JSAA 1PR9A 3GFGA 1PSDA 2ZTMA 3Q2IA 1QP8A 3WNQA 3GT0A 1ZSVA 3COSA 3WTBA 1BHSA 2BD0A 2OZPA 3ZV5A 2VZ9A 5JLAA 4E3ZA 6LDHA 4XYGA 1LNQA 1YE3A 1YO6A 4EYEA 3RCBA 2PD6A 4N18A 5TLSA 3DAPA 3PIDA 4JP2A 3PPIA 3UCXA 1Y8RA 1ADGA 2PKQO 3H5RA 4WLUA 2J3KA 1IOLA 1OC2A 4IMRA 5THKA 3HB4X 3KLPX 3LLSA 3MEQA 5TT0A 3H5AA 2C5EA 4A27A 3I9NA 3IIEA 5LC1A 1D7OA 4E21A 3ULKA 4PLZA 1IULA 2JFHA 1QYCA 3VH1A 1VSUA 4DMMA 4AL4A 4AJOA 4IUYA 4EJMA 3ETGA 2GERA 4P4GA 3GG2A 4AICA 3UUWA 4DC0A 4CM3A 1QLHA 4HY3A 4NBVA 4ALNA 1DFIA 1PZFA 4Y6SA 3SC6A 1FJHA 1MLDA 1J4AA 2Y1GA 2X5KO 4ILKA 3MJEA 4J4BA 3TZKA 3PHGA 4NBRA 4YCAA 7MDHA 3AY7A 4GKBA 2FOIA 1DAOA 4WK6A 2A92A 2FN7A 1XGKA 3I83A 3WYCA 3LSYA 5DCYA 1I01A 4DPMA 5JAIA 3W8DA 1ZSNA 3JQGB 2QZ9A 1XQ1A 5G0SA 3TNLA 2DPGA 5L4LA 1YVEI 3W4KA 4F45A 2VTDA 3E5MA 3QHAA 4PLTA 4WCFC 5CEEA 2D5CA 4BNHA 2IYPA 5DT9A 2X0JA 3HDYA 4I9HA 1PEDA 4YJFA 5K6AC 3I1JA 1N8KA 1SO8A 2JCXA 4A5OA 2ZCVA 1JU9A 1YWGO 3KYCA 4CMGA 1E1KA 3X2EA 3U4IA 3P2OA 2Q1SA 4MO2A 2WE8A 1E92A 3F1LA 4E2XA 1U5AA 4Z0PA 5F1OA 3OEWA 3E18A 1BTOA 1U8XX 2DTDA 4OO3A 3DMTA 2D4AA 4WLVA 4EGFA 1W6UA 3AUSA 1E77A 4YAEA 1HE2A 5BSEA 2NADA 3JD2A 4FGWA 2J5RA 4J1TA 4PLCA 3OJFA 4M1QA 4XIYA 3HN7A 1K6XA 4GLLA 3HN2A 2Y1OA 3MOIA 1F14A 1ULSA 2A4KA 4B4WA 5C7OO 3GEDA 3FF4A 3GHYA 3H9JA 1LI4A 1MP0A 1Y8QB 1EVJA 1TT7A 2Q2VA 1XU7A 3UVEA 1UZNA 5K0ZA 1QV6A 4FIZA 2AEMA 2VOJA 3WJAA 4YJGA 2VYND 1PJ4A 1PZEA 2Y1CA 4WOKA 1K5HA 1Z75A 1VKOA 3JQAA 3JQEA 4R4JA 1UAGA 2IE0A 4BO6A 1V3UA 1H9BA 1LLUA 3G3EA 2C2XA 1S6YA 2DBRA 3N7UA 1TA4A 3LZ6A 4YRBA 3IJPA 4KTTE 5F1KA 1D1TA 1DSSG 4BNFA 2A35A 5DN9A 2Y05A 5EINA 4ZVVA 1EK5A 4FC6A 4L4SA 3ZU4A 3UGKA 4N54A 1B3BA 4FFNA 2ZQZA 3UN1A 2BKAA 5B4TA 1N9GB 3C1OA 1NQAO 1DRUA 1GUYA 4FR5A 1OAAA 4MVJA 4PGFA 4RLSA 3OIDA 2G5CA 4AVYA 4BOYA 1NHGA 4JGBA 1GPDG 3L0DA 4RPLA 5KWEA 4LVUA 1KVQA 2X6TA 4INAA 3JQDA 2VYVD 3H6KA 4U5QA 1ZNQO 2NQTA 2X0RA 3O8QB 3DZFA 4CLRB 3DONA 3B1KA 3OEYA 3GN1A 2P2SA 1T2DA 1K0UA 3IMFA 1PU2A 4Q3NA 5ER6A 1KYQA 3INTA 4F46A 1A71A 4KZPA 2YYYA 4MVJE 1XIVA 4E0BA 1E3LA 1YH3A 1LUAA 3JD0A 3LK7A 4MPDA 5FF9A 5U4QA 2JAPA 1ZK4A 4MVJH 4YAGA 1N92A 1ONOA 1GQ2A 3HWRA 4IJKA 4YRDA 4CMBA 1A9ZA 4JQCA 4PVCA 3Q11A 1DOHA 1T2CA 2HDHA 1FMCA 1YB4A 5HA5A 4D44A 4NIMA 1U4OA 4UUOA 1WZIA 4UAGA 3WGIA 1MC4A 2EERA 3JQ7A 3OICA 1UZMA 5J23A 1O8CA 2TMDA 3RKRA 2X0NA 4L73A 4OOFA 1GY8A 4XX0A 1XR3A 4QSMA 5A02A 2GZ1A 4DRYA 2EW8A 3EDMA 2ZCUA 1DIGA 1Z7EA 4CPDA 4NBTA 5F5LA 1IYZA 4WOJA 4GVLA 1O94A 1Q0HA 1VRWA 5JO0A 1YBAA 3DFUA 1SZJG 1T2EA 1L7EA 3WFIA 4M8SA 3EHEA 3ZGYA 3PI7A 4ND4A 5I9MA 3C7AA 3GA0A 1WDMA 3LLVA 3MJSA 3RBXA 1JN0A 3U62A 3NJ8A 2UUOA 3UCEA 3NTOA 1AHHA 1GTMA 1N9GA 3EYWA 3TRIA 3AU8A 4A26A 4JK3A 1YGYA 3PRJA 1I10A 2LDXA 4O0LA 3LQFA 1F8GA 4UVHA 1PZGA 4FFMA 3EW7A 2HCTA 2PWZA 3A28A 3R1IA 4L74A 1L1FA 3QP9A 3ZWBA 3B6ZA 2D1YA 1E3EA 3IP1A 4GI2A 3AI2A 3O8QA 2BRUA 3DZIA 4CLRA 4IDGA 4J0FA 5CG1A 4H16A 2OO5A 3QVSA 2WDZA 3ZV3A 1KEWA 2HMWA 1BW9A 1YOVA 3LU1A 4OXNA 2DM6A 4WASA 4MVJD 3LC1O 4L9RA 4GX2A 3I9LA 1OI7A 2PGLA 4PG6A 5CPBA 3WBFA 2P9EA 1PIWA 3K31A 2C7VA 4RPKA 1F06A 4K6CA 3C7CB 2QZZA 2WJPA 5ENDA 2RHRA 3DFZA 1N7GA 4BNWA 5BQFA 2V6BA 1RKXA 2VZ0A 3QIVA 3FPLA 3ZWPA 2WSBA 4IDEA 4JXKA 3TN7A 4AJ4A 4ID9A 3ZW8A 4GX5A 1L7DA 3JD1A 4Q39A 4RF3A 4E5PA 3VZRA 2GUGA 2CUKA 1MGOA 2ZTUA 1ENZA 4FFOA 3WYBA 4BMSA 1MV8A 4LRSB 5A3VA 4BV9A 4YYZA 3SC4A 1VM6A 2IZ1A 4CM4A 1W8DA 5DULA 5KKAA 4BKRA 2VHZA 3SJUA 1TT5A 2CZCA 2UVDA 2FR0A 1DFGA 5DP1A 4KQXA 2BFAA 3NAQA 4L4XA 1G6KA 3H3JA 4PZEA 3QA9A 1I30A 3GEGA 3JQ6A 3RKUA 3JYQA 1E3WB 3VTZA 4P22A 4YAKA 2VNSA 3JYOA 4G2NA 4P38A 5CG2A 2GD1O 2W4QA 4I9UA 1PJ3A 2VHWA 1VI2A 1T2FA 4AJNA 1V9LA 5L3ZA 1ZXBA 1C3VA 5DNAA 4ZQGA 1I3LA 1Q7GA 5EESA 4WJZA 3KVOA 4BNJA 3ZU2A 4I8XA 5DF1A 3GZNB 2A94A 4YRAA 4YT4A 4BKUA 5CHEA 1M75A 2VCYA 3JQCA 