4DDHA

Pantothenate synthetase in complex with 6-methoxy-1-benzofuran-3-yl acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
molecule keywords Pantothenate synthetase
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddhA01
2X3FA 3FDXA 1O96A 4ZT7A 4JXXA 5HUJA 1G59A 2IELA 1XNGA 4NATA 3CVVA 2DXIA 1QNFA 1TEZA 4MUHA 5F23A 2PZ8A 5LLTA 1LW7A 2EJCA 2CSXA 3H97A 1O96B 2CYCA 1N3LA 1TFUA 1HYBA 2QTMA 4I6EA 2EL7A 3DLAA 1NUPA 4I6JA 2Z3VA 1O6BA 3HL4A 1GAXA 1T9GR 1NUTA 5J58A 1M8FA 2QUKA 3Q12A 4CDNA 4ZCQA 3COZA 4A91A 3SZGA 1MB9A 1F7UA 4KKVA 3NBKA 4NAUA 4K0RA 1QTQA 4MVWA 1N2BA 1IQRA 1FYDA 1N75A 5TEWA 2QUIA 1J21A 1N2HA 5AHWA 2E89A 1QU3A 4MQ6A 3ZXSA 3E27A 1Q15A 2IJGX 5TGTA 1WY5A 2JAXA 3G5AA 3RHSA 1O95C 2DPLA 2WSIA 3CA8A 3CLRC 1D2RA 3H9BA 2QUJA 3N9IA 1U7XA 1NP7A 1TYCA 1K97A 1OBHA 1VBNA 3CLUC 3KT3A 4WSOA 5KHAA 2O8VA 3AG6A 1KH3A 5K0SA 2RD2A 1QRTA 3UMVA 3COVA 4MUGA 2AZXA 1WQ3A 1J20A 4EG1A 2BTEA 4PBSA 1OWNA 3Q4GA 2XRZA 1N2JA 1OWMA 3MLAA 1X8XA 3PNBA 4R2MA 4AQ7A 3FOCA 5K0TA 4ZT3A 1ZUNA 2D5BA 4TS1A 4AS1A 2XRYA 3PNVA 1KORA 1N1DA 3S3TA 3X1JA 4HJXA 1EUQA 4JXZA 3G59A 5H7XA 4MW9A 3G6KA 2CT8A 2DUMA 1ZJWA 5DB4A 1YULA 4DJAA 3ND5A 1V47A 4PBTA 1DNPA 1OD6A 1G8FA 3ELBA 3IUEA 5DEOA 3SEQA 1Q77A 4BWVA 5IHXA 3DPIA 1Q19A 3SYTA 1QRSA 3MMXA 2J07A 1O94C 1N2EA 5J5AA 3IUBA 2YWBA 4G5YA 2J4DA 3TZEA 3UY4A 1WJGA 3TQOA 2QJOA 4ZT5A 4MVXA 1N2OA 3CVYA 1KQPA 2CV0A 3FNRA 2PIDA 4ZT4A 5FO0A 2AG6A 3PXUA 3LCJA 3C8ZA 2DR2A 1MB2A 3HMQA 1PG2A 3BL5A 1Y42X 3CLSC 4J75A 4XFDA 4G5FA 3KT6A 1YI8A 3P0IA 4MWBA 3IMEA 3HGMA 2X1LA 1NYLA 4MUJA 3NV7A 3ZIUA 3COWA 2HZ7A 1GTRA 4FZJA 1M8JA 2ZUEA 3M5WA 3LE8A 1OWPA 3FHJA 3TZLA 3F3MA 4F4HA 4MW5A 3UK2A 3CLTD 4EG8A 4MW4A 5LFAA 3H9CA 1JMVA 1R6TA 2A4MA 4ARCA 1WXIA 1U0BB 4P2BA 4G6ZA 1WXFA 2ZP1A 1I6KA 3K32A 4QRDA 4MUIA 1IHOA 1TYBE 1KKUA 4DDKA 2VXOA 3RK1A 1B6TA 3IVGA 1T6XA 3HZRA 2A7XA 1PFWA 1JIIA 1WKBA 3QE4A 2DLCX 4PBRA 1V8FA 4JZYA 1NZJA 1T9GS 1R6XA 4U63A 1ILEA 4MWEA 4YP6A 3JXEA 1ULHA 1OWLA 1JGTA 3N8HA 2OQ2A 1I2DA 1T6ZA 1KH2A 3IH5A 5FNZA 1WXGA 3IOCA 3VU8A 3ZJTA 4EFKA 1P7PA 4YBRA 1GTSA 1JIKA 4KR9A 4HJRA 2QTRA 1JILA 1IH8A 5IJXA 2AKEA 3RJZA 5DK4A 3FG9A 4KR7A 1MAUA 2PG3A 5TEVA 1VBMA 2R5WA 1A8HA 4HK4A 4MUKA 3IOBA 1KAQA 1M8PA 3K9WA 4DDHA 1S4MA 1QQTA 2Z09A 4MVYA 3A4IA 