2XPCA 4HBGA 4RZHA 4ND3A 4QT0A 2E6UX 4DYVA 1I5RA 2O4UX 2GCGA 3ZHYA 5JAQA 3PJEA 3JCZA 2ZJ1A 4Z3DA 1Z74A 4CM8A 1F12A 3JQ9C 4M86A 4CJXA 1UP7A 3WFJA 3WX0A 4QFCA 1QYWA 3DOJA 2PGJA 5KVQA 3VPHA 1M66A 1R0LA 1W73A 4BQRA 3JQFC 2E4AA 5G0WA 1R4MB 2O48X 2JFFA 2Z95A 3D4OA 3UXYA 3RUAA 2AE2A 4HFRA 4XEHA 3TFQA 2JD0A 3BMQB 3T7EA 5IZ4A 1T4BA 2PGDA 4IBOA 5ER9A 5T8KA 2G76A 2GGSA 1WMBA 1ZXLA 2J5KA 1UUFA 4R5MA 1E1LA 1ORRA 1NBOA 2HJRA 1ISFA 1V8BA 2FR8A 4CV0A 2X22A 5JY6A 4D79A 3AOEC 4TSKA 3ZNPA 2DFDA 1FXSA 2CDCA 3H9GA 1KY5A 2JKVA 2ZB3A 3EGOA 3ITKA 3ZHXA 4HXYA 2IDZA 3CH6A 1Y1PA 2PZMA 4DPKA 4WECA 4ALLA 4DTIA 5JCJA 2YY7A 3VPSA 3LF1A 4E12A 5H82A 3TOXA 3DBHB 2B0JA 3VOSA 4II2A 1EMDA 1UP4A 3AY3A 3ASVA 1U7TA 1Q1NA 4J2OA 2ZQYA 3RSHA 4DREA 2EF1A 2EXXA 1BDMA 3DZHA 2VWHA 1PQPA 2DUUA 1BG6A 1MA0A 4GKVA 5G0TA 3NDIA 3AUAA 3WIEA 3NT4A 4MIYA 3IUSA 2D0IA 4XJTA 4AJPA 2XXBA 4OKNA 2O3RA 2O3QA 1P44A 1D1SA 1Z73A 4OQYA 4OSPA 5FEUA 2VQ3A 2NVWA 3PQEA 2J3JA 1C0LA 3FBTA 4LISA 5B37A 1BGVA 1KEPA 4CV3A 5JMPA 3P5SA 2ZIZA 4NI5A 4PFJA 3D3WB 5AVOA 1K3TA 1R37A 4PN3A 1R4MA 4R1UA 4BNIA 4DL9A 5JY1A 1DB3A 3I4CA 1VL0A 5I7SA 3HDQA 2BFMA 2VRCA 2O2YA 3L07A 4TZTA 2WD7A 1R66A 2POQX 3T4EA 2RBEA 4ZQFA 5ES3A 1B16A 1MXFA 3OIGA 3AJRA 1C14A 2AEFA 2JHFA 2J5QA 3EUWA 5EPOA 1AXGA 1AUPA 4R51A 3HHPA 3KYDB 2CNBA 5KOIA 3FNGA 1XELA 3Q2KA 2WYWA 2C7GA 1R4NB 4KUEA 3M6IA 1T4DA 5FI5A 4XGKA 4OL9A 3EC7A 3PHIA 4BGVA 5ICMA 1CYDA 4J43A 4WLEA 4BO3A 3ONFA 2VWGA 2AMFA 2BF7A 2PFGA 4ZRNA 2WE7A 1R0KA 1ZK1A 3NEPX 3OQ6A 5AXCA 4E30A 3ZWWA 5IFLA 1GQYA 3DBLB 2O3JA 5IDXA 3DZKA 4W7IA 1XWFA 3GMDA 2W8ZA 2FPIA 2JCVA 2X86A 5L4NA 4ND5A 1JDJA 3VH3A 1VC2A 1J6UA 3H2SA 1M6HA 3CINA 3E9NA 4OQZA 4YQZA 1Y5MA 5G2OA 3RBZA 4CM7A 2PZJA 5A04A 2FP4A 1U3UA 3RVDA 1CWUA 2VT2A 2B4TO 3I5MA 1F0YA 4XYEA 5IXSA 4OGWA 2DT5A 1MFZA 3CUKA 5TT1A 1HETA 3RI3A 3QV1A 4J7CA 3K73O 2XAAA 3KOUA 3M1AA 1PTJA 4E5NA 3OQ1A 4YJHA 8LDHA 4RF5A 2BFPA 2GF2A 1BVRA 4CLDA 2JJYA 1P0FA 3TOZA 3L4SO 4WKGA 3OBBA 3ZWAA 4MP6A 4X54A 5JCXA 3NGLA 3ZWYA 4OKIA 2DUWA 3D3WA 3ONEA 2NU9A 4GVXA 4Q3DA 3ZWCA 1GCUA 4XR4A 1J5PA 4O59O 4Q3BA 3HADA 4ONEA 3F4LA 2YV2A 3D1LA 2DC1A 1OOEA 4XZ3A 2QRKA 1CQIA 4PLWA 4JBGA 3PJGA 1K89A 4YT5A 1KOLA 3QWAA 3JQ8B 2CD9A 3A14A 1P1RA 1IL0A 2P5YA 3GGPA 3WOHA 3S55A 2Q49A 1NX6A 1PJCA 2EHDA 3E82A 1HLDA 1KVRA 1BXKA 4OIMA 3U4CA 1NNUA 2EKLA 3GEMA 1LRJA 1NVTA 1YDEA 2P9GA 4MJLA 4EUHA 5IJZA 1FDWA 2J3IA 3D3EA 3JQ9A 2V65A 3ZWNA 4ALKA 2OHXA 4DIOA 1YXMA 2VRCD 2C59A 3QJ5A 1A7KA 2NV6A 1ISMA 4B4OA 1ARZA 3G79A 5CDTA 4URFA 1Y8RB 3TSCA 3PK0A 1E6WA 1LSSA 1B15A 3W8FA 1LXCA 3GVXA 4XYBA 1GU7A 1EE9A 1PGQA 4AJHA 3ZNOA 3TZHA 1GEEA 1ZO8A 3WG9A 4J2HA 4RQUA 3ZU3A 1NQTA 2HJSA 2I99A 1NQOA 3PXXA 3CZRA 1N5DA 3QW2A 1KEVA 4IZIA 4J4HA 3SLKA 4NK4A 2X0IA 4CUZA 4ALJA 3K2EA 3O4RA 4WCDA 1G0NA 4U6QA 1H9AA 4K9DA 3S1LA 1FDTA 4RGBA 3GAFA 4EW6A 1E7YA 2O3TA 1T26A 2YHUA 4B8ZA 1YJ8A 4Q3EA 1VL6A 3UKOA 3S2GA 1H2BA 1X7HA 1GUZA 4IIUA 4PZDA 1B26A 3IS3A 1UJMA 2GDZA 4OSOA 1WW8A 2Q2QA 1C0PA 2BH9A 1NPDA 4FB5A 4HV4A 2OP1A 3RQSA 3GDFA 4NZ9A 3G1TA 1ISGA 3HE3A 2YFQA 3GC6A 3R6DA 2ZB8A 3MJVA 3PDUA 1C1XA 2AA3A 3GFBA 1DJQA 3QWIA 3B1JA 3WGTA 1HYEA 3JQ8A 2VHYA 3TZQA 2B4RO 1GV0A 2G82A 1B2LA 1IZ9A 2Y99A 1NM5A 1WAMA 5TGDA 4PZCA 1DRWA 2GPTA 4YJFB 1PGJA 1Y6JA 2AG8A 5BNTA 3A4VA 5JO9A 3KSUA 5DBIA 1BSVA 3KYCB 3N58A 4CMAA 1P31A 1GYQA 1ZJZA 4RV9A 5JMWA 1QYDA 1BWSA 1ADBA 4D41A 5JYEA 2W2LA 1HEUA 2WD8A 3E1KA 3IDSA 5B1YA 1C1DB 5A05A 2JCYA 1CIVA 1E1MA 3ADOA 3ORFA 4IZHA 3RIHA 3GHHA 4UVEA 4E6PA 3AWDA 2UAGA 3GN2A 4XQEA 2B5VA 1T25A 2O23A 3S2IA 1DC4A 4BQPA 3PHLA 1NVMB 1JVBA 3PVZA 4CLHA 5L51A 2HQ1A 2E49A 2YV3A 3DOOA 1PQWA 4DLLA 2Y0CA 4FS3A 3QQPA 3BA1A 5JDCA 1SC6A 2DQ4A 3AI3A 4BNNA 2GNAA 1A7AA 3IC5A 3UICA 1JA9A 1DJNA 3LT1A 1XQ6A 2E48A 4H7PA 1N2SA 1O95A 4YJGB 4Z9FA 2AHRA 1VJTA 4DUPA 4B3HA 3JQAB 3ROQA 1LRLA 4OAQA 2HAEA 3GQVA 5GZ6A 2VNAA 3VH2A 3RUFA 3ADPA 1EFLA 1SNYA 1U8FO 2OP0A 2HUNA 5G4KA 3FI9A 4QQRA 1X13A 4MDHA 2O3SA 3VZPA 2B69A 2HU2A 3Q1LA 5TJ9A 1SAYA 4G5HA 1EEHA 1IHYA 2J3HA 4BO0A 1LDBA 5A03A 2G17A 1V3VA 5DBGA 3DBRA 3V1UA 2R2GA 3ICCA 3UHAA 1UXIA 3CTMA 4YVFA 2EWMA 4NMHA 1A72A 3OJEA 5BSFA 5IZCA 4CMIB 2QHXA 1X1TA 3T7CA 5JYDA 3AM3A 3U49A 4FW8A 3W1VA 2PY6A 1HYGA 1CDOA 3GNSA 4CMEC 1JWBB 2EGGA 3MWEB 2Q99A 2PD4A 4JJGA 1I3NA 4BO5A 4ZGWA 3MCVA 4QECA 4W7HA 2PKRA 1JAXA 4TRJA 2DBQA 3K2BA 3NDRA 5TF4A 4IQGA 1C1DA 4TRRA 3QWHA 4JIGA 3E9MA 1GYRA 2H6EA 4FD3A 5JC8A 1EBUA 3DHEA 4XD2A 4LMRA 3F3SA 4IQ8A 1EFKA 4BNLA 5I8WA 1SOWA 4PRLA 3D7LA 4DQXA 5EL0A 1ZK0A 2ET6A 3WLFA 2B35A 4CR7A 3FWNA 5GZ1A 2EJWA 3U4HA 1HZJA 3RFVA 2WTBA 4A0SA 3FSRA 3WSWA 4RLHA 4Q9NA 1A9YA 2Q3EA 2W2LD 3IL2A 2QYTA 2ZYDA 3WXBA 2JD2A 2W98A 3KB6A 3JQ7B 2YZ7A 1DBVO 3RC1A 4Y8VA 1HDRA 4YAIA 4BO8A 2DKNA 3AU9A 3TPCA 4DIBA 1HKUA 5TJHA 4Y6RA 4BO7A 1SBYA 5KJEA 1UP6A 2IZ0A 2XXJA 2FSVA 4LRTB 3QVWA 4MKXA 1HDOA 1FF9A 2VTEA 2P91A 4OH1A 1EDOA 4BIIA 4AG3A 4E32A 3FNHA 1WP4A 4A10A 4OMUA 1LTHR 4PLPA 2DTEA 2WMDA 1HYHA 4UVIA 3G49A 1HXHA 1Q0QA 3H9UA 4YDRA 3HNPA 4ZQBA 1E7SA 1RWBA 4W99A 4KDEA 4CMIA 3GF4A 1SEPA 2I5PO 3PZBA 3TDKA 4JP3A 5FWNA 3SBOA 4GH5A 2CF5A 4MVJI 4U0JA 2VWPA 1T1SA 4NG5A 4OHUA 2AQ8A 4XCVA 1XKQA 1AGNA 3PWZA 3ZWOA 4BS9A 2ZYAA 2FPPA 4K28A 5KTKA 4OYRA 1GZ3A 1BRMA 1P33A 3I6QA 5KIAA 3KV3O 3TZCA 4L0QA 4FGSA 1BW9B 1YOVB 2NLOA 2RH8A 3NTQA 4XGNA 3WMXA 3AK4A 1R0SA 4TRNA 4CL8A 4Y9DA 1E7MA 2Y1EA 2HRZA 3F6YA 2CMDA 3FNEA 4XA8A 3V2HA 3EVTA 1NHWA 4TVBA 3I23A 4KWHA 1FDVA 1EQ2A 3L4BC 3MJTA 4XB1A 5IN5A 4BO9A 2EGHA 2QX7A 4BUCA 4J7XA 2VUUA 3MJCA 3FTNA 3W4IA 1ZMOA 4Y98A 2YV1A 1R16A 1QYVA 4RPJA 2C2YA 1YS4A 3O9ZA 3WGYA 2HLPA 4BB6A 5KKCA 4R16A 4CM4B 1R12A 1SPXA 4GL4A 4HADA 3SXPA 1PS9A 1TT5B 5G0UA 3ROMA 4JLWA 1UDCA 3I9OA 4DLBA 3JQBC 2I66A 2Y1DA 2PA3A 1VL8A 3OP4A 4MVJF 4A03A 1ZK3A 3WQQA 4MINA 1I3MA 2B37A 4JX8A 4E13A 1LDMA 1UXHA 4IGEA 1ENPA 3JV7A 1T1RA 2BGMA 5A06A 3TJRA 1H93A 3JQAD 3RU7A 2Y67A 5IAAA 1EE2A 3FR8A 3G17A 2J6IA 4RF2A 3ON5A 4YJDA 3SVTA 1O5IA 1X7GA 5EJ2A 1HL3A 2GN6A 1IUKA 5KNLA 2I3GA 2GZ2A 3DR3A 3OMLA 3ZWVA 1E6EA 3UOGA 1Q0LA 4XJSA 3EMKA 3NYWA 1HE5A 4OXYA 1NASA 3PFWO 1ML3A 5C7LO 3I4FA 3LT2A 4DYDA 1I2BA 4PG7A 4PG4A 1ZBQA 4EITA 2BGKA 3OHSX 1OC4A 4NJMA 4DVJA 4CM8B 1ZSYA 1I2ZA 5HBRA 1Y5RA 1ZK2A 3D0OA 4IJUA 4JBHA 3DXFA 1NXQA 4R01A 2WM3A 1XYGA 2FMUA 4KUHA 1G1AA 1UDAA 1EK6A 2C0CA 3RBVA 4ND1A 4TQGA 4BB5A 4OOEA 4WCFA 2JL1A 4K1LA 1X7DA 4PLVA 4RVUA 4WGGA 1DC5A 5H83A 1A4UA 1K2WA 4FSHA 5K6AA 2QG4A 5DOZA 1JWAB 4PIVA 1Q7BA 2X1HA 5BNFA 4XWYA 3F5QA 4YAJA 4CMEA 4TKMA 1Z82A 1WZEA 2PH5A 5A9SB 4BGEA 4GPD1 4D43A 3GG9A 2YFHA 2VRBA 1IY8A 3GY0A 3PJFA 5CEFA 3RC2A 4B79A 1H6AA 2I9PA 4Y67A 3DAGA 3UAGA 4E2ZA 2UDPA 3DZBA 1GZ4A 4B3IA 4H3VA 2FRDA 2CVOA 1V6AA 3I52A 4UVGA 5COAA 2Q1UA 2IRWA 2B83A 4C7KA 3MJ4A 1YDWA 2NU8A 1BXGA 1LQUA 5IG2A 4OM8A 5AOVA 3UW3A 3QLJA 1P45A 2QW8A 4W4TA 1PS8A 3GVIA 4MP8A 1PR3A 1DXYA 3MTJA 4GX1A 3TL2A 3OH8A 2X5JO 2X8LA 1WMAA 3HUDA 1NPTO 4CLEA 4ZQEA 3CPSA 2DBZA 2BLLA 2GLXA 3QRWA 4PCVA 4DXHA 3KYBA 4ZJUA 1HDZA 1U9JA 4O1MA 1ZJYA 3QWFA 3R3SA 2V6MA 3VAZA 3QSGA 1U2GA 3JYLA 3H5NA 2NVBA 3DHYA 3DTTA 4MKRA 3EZLA 2AQHA 2CSUA 3BHIA 3KLMX 5C3MA 2X58A 4ITUA 2VOEA 4TROA 2HKIA 3GNTA 2Z5LA 2VUSA 4KQWA 1P3DA 4R1NA 5EQDA 1U7HA 5I7VA 4B7UA 1H6CA 3AUTA 4CR8A 4EBFA
chains in the Genus database with same CATH superfamily
1CBUA 3MT8A 2OFPA 4CNBA 2HMTA 4DDTA 4ZO9A 3IIMA 2I55A 3SM9A 1H0KA 3R77A 3SG0A 1GG2A 3OQMA 1QTQA 2OHFA 4O4LB 5A9SA 2QL7A 2A78A 3OCVA 4HLDA 4AUNA 4G26A 2IBTA 2FNAA 5DYYA 4LXTA 5JIBA 1SIWA 5F35A 4RFLA 4DCJA 1CUXA 4EARA 2ZBQA 4TMWA 3IVMA 1DO8A 1ZM4A 4X8MA 4CCYB 2G5GX 4DIFA 3G6KA 1KY4A 2QAJA 4JUAA 1GR1A 2WNSA 1PWHA 2DFVA 3FWYA 3IMCA 3RVOA 2CJPA 1GLVA 1MG0A 2QQ5A 1G8AA 2J7PD 1N1GA 4U3JA 5AVUA 3ODPA 1RQLA 5DXAA 5SYNA 2FWPA 2CDBA 4D4HA 2AMLA 1IN5A 3LRTA 3A1TA 3CUTA 3GPBA 1X2EA 1ID8A 3E22B 4MZDA 3LDHA 3LHKA 3HP7A 3B52X 3C97A 4A2WA 1KQFA 4Z4CA 3TL3A 3HJGA 3MQ4A 5ABPA 1SA0A 3OE5A 4NU5A 2ZBEA 3FCEA 1SU4A 3GRCA 2DPXA 5TX7A 5IHXA 1XTIA 1WZUA 4TUYF 4YA6A 3MFQA 3LHSA 1X1DA 3L9XA 2WEKA 3OG9A 1K6MA 4H0NA 4HDKB 4MGEA 5CDYA 4MWCA 3N74A 5T6MA 1BD4A 2WWRA 5HKOA 2XI4A 4JJKA 3ZGOA 1RQ2A 4MWTA 2EKPA 2YFKA 4F2DA 1HE4A 3K8YA 4DDVA 1P9OA 2BZSA 1P3Y1 4QHYA 3ETDA 3LPNA 3NO4A 1MC8A 5FUXA 4UNIA 5FPPA 1BFDA 3RS3A 5LZ7A 3PXGA 1FU4A 2XGSA 3ORSA 3T94A 3OPNA 5JC1A 2Y4OA 1ZVJA 4G4SO 3DYVA 4QBFA 4RHXA 1NPYA 4N5IX 5D3MA 2ZRDA 3H5WA 3NALA 4KODA 5B2FA 1FS5A 2IUYA 1NW9B 2IYQA 5M34A 1HLPA 2HUPA 4XAQA 2G3YA 2GZAA 4Q0MA 5D01A 1BDBA 2D2IA 1NR1A 1KI1A 1LBSA 1ITZA 1OKKD 3OIFA 5ALMA 3CF4A 5BR4A 5C9ZA 3KBOA 2CK3A 1U4SA 1CQIB 3G5TA 4C29A 3G7NA 4GDMA 2PX3A 4QNMA 4UPDA 3LP8A 4JR2A 2XMCA 3CNQS 2JFGA 3RUIA 4QDZA 3ES9A 3RADC 2CXPA 4UXHA 3B12A 1GPLA 3RUHA 1AG9A 5B3LA 1XL0A 4CKYA 4RVOA 5KJ1A 3SM3A 1NUQA 4MCIA 1GPAA 1T2AA 4KMOA 3U3JA 1T8UA 2JGMA 1P0IA 2IV7A 3KU1A 4C0AC 2JGRA 4ZDJA 1KEUA 5AI0A 2H5LA 3QVVA 3KRTA 3VYRB 4TPKA 2FWMX 3AF2A 1G5FA 4ZU3A 3BREA 4EG8A 2X9NA 3NONA 5L3SA 2Q3MA 3E22A 4B48A 3VPXA 1Z6ZA 2FB9A 1HFEL 3CKYA 3F8SA 3KB2A 3WMWA 1SVIA 2NU6B 3ZIAD 4ER7A 1EK1A 3DJFA 1R0CA 1AK9A 3BEDA 1ZKDA 4GOJA 4AQDA 3GJ8A 1BNCA 2C5GA 4ZTUB 3PFFA 1Z68A 2WWFA 1T9AA 4LY3A 3LMKA 4LCJA 3UYLA 4L07A 1VE3A 4YXWA 5DEIA 4C6TA 1XG5A 2BMDA 4Q19A 1ZD5A 2A8YA 3V8RA 2AUTA 4JLAA 4KTVE 3OQOA 6GPBA 2WHYA 1NYRA 1PL6A 1KYVA 1I2CA 3S5UA 3OA2A 4HQNA 5JAOA 4G0WA 1ZMRA 4OIFA 4G56A 1IK6A 2REQB 4EA6A 1DDOA 3ER8A 3O82A 4XB2A 1HLFA 4BUJA 3MCWA 2BCJQ 4LDRA 4RM2A 5B58T 4WDQA 2GEJA 2XGOA 3SQOA 2OMEA 3EY4A 4DRXB 4ZOLA 3PQ2A 4Q1AA 4AUEA 4EQ6B 2Q5EA 3FVTA 4YRJA 4NSNA 4UUMA 2J6CA 5TXGA 1EVZA 1EXWA 4R40A 1SR8A 4AY5A 4YT2A 3H2YA 1QHYA 5AVYA 5KTPA 2EKDA 2OBLA 4ZCPA 2C2BA 4DG9A 4LI3X 3KZVA 1UFQA 2AR9A 3MBOA 1JSZA 4HQKA 4J1SA 4LZOA 5CK5A 3T35A 5IXYA 2J5XA 2OM2A 4KFSA 5L8VA 1BJRE 1JSXA 4CF7A 1FNMA 4P82A 3SJZA 2RGWA 4HWPA 1QGDA 2AR7A 2FR1A 2X7JA 3CLRD 4PR3A 3C6BA 1R9MA 2JIZA 4UATA 1K1EA 3I45A 5DM2A 1RAAA 2GBCA 3KKZA 1RXVA 2CVPA 1RM5A 1CULC 3X2FA 3M3PA 4ZI7B 3BMOA 4MQ5A 1I0ZA 2B6NA 2NN3C 4FFWA 1LWNA 1XMSA 3TKAA 4AFNA 4D98A 1GUBA 4MCAA 3NVKI 1WVGA 3ETEA 4QQFA 4KLZA 3MMNA 1C7JA 3OSZA 4QU9A 3BJMA 4FYHA 4IIJB 4C7OA 1CDZA 1S1CA 3CR7A 4AWBA 3P0IA 5BWNA 4EM6A 3EUFA 3JQFA 3MJRA 2QJFA 2M6RA 3FWKA 2EKQA 3GK3A 4H6PA 5DDIP 2RCNA 4BFCA 1RAFA 2AXQA 2XW6A 2EFHB 2NU6A 4RZUA 2B1GA 2NP7A 3WL8A 1KJYA 3SIPA 3OT4A 3G5AA 4S2UA 3SC2A 5K0BA 4MDEA 3UT5B 1GAEO 1X0XA 4FEGA 2PWBA 1UXGA 3H9BA 3C4VA 4A9AA 2R47A 1HT0A 5FBKA 5FP0A 1KSJA 1TAGA 5B4UA 1D0IA 3ZZ0A 3RWBA 2W48A 1H6DA 1SY7A 4YMGA 1TQ8A 3LCMA 1NYQA 4ZHSA 1MC5A 2D5IA 2REBA 4H7DA 4MYUA 3KJZA 1TFUA 1M3SA 4C43A 1EX7A 1XQVA 4NYIQ 2ZRPA 2REQA 3AOEA 4PGMA 3VZQA 3ZDZB 1PQUA 2EP8A 4K5QA 3ORRA 3K0AA 4RTLA 1DO0A 3IP6A 1V2HE 3ABZA 1QTRA 2EATA 1KH2A 5ICFA 1J90A 1DIHA 3X2SA 4R2IA 5I48A 3HV0A 2BSAA 4DRXA 2XV1A 5CRIA 1ZJ6A 3F8WA 1YZVA 4JLVA 4XDYA 2PRZA 4DMCA 2XHZA 3NAGA 3HY6A 4PRKA 2NAPA 4XUDA 4EJSC 1NZJA 4AMUA 4UDNA 1I7QB 1GGHA 3U9SA 1L8OA 3E27A 3OJLA 2XWSA 4BVJA 3ZN2A 3M1IA 2DY1A 3S81A 1CY1A 2WIJA 4XQ9A 4K6FA 4UHCA 3U61B 1JLLA 2FLKA 2ILTA 3INGA 3MBKA 4TKLA 3ZD6A 2D06A 3TINA 4NHEA 2NUAA 3QITA 4L5JA 4B8WA 1A9RA 2OBYA 4COOA 1RM3A 3MWKA 3K0SA 4GMXA 4JASB 1PX2A 3DDNA 5DT2A 3CZMA 2AN1A 4CRWB 3BHMA 1J06A 3WMRA 1N1EA 4JOQA 2CLLB 3UAOA 3GRFA 1E3JA 2QE7A 3UM9A 3ORHA 2COKA 2PLFA 5FQNA 4D97A 1GRQA 5JV5A 4IIJA 1JEOA 1Y7TA 5K0GA 2RGDA 2NVOA 1H85A 1C3LA 2QX6A 1AGRA 1V5IA 2CFCA 1RQGA 5DHQA 1AK2A 5TMEA 3RFTA 2OXIA 4L8VA 4ZYLA 5DOVA 1FMJA 4DHEA 2I34A 1Y3CE 4ZOQI 4DKJA 4BRUA 1KFJB 3NOVA 2HWYA 3K0CA 3WGUA 2ZXEA 1DBQA 2QX8A 4H1HA 4JSTA 3M1LA 5HRUA 3WGOA 1PX0A 5JNRA 3RARA 3ZHCA 1T9HA 1UZLA 3BL5A 5T4EA 4RY0A 5B3JC 4QQKA 5C32A 4F12A 4NZOA 1NLFA 1RBQA 5AUQA 1N7JA 1DIAA 1N2CE 3F2VA 1KMQA 3KZCA 3IUPA 3UJAA 1PWEA 3MVEA 1LV8A 4BFUA 1SXJC 4N5DA 2ZJAA 3VC7A 1W2HA 4CM9D 4JIMA 5C52B 2QKYA 4PPFA 3RG2A 1LC3A 1VMDA 2YBEA 4IQFA 2ZIFA 4OQNA 4PLGA 4QU0A 3I2GA 2Z6VA 1EQUA 4LX0A 5T5QA 4IS2A 4YLYA 4UQPA 4UEQA 5C34B 4QDOA 5BV7A 1VHQA 2EGUA 3KZOA 3WYNA 2X2PA 2OHVA 3VOTA 2BEKA 5BPHA 3SI7A 3SSAA 3IE0A 1Z5OA 4I5IA 4YWHA 5BO5A 3E2MA 1U28A 2R65A 1U7DA 2HRDA 1DELA 3PWSA 4ZOBA 2QM3A 3KKEA 5FL7D 4WFIA 4NYJQ 3SK0A 3GLRA 3O03A 4NV0A 3U40A 2A7QA 4MX8A 3EAGA 3WDSA 3RRYA 2R8PA 3QPCA 4FFPA 3Q0EA 1RQ7A 4R1SA 5BRNA 4J9UE 1TC1A 2HOQA 2EARA 1GUFA 2YHAA 3QBDA 4YI3A 3RF7A 4CR6A 3VO8A 1SXHA 4P5EA 4B4UA 3VPBA 5AJYA 4U02A 4HRYA 4KE9A 5LDGA 3NRJA 1FNSA 4GPAA 4WUTA 4RH0A 5F12A 1W0JA 1KJ8A 4CIYA 1X8XA 1HT2E 1LBQA 4QM7A 1N3IA 1W47A 4QASA 3L0OA 1GG8A 4AXXA 3AM5A 1MAHA 3U3KA 1GZUA 4DM4A 3L7BA 1NAIA 3PKJA 5JMTA 4L6IA 4UHEA 5AXBA 5A4MS 3T1NA 1HMPA 1YR7A 2H65A 4I81A 3SLGA 4TMZA 1NYTA 2RAPA 2XYVA 4EYKA 4GGOA 1Q16A 2Q45A 4Q3CA 3UJDA 4J1QA 4BHTA 4F11A 4A73A 4ZXPA 5HHTA 1QXSA 4W7SA 5IF9A 3KJIA 3HK2A 4TZ6A 1X77A 2GKSA 3G6WA 4JLKA 2ODAA 4QO8A 2H9IA 3W5JA 1D6NA 3RC8A 5EQTA 1E5DA 1TIKA 2IQ5A 1EJ6A 4FDLA 1WVMA 4CF4A 3TLMA 3RT7A 1X1CA 4H1UA 2CJXA 1FK8A 4GRIA 2AJLI 5F4BA 1DS6A 2DQYA 2Q5JA 1EFCA 3CNEA 2X7XA 3MILA 4JEHA 4MQUA 2RARA 2AXPA 2IK8A 3HKBA 4BFVA 4M9RA 1Z6GA 2ZLBA 3IA7A 4TLLB 2H4YA 3THYB 4LTMA 2PZLA 1N0HA 2JLSA 4OKSA 2DWPA 1DQNA 1ZMXA 1RHJA 4V0QA 3REQA 1QG0A 3T7DA 3TGPA 3H0EA 1F7VA 1A8HA 4C78A 3QUCA 5A5VA 1JHUA 1MNQA 3HJAA 3WTCA 4ER5A 2ERYA 1CQZA 1UJ6A 2IXBA 4GE0A 5JBNA 3UPTA 1MQ9A 3OZBA 4X62B 1HV8A 2AOXA 5B1DA 3ET5A 1OV6A 1JLSA 1YOBA 4D56A 1IHOA 3U7RA 4IZOA 1WBJB 4P8RA 3CLKA 1KJJA 2BKXA 4P35A 2H2DA 1O95D 1QRUA 1F7UA 4TV8A 1M8JA 2A0FA 4KMSA 4M53A 3O4IA 1S7CA 4C4YA 3DVAB 2ZRJA 1I0LA 1JFLA 3IAM6 3OTHA 5CDUA 6ADHA 3QVOA 1P75A 5EIXA 3K05A 4KU4A 4P5DA 2P27A 5C8ZA 2QT0A 1E5LA 1O3YA 3AYZB 4FYMA 4YLEA 2GSDA 2V6JA 5E6SB 4BNZA 3DMRA 3OFSA 1Z0ZA 4XQCA 4FN5A 2VSNA 1KYTA 4UM9B 2VN8A 3NHLA 1VIMA 3RAJA 1XLUA 2EWWA 2NYAA 5CA1F 1ISIA 2BBTA 2OOSA 3JQGA 4KNYA 5DTEA 1QRSA 1KO1A 2HW8A 2WUVA 3Q6IA 4IPTA 1KH1A 5KNDH 3EEYA 1OVMA 1T0HB 3JU3A 1E89A 4HFJA 1PJTA 3H18A 4IS3A 4WT7A 2Y76A 3RFXA 1N1DA 1TD9A 2OHOA 1W4CA 1TVEA 1ODIA 3B9PA 2DF8A 1OLUB 2PCLA 4HWGA 3L6UA 2ZRLA 4WNCA 4PO3X 4HRVA 2UUBB 3HGQA 1IE3A 3EF3A 5THXA 1SKBA 4EG5A 3A1UA 3QPWA 4BAGA 3WB2A 1R6UA 1A04A 2H4WA 4P0TA 3SGLA 1PLLA 3NDJA 3ZZUA 5ANRB 2Z8ZA 1GP2A 3RO7A 5AW9A 4S1VA 1ISRA 1BMDA 1Z5PA 4EB6B 1O4WA 1UL1X 4FC7A 3WGGA 3I1FA 2IPAB 2YQ5A 1DZ3A 3A1VA 1QC5A 3K4QA 4KDFA 4XX1A 2ZSDA 3HGTA 3FGOA 5L3RA 1CUYA 1YCFA 2A57A 2RGUA 5IBRA 3RODA 3ACDA 5KSPA 1DADA 3HB9A 4TS4A 2Y66A 1B6TA 2OILA 3OO1A 4BC0A 2ZJ7A 3CPEA 5GIOE 3LPMA 4KFCA 1GSAA 1WXQA 2G1JA 4MRAA 4XCXA 3GEBA 1J7JA 4F60A 1CP2A 2ADOA 5A1TA 4TTTS 3LVQE 3NGMA 4CV2A 5I4IA 3BHJA 3HZHA 1G5HA 2CHQA 3R3HA 3UK1A 1WA5A 4D9EA 4ICIA 5A4IS 2QL5A 4J0EA 2NYUA 1QIIA 3L5OA 2HPVA 3K16A 5BOSA 4KR3A 2NZJA 2VDUE 2O3UA 4UNNA 3AETA 3O92A 2CUTA 2HXGA 2HU8A 2NO1A 3CRRA 4LBYA 4PNZA 2WR8A 4L4ZA 4DIEA 4JQOA 4DDWA 2O8EB 3EEFA 2D62A 4OY3A 5F5NA 4GSYA 3ZZ1A 2IWHA 3RS5A 3SSOA 4IXWA 1DCFA 3QE0A 4BMXA 4JVSB 4DAOA 5B58C 5E6SA 3Q9UA 2O2GA 5KJFA 1XZFA 4N76A 3AKCA 4J0GA 3CLRC 5F1PA 3N2GB 3GFVA 1JJ7A 1KY2A 2ZTVA 3M4ZA 2QVCA 2YICA 5KSYA 3ENKA 2JHAA 4ETWA 3IKMB 4EMUA 4D46A 1NF9A 4EDHA 1C9MA 3LYLA 1U0GA 1V3TA 3D7RA 1MH1A 1D2EA 4P83A 4OYYA 3C1AA 5BMVF 2XVMA 4XTCS 2V0GA 1APBA 3PNYA 5D3QA 2PMFA 1MEEA 1CLEA 4J0JA 4AG6A 4RVNA 2QRLA 3ZD7A 2RKWA 1W2WB 2GS9A 4QU5A 3PQ7A 3ZV4A 1ZCJA 3YASA 1OLUA 1IMJA 2H4FA 1CEQA 3OE1A 5DGHA 4DQLA 2FUEA 3LT4A 4ZVQA 4QVIA 2H51A 1OFGA 1Z34A 2BTOA 2GJSA 3IB3A 5ETJA 2YFYA 4MIOA 3V6LA 3IA2A 4ISCA 1O9HA 3QSYA 2OL4A 4J2TA 1YAJA 5AK4A 3A8TA 1QRTA 3Q5EA 4KGZA 4CTKA 4RMHA 1RYFA 3Q8KA 1TFRA 2R6ZA 5T6BA 1M2EA 3W3ZB 4MRNA 2ATCA 3PD0A 3ZJ5A 3GPDG 2GETA 1JPUA 2HQSA 3B1VA 1LLCA 1IZ8A 4UEOA 3FTDA 4D4JA 2Q8NA 1C3JA 4UHKA 1UDWA 1VOTA 3BMCB 4BVAA 1K97A 3I5XA 1SWWA 1R1DA 5AVVA 2EIXA 1KIAA 4HGRA 1Q2XA 3D81A 2C7QA 4B6SA 3UQYS 2W6ID 5F9MA 1KZGB 3EIOA 3NHAA 1SQSA 1BXZA 3U7QB 1NONA 1G20B 1LBHA 4QPDA 4JB8A 5ITZA 1QUEA 4O5OA 2NYVA 3QZUA 4EPWA 3EQ9A 1DGQA 3M6AA 1FW8A 5FH9A 4ZQHA 1F9EA 1EUDB 1HFJA 5KPJA 3FPAA 3LC7O 1Z4JA 2AJTA 3JVDA 5EE1A 3WLMA 5EIHA 4CFSA 3W5CA 2O8EA 3O38A 2FU5C 1ZUWA 3T7SA 2EDAA 4R83A 1DWUA 2HA7A 1LSJA 3MB8A 3TXAA 4XH9B 5JDIC 1RIFA 1VSTA 2PLNA 4D0RA 3JTMA 3GBVA 3W7BA 1CNFA 3H7AA 4GLFA 4YHHB 1E5QA 2QIOA 2WWXA 1AXEA 1S3GA 2FFBA 4Q9AA 4X1IB 3PHCA 4NFSA 3ZDFA 5DX8A 1IQ0A 5FNZA 1CY6A 1G6OA 3CWZA 1K3UB 2C99A 1GGNA 2V7VA 3L93A 1KZHA 4EJ0A 4Q9JA 2XZOA 1RYEA 4HF7A 1ICEA 4OLHA 3O3MB 4B85A 4GBJA 1K66A 4RIEA 1NMYA 1NVVR 3LLCA 3U5TA 2W2OA 4TMVA 4J7AA 1M5TA 1ZOOA 2AEJA 2DUNA 3IXMA 3MGBA 4IFTA 4LJLA 4BKPA 3NX4A 2VT3A 2I91A 4DC1A 3C7KA 2FFQA 4TGLA 1U7ZA 4N1AA 5H3CA 1M0EA 5K99A 1X1SA 2Q4BA 3MMSA 4HFMA 4DJAA 1G19A 1LLFA 2EVWX 3G2JA 1HMYA 2MSDB 4OHCA 5KTMA 4F6LA 4UVDA 4E2YA 4Q1CA 3T99A 4EJ2A 1FU8A 4HPWA 3W2FA 1XNRB 2GJ9A 1XCMA 1ZLXA 4KXYA 4WE3A 2GN4A 1WB5A 2Q5OA 2VLBA 2XNKA 1J1ZA 2H3HA 3HBNA 1WNTA 4GI1A 5CBPA 5IBPA 2GK3A 1XDDA 2GPNA 2Z2XA 4TV9A 1U2PA 4ZCSA 2Q5QA 4GP6A 3COWA 1G4AE 3QU5A 1RLUA 4C0SA 1HE8B 3FPCA 4JJZA 3B36A 2OVFA 1P2FA 3DS8A 3L46A 3QKRA 4UAVA 3X1WA 1YC5A 5IEBA 1QUFA 4F04A 4H1WA 1OA0A 2HF2A 3H4VA 4LOIA 2WNIA 3M70A 1M76A 3OZWA 4ZZIA 2Z9CA 4Q4AA 4PTZA 3I6YA 5E95A 3IBYA 3OCJA 3BMCA 3KC2A 1L4YA 2JBWA 2FJ0A 3IBGA 1GCOA 1O97D 3I09A 4IDNA 1O9BA 4JP5A 4R69A 1UQTA 1JUDA 4FGUA 4QZVA 1ZR2A 5DJ5A 5CFOA 1Y7IA 5A5FA 5LLDA 2YQ4A 1H1LA 3D8UA 3O31A 3H8VA 2F9LA 1H6BA 3HXPA 3IBSA 3BIOA 1XMPA 1ENOA 4CL3A 1DAMA 1SVSA 4YMVA 3ZLBA 1C9KA 2D74A 4FKZA 4ZVNA 4AF7A 4AMYA 1L7MA 1P9NA 1WOYA 4R31A 1ODJA 5GY7A 3TZEA 2SNIE 1UBGA 3ZJUA 1N8TA 3CWQA 1N7IA 2ZSAA 3KUDA 4K86A 1XU9A 1N3YA 1LS6A 1ORDA 1UJNA 3GNQA 2BDEA 1GITA 3N8HA 2V4UA 3DDSA 4ZU6X 1YQQA 5K0SA 4CHTA 3DOCA 4JOCA 4Z86A 3S8MA 4X1IA 1K8XB 3ITNA 8ABPA 1RPJA 3VI3B 1JSRA 1QVWA 1YRHA 3H6GA 4JSRA 1CS0B 1B6SA 1E3WA 3P7MA 1M0TA 4M0KA 3UJ7A 3MYYA 4EAQA 3E7FA 4BGUA 5HVNA 2BHLA 1GKUB 2QROA 1II0A 3D4LA 1EVEA 5SY6A 3RYHB 1SXPA 1UCFA 5D5QA 3DWFA 2CVQA 3AQIA 4DV3B 4QYMA 1ISPA 4ZOAA 4HQFA 4OM7A 1T8YA 5FTMA 4WESB 4C7JA 4WK0B 2PO7A 3P2MA 3PL5A 2ZI5A 1OLXB 4GO1A 2I67A 4PC1A 1NXVA 3RF6A 4C76A 4EJ6A 3RU9A 5J40A 1RXYA 3MUEA 3NPAA 5CYGA 4C4PA 5JARA 5KTYA 1V1RB 1Z08A 1G8FA 2P6OA 4JVOA 4BP9A 1KNXA 4E5KA 1QOZA 4R2JA 5FHQA 2HK6A 3EOZA 3OY7A 2AMYA 4C0LA 4TQ9A 4Z7NB 1ZUIA 2IHNA 2ID8A 1CUHA 1NULA 2UUAB 4WKBA 4MVJM 3WIVA 3NFRA 3SDBA 3LW8A 4QXRA 1N0WA 1L5LA 1H1DA 3GLUA 1FFSA 3FRJA 5IULC 1M5RA 1I24A 3WRXC 1EFPB 3ROPA 3ZWKA 5FTNA 1WSWA 1A5ZA 1RACA 3QU9A 2Z56A 2PXHA 1XKLA 5EERA 1ULTA 1CERA 4BNXA 1REQB 3U60B 3FMOB 3ECSA 1ISSA 4D9KA 5IT9A 2VAVA 4G1FA 4NBUA 5CT4A 5C80A 3QKSB 1KRWA 2PX5A 5EPEA 3P9IA 5F78A 1VLLA 1VIDA 4EX6A 1KI3A 2Q3LA 1LTQA 1Z25A 3ETJA 6Q21A 4HH1A 2CLSA 4S24A 1V3QE 2X1LA 2XQKA 4MROA 2QVBA 5T4HA 4QBKA 1OXSC 4UFOA 4A6EA 1X1QA 2WTEA 5DISB 4DWJA 1D3AA 2XQJA 3IBFA 2VEDA 3E9EA 2XLBA 3KTAA 4Y2JA 4D42A 3K7EA 3BMNB 4L0CA 1BHO1 3DO6A 4EWLA 3HB7A 4UEWA 4KACA 5LU9A 3K5IA 3CU5A 2OZLA 3MMXA 1HG0A 4ENTA 4V3BA 1NU6A 3MUNA 3BICA 4ZANA 3AKDA 2P40A 4B17A 4PRZA 2FRXA 1OTHA 4LX8A 4MUGA 4FPXA 4JBYA 5C37A 2JFZA 4UUPA 4PPNA 3KKLA 2PSFA 2XUPA 3GRPA 3KE9A 4NQRA 5ICSA 3K8OE 1JFRA 1SIUA 1GJRA 4MV4A 4ZT5A 3DMYA 2PWPA 3OZDA 1K86A 4CMJA 1YRLA 2PL9A 3Q40A 1W4LA 3KXDA 1NX9A 1NJGA 4HDRB 2DPMA 3GRYA 3R4VA 1GUDA 2CFSA 2QV0A 3VNBA 5EPUA 4OSEA 5LPNA 1TLLA 2P62A 2QLMA 5IYZF 2A1UB 4ALMA 4QLBA 2M6LA 1WXEA 1NW4A 1UKBA 2ZYGA 1GGEA 2G9NA 4BMPB 3OEHD 4FJ0A 4IJVA 5I4BA 2ZAOA 1UM8A 2EG5A 4H2DA 1XRQA 1Y6FA 1PZHA 5KYKA 1M2WA 3MA0A 4IDDA 5IZCC 3GGCA 2BZ1A 2BFDA 2FGJA 1EDDA 4RDHA 1CUUA 2RC5A 1CQPA 3OQPA 1WPQA 1DPGA 4MULA 3RABA 4AO7A 2EFCB 3H9EO 3K92A 4JVNA 4LRXA 4DMFA 1E0SA 3T3NA 1FXWA 1QV7A 1SKYB 3C7DB 5CH5A 1LFAA 1NXTA 1SC3A 1RYDA 1PN3A 2CDAA 1P73A 3AIKA 4PBTA 2ZYVX 2YJGA 4UMDA 3BVPA 3T6KA 4X97A 2DH5A 3FR7A 3TL6A 2VAPA 2VXCA 2C9DA 1Y9AA 2VJAA 4J9VA 4BZZA 4CM5A 1RAEA 1GQFA 1REQA 4FE4A 3TKYA 4MUHA 3CEMA 1ZM7A 2HIGA 3E58A 3JZDA 5EJEA 4DV1B 3BE4A 2C9YA 4LXHA 2WRZA 3U26A 5ILGA 3W6ZA 1J24A 1DEHA 1MW9X 1VKNA 1YJQA 3LI2A 1UXJA 2FUNB 1XZEA 2Q46A 4LHWA 4M37A 3E9RA 5CCDA 2LGJA 1UPTA 4PG5A 4D0SA 2C3PA 3JAKA 1UPBA 2E5FA 2CK3D 3EXEB 3V9PA 2EIHA 3V7YA 4L51A 2XTMA 3LCUA 1U0JA 2UZ3A 1KSGA 1I80A 3A26A 1I2AA 3ITDA 2BMJA 4QIHA 4YXFA 1R4NA 3GAZA 4LYJA 4R6WA 3TD6A 3V2IA 1E7QA 1F3OA 2ENWA 4D9GA 1MPTA 4L76A 1YU6A 1TZMA 4QXPA 2BFOA 3H1PA 4OHPA 5DP2A 3WNBA 5DM60 4UOEA 4X1KB 2IEBA 5ILQA 3V1KA 2IWRA 3VR6D 4PRYA 1FJ2A 3AFOA 3CE9A 4ZDWA 5I7AA 4Q3AA 2YIDA 4YBZA 4KR9A 1B8UA 4H15A 2E5LB 3JD3A 4XASA 1X3LA 5B3KA 3ZW9A 5M29A 2O50A 4CLXA 1XMOB 2O06A 3ANSA 2FX5A 4X6UA 1MJHA 3E9ZA 1VHJA 4GS5A 4MPRA 4AECA 1P72A 2G09A 4IGAA 1PNRA 3Q7RA 1KEEA 5IH7A 4AY6A 1I3KA 2RI1A 1FQKA 3F8TA 4FYJA 1CIJA 1R0YA 2QVGA 3MM4A 1J2UA 4EUKA 4PNEA 2X8WA 1NI3A 3DNFA 5C7IO 4XQGA 2F4VB 3C8MA 2A1UA 1SCJA 3ZH2A 2DE0X 1W35A 4PLYA 4OHWA 3GVPA 4BO2A 4FDVA 3KUUA 3V80A 1Q6YA 2V96A 4ZTBA 5JH7B 2GAFA 5AJWA 4MYTA 1KWKA 4YMWA 4CIWA 4LAFA 4YXWD 2OBMA 3LQYA 4M8LA 4H1TA 5IKOA 4B47A 1CKEA 4C2BA 4E5VA 1ZCFA 5LA6B 3SR4A 4OXXA 4EKNB 4ARCA 4F93B 3B48A 2VDQB 1EK2A 1YQWA 2RHCA 3D2LA 3ETHA 4IRUB 5ADVA 3DDOA 2NM0A 1KDYA 2VRWA 4Y2PA 3AR2A 2XDQA 2X42A 2YWJA 1KC1A 2WTXA 3UMVA 1Y7PA 1IEVA 4BJ1A 2CNLA 1L7RA 2V9PA 2WFLB 1W87A 1QSGA 2YZGA 1CE8B 3O7WA 4WXMA 4IW3B 4W8GA 1I1HA 4DJEC 1E99A 3TRDA 4I50F 3ELWA 2BDTA 3MOGA 1U3FA 3JAWB 2H1RA 2FV8A 1H05A 1DLIA 1QRRA 3FX2A 3IBTA 3PGKA 3CX6A 4NH4A 3RROA 1YKSA 1QGED 3RIMA 3GJRA 5MGBA 5CX1B 3FUXA 3FTPA 4DQDA 3FI0A 5BR8B 3RUEA 1LDEA 3T9BA 2G4LA 3K0HA 3SEFA 2F8TA 5EP3A 1WDWB 3KUKA 2FW1A 1OH7A 1EI9A 2J3LA 1Q0ZA 2HRRA 4QTZA 1K2VN 4R2LA 2GEBA 3UUEA 3GFGA 1TF2A 1QP8A 4ZZ3A 5EE9A 3HJFA 5DEOA 3PDIA 2H2HA 2F1IA 4PIMA 3OY2A 2QA5A 2VZ9A 3SDSA 4P31A 5DSZA 6LDHA 3ZU6A 1RT9A 4XYGA 1WQ4A 1RQXA 3EGXA 1YE3A 1Z7WA 1M1UA 2NZVG 1TTTA 4BQQA 5FUYA 2CLOB 4N18A 5TLSA 3IAXA 3OTWA 5CYPA 4N7BA 4Q7KA 3OAAD 3PPIA 4J94A 3O9VA 5AJTA 1G1MA 4GKAA 1EXNA 3KQKA 1R18A 4OGFA 4A23A 3ORYA 4EPRA 3KAKA 5ARBA 4TTPA 3FDJA 3IUYA 3LO5A 2P69A 4ZAYA 1QO0D 4LJYA 4I1UA 5FWYB 3H5AA 1CY8A 3A4LA 2ZB2A 3S2UA 2C5EA 4WKOA 1FSZA 3A6GA 5LC1A 1ATZA 4Q02A 4PLZA 3WLNA 9GPBA 1QIMA 5JCZA 5JAHA 2JFHA 3USCS 1QYCA 1P0PA 1VSUA 2G7MC 3CFYA 1BMTA 3TR5A 5FA8A 3SSMA 4AL4A 4Q9IA 4AJOA 1JEJA 2N3ZA 4YFYA 5BV8A 2DMRA 3SE0A 4D9JA 3T5DA 3GG2A 1GLGA 2V97A 4EKGA 4G3XA 3RSFA 4Z3KA 3P2IA 1M7HA 4NBVA 4P08A 1L4NA 3COPA 1PF7E 4MTLA 3T5MA 3ZQ4A 4AQYB 1DXHA 3TLZA 4OCZA 4P86A 4QBHA 1RKBA 3V4ZA 3BIWA 3G2OA 1J4AA 2WFLA 4TYNA 4OMCA 2DKOA 2WUDA 2ACKA 1CE8A 1K7SN 3DNMA 3TW0A 2D8MA 4M46A 1V16B 3K1AA 2XGMA 2ZYRA 3TZKA 1PKEA 2AX4A 4NBRA 1MQAA 3DUFB 3UGQA 5EJ9A 4EGAA 1HNWB 2CMGA 2Q3FA 2FN7A 2AKYA 3CV3A 2Z3WA 3I83A 3L4JA 1KO5A 3N2ZB 3WYCA 5DCYA 4QPCA 2X77A 1GL6A 3RSLA 2OG1A 3FJ1A 3UC5A 4JOSA 3W8DA 1QX4A 2LKCA 2CNOA 2O7RA 3CB4A 4MPTA 3JATA 4FNGA 2P9ZA 2JLWA 3U2QA 5FTJA 3W5AA 3H1TA 3TNLA 2XTZA 4TTSA 1N6NA 2P90A 4HLUC 4WCFC 3KG2A 1JECA 1C4OA 1SC9A 1E3DA 4BNHA 2BEWA 4CQNA 1PEDA 5K6AC 2MIIA 2RGNC 3IDQA 4AKSA 3KB1A 3ENVA 3I1JA 5FFNA 1BYUA 4A5OA 1ODCA 2Z58A 4RIGA 1U1FA 1NMSA 4AULA 1DCTA 5CITA 3ENZA 3P2OA 2ID9A 2Q1SA 3IQZA 4MO2A 4RANA 5DE3A 3L6BA 3QYPA 4QJIA 2XD4A 4MAFA 1A2OA 5IVKA 3OLZA 1SKUA 4O2AB 4ZK6A 2BH2A 2GCPA 3DMTA 1FFXA 2LWIA 4AMZA 4EGFA 4FWBA 4AJ9A 3GGSA 1C9EA 1YRQA 4HATA 3UBMA 4YX9A 3K6SA 4EVIA 1IONA 1Z39A 1PV1A 4UD6A 4ME6A 5CT6A 4ZVRA 5CCBA 4FGWA 2FWNA 2NUTB 2CT8A 4M1QA 2XSZD 3PQCA 1XI2A 3LUFA 4GLLA 3HN2A 3V4SA 3LCJA 1ULSA 2A4KA 2F62A 2YXEA 4UPEA 1LPPA 3GEDA 3QY0A 1W25A 3H9JA 1MP0A 3ADBA 1XTQA 3E23A 2A5LA 3C5HA 3ENWA 3OKCA 3EZXA 1UZNA 2IIPA 4TXHA 5CA0A 3HCCA 4DBLC 4RQAA 1W34A 2WTAA 4XSGA 4RCYA 1J0AA 2TMYA 5ECWA 3SR3A 3WJAA 1PJ4A 1PZEA 2CVHA 1E2BA 4NXNB 1TJNA 3DPIA 1R8JA 3JQEA 4LV5B 3GARA 4Q00A 1YZTA 1ACMA 4MGHA 2DFNA 3LGAA 2IE0A 1ZBDA 4R4JA 1AO3A 1QG4A 2IIVA 3ND9A 1GRCA 4V3CA 3JRNA 1PD0A 1V3UA 1H9BA 1LLUA 2OBFA 3G3EA 1V16A 2DBRA 5IHPA 1VTKA 2V0NA 2Z8YM 3FKSD 2DETA 3LZ6A 4TKVB 4GOKA 1UJBA 4AYXA 4BE9A 1BMFA 3QUBA 1J0CA 3A3PA 3O2SB 1U6KA 4O8CA 1XPOA 3RSQA 4QTTB 3R09A 1PNQA 1GU1A 2QUJA 1T9BA 3C2QA 1ZINA 1WUJS 1HR0B 1B3BA 1YB6A 4FFNA 1JQDA 1Y82A 2GCOB 2ACVA 4WKCA 3AESB 3FSJX 4MVJA 2Z6UA 1G8JA 3EMBA 3GFSA 2Y2VA 3KJGA 3OIDA 3FG9A 3L8ZA 2REXB 3H05A 1NHGA 4OMFG 4R9UC 1GPDG 2MMGA 5KWEA 5KNCA 1QWSA 1PLJA 4EKDA 3MWEA 3RSSA 3OU7A 3MGAA 4Q3LA 2NQTA 3L84A 5ENZA 4DJ5X 4EO4A 1FW6A 3S40A 3L7JA 3MWYW 4U2BA 2WIDA 1QWOA 3DZFA 4NOLA 2FZCA 3PR3A 4UBJA 3QKTA 4G5FA 4YRCA 3MLBA 3BRWD 1T2DA 3IJEB 2GZSA 4HVAA 5ER6A 1KYQA 1SKMA 3INTA 3V8QA 4A15A 2H1OA 2PZBA 1NVFA 4FDUA 1A71A 2CLMB 1Z0AA 3N2YA 1VKHA 1SBNE 4LRWA 2YYYA 4E0BA 4FLMA 4DNFA 4Y3UA 3CX4A 5SZHB 1OZ0A 4RXTA 2CFRA 1YH3A 3JD0A 3G7UA 2NUTA 4NDAA 4HAUA 3CRZA 1ML4A 5FF9A 3VHQA 3PGMA 2BZ0A 5U4QA 2AFHA 4MVJH 1DARA 2P4SA 1QK4A 2FEKA 1Y6RA 1N92A 4FILA 4JL5A 3RRNA 4YRDA 2XYRA 3T8YA 3JVUA 1FYFA 4R1MA 3PC4A 3QBTA 1T2CA 1AZLA 1L4UA 4JD5A 3V32A 1NI4A 3EA0A 5KNCH 1U4OA 1K8RA 4OP2A 2ZUFA 3A4NA 4IHJB 5AKIA 3JQ7A 3N0VA 5EMJA 2ZBDA 3Q7IA 3CRNA 5J23A 1JDBC 1EVLA 1O8CA 3PDHA 4TSFD 1R74A 4L73A 4OOFA 2BMWA 5CUQA 4ZQIA 2QSUA 3RYCB 4QSMA 1Q83A 2C3OA 2GSWA 2GZ1A 3SYRA 2EW8A 4CPDA 1Z7EA 4DV0B 4NBTA 1NBIA 1IYZA 4B80A 2AZTA 4KSBA 3V33A 3GXBA 1VRWA 1O94A 1Q0HA 3K9CA 1G5IA 1MEJA 4GVLA 4S1PA 4ENWA 5K3OA 1L7EA 3WFIA 4EYOA 3ZGYA 4V2UA 3K70B 4ND4A 3Q9LA 1J1UA 2LCQA 3MJSA 4AY3A 4YJ2A 1X42A 3QXHA 1XRRA 4QQNA 4FD2A 4ZREA 1JN0A 2H1HA 4RE5A 5H4HA 3RBXA 3TQRA 2XDWA 3NTOA 3U62A 3UCEA 5KWIA 1GAXA 2C57A 4AP6A 2QWXA 1OTXA 1R8SA 3PUYA 3ZCVA 4A26A 4LYDA 3SZGA 3LIPA 1D2RA 4TXLA 1XA3A 2LDXA 2XX3A 3MK31 1RWMA 4HAZA 2OKCA 3V4LA 4BWYA 2QLLA 3DLPX 1OFTA 4UVHA 1NW6A 1JPJA 1PZGA 2Q8PA 4FFMA 1XOIA 2QMEA 3PVSA 4L74A 3HHEA 3R1IA 5ELMA 5FPHA 4LKRA 3ZWBA 3B6ZA 1ECLA 4L3WA 5IVPA 5KKNB 1F4PA 2I1QA 4HDAA 4Y2GA 2BRUA 2XKAA 4EJFA 4EPXA 1EYZA 2VHQA 3QI2A 4J0FA 5CG1A 2E55A 2OO5A 4TQUS 3KAQA 4ER6A 3QVSA 3X3HA 1KHHA 1GNRA 1GG5A 2HMWA 4LOLA 1YOVA 3RTDA 4KL8S 1NKTA 4OXNA 1D5CA 3UHFA 4WASA 5LQNA 3PEWA 1CY7A 3FF1A 4L9RA 1V2GA 3M6UA 2GN0A 4DUGD 2PGLA 3DR5A 4DA0A 3X1JA 1PIWA 2GBIA 4YCJA 3HYCA 3C7CB 1HRKA 3DFZA 3GRAA 5DHPA 4EG0A 1RU3A 4UU8A 4OI2A 4AJ4A 4IDEA 1QHHA 4JXKA 4OHZA 3S70A 4MPPA 3JD1A 4IHJA 3GWGA 1V95A 1N2IA 3TTUA 3OLQA 3FFWA 2D2XA 4DLTA 1QQAA 3VZRA 4OQEA 3EQ8A 2ECOA 4F4DA 1ENZA 1XVAA 4PBSA 5AW3A 4RA9A 4BMSA 1MV8A 3GUZA 3ADDA 5A3VA 4EW1A 1PZNA 2JIDA 2J41A 3GJ0A 5G41A 4HZUB 3SC4A 2IZ1A 1X8JA 4BKRA 4JFAA 2ZI4A 5KKAA 4W5OA 4G0XA 4HB2A 2AN9A 3Q0IA 5TGZA 3RVBA 1D2NA 1V9SA 5DP1A 3ZE9A 5CFMA 2BFAA 3RS4A 4EI9A 3R3WA 4R1OA 3NTXA 1ZH4A 2R6AA 3GEGA 3ANTA 4L7QA 3VTZA 4ITVA 2F3SA 5JD5A 2VNSA 4MWBA 4LXUA 3BPSA 4ZAZA 5CG2A 3WLQA 2ONKA 2W4QA 3W5BA 2YASA 1PJ3A 2DJ5A 2WJGA 4C5AA 5CDHA 4PAGA 5HG0A 4GOOD 1W6RA 2O07A 1DU4A 4LRUA 3VR5D 4NBLA