4MLPA 3GMIA 2CFOA 3ZXIA 1N77A 5HG0A 3OP1A 3CVXA 1H3NA 1K4MA 3ND7A 4X0EA 4YMIA 5FO1A 1R6UA 1K92A 1OWOA 3IDFA 2J08A 1GLNA 4GU5A 5HUHA 2JA2A 5BNZA 1WOYA 1MAWA 3FY4A 3ZJVA 2QUHA 4NX2A 1F9AA 4MW7A 2X1MA 1WXEA 2YXNA 2J09A 1QU2A 1N78A 3ILVA 4OUDA 3SEZA 3ND6A 2O5RA 3HFJA 3A05A 4ZCSA 1IQ0A 1VL2A 2E0IA 4QBTA 3X1MA 1N2IA 1VBKA 3MXTA 4OUDB 5KCMA 3SP1A 2I1LA 1NUUA 2A1TR 3X1KA 2QJTA 3FWKA 2A1TS 3TNJA 1SURA 1JEEA 3FH0A 2A1UA 2B7LA 1NSYA 1PG0A 3AKZA 1IVSA 3FI0A 1M83A 1JHDA 3TQIA 1PFVA 2GOYA 2NSYA 4MW0A 1QJCA 1FFYA 3PRHA 3IMCA 3AL0C 2IP1A 3D6UA 1EFVA 1GZUA 1JZQA 1J70A 2A1UB 4DNXA 2ZUFA 2E21A 3L92A 1Q11A 1WZ2A 4MW6A 2HMAA 2BYTA 1TYDE 1EFVB 1O0CA 1BS2A 4UZFA 1EFPA 4MW1A 1TYAE 1GPMA 3P52A 2GM3A 1UFVA 1EE1A 3U1VA 2TS1A 4MUEA 3CLSD 1O0BA 1O97D 1J1ZA 4L2IA 3H99A 3N05A 3CLTC 1M8GA 2RE8A 4U8HA 1NUSA 3A04A 1JIJA 3ZUGA 2WQ6A 2CYBA 4EG7A 3HV0A 1PFYA 5KWVA 5TS2A 4H3SA 4OJMX 3ISJA 3INNA 3IODA 4ND7A 2GKSA 4R0NA 4L2IB 2VTBA 1H3EA 1YIAA 3FETA 4NZPA 1EXDA 1U3CA 2WB2A 1J1UA 1KQNA 1U3DA 2DERA 2E18A 1I6MA 2VTBB 1OBCA 3TS1A 1LI5A 3ZJUA 2D54A 4XFJA 1LI7A 1F4LA 1KH1A 1JEDA 4ZCTA 3CR8A 4EF6A 4XSVA 3L93A 3QTBA 2DETA 2C5SA 2G36A 2PFSA 2PZBA 4DLPA 3PNYA 1CT9A 4ZCPA 4GRIA 1XNJA 1N2GA 4MAFA 4MUNA 4JYZA 4UZEA 1NURA 2H2AA 4I6GA 1KP2A 2NZ2A 2PZAA 3KT0A 4NDAA 1MRZA 4NAHA 3AG5A 3RBAA 1H3FA 2X0KA 1YUMA 1VLHA 1KR2A 1NI5A 2WQ7A 2A84A 4MUFA 3P0JA 4Q93A 1KAMA 4ZT6A 4ZCRA 4ZT2A 2CV1A 4KR6A 3MLBA 4RPIA 3CVUA 2Z08A 1KP3A 3N2YA 5J59A 1I6LA 3VRHA 1WXHA 1TQ8A 3P0HA 5EKDA 4U7JA 2DEUA 1H1TA 3GUZA 1MC1A 4E1AA 1EUYA 2HGZA 3CVWA 1IFXA 1O95D 3CLRD 1G8HA 2QJFA 4WNYA 1X6VA 3IOEA 3IVCA 3QTTA 1T6YA 2QTNA 4EG5A 1NUQA 3UOWA 4S1OA 5DASA 2V0GA 3CLUD 1QRUA 1IQUA 3IVXA 3I05A 3A2KA 4EGAA 3GLVA 4MVCA 1ZH6A 3KT8A 1M8KA 1EJ2A 1YUNA 3VGJA 3AFHA 3RK0A 3D6VA 4YP5A 3ZGZA 1ZH0A 2H29A 1XNHA 1U7DA 2J5BA 4CT0A 4ARIA 4KPUA 2V0CA 3NBAA 3COYA 4DDMA 1WQ4A 4PY2A 1IRXA 3IMGA 2YY5A 1J09A 4JFAA 1PFUA 1RQGA 4K03A 4EG3A 2D13A 3Q10A 4KPUB 1G8GA 4R2LA 3LOQA 2CUZA 4Q16A 1O5TA 1MOPA 4YP7A 1GN8A 4J76A 1JZSA 2YWCA 4RUKA 1M1ZA 3KFLA 3SDBA 1KQOA 4CQNA 4HPWA 3AIIA 4EG4A 1O94D 1MBZA 4F3RA 4MWCA 4DE5A 3RFFA 1K4KA 3DV2A 5JBNA 3MUEA 3SZ3A 1XJQA 4MULA 2PXHA 2OV4A 3DO8A 3H05A 2CYAA 1F7VA 1YIDA 4MWDA 3FIUA 4QREA 1EFPB 5LM3A 1O97C 4MW2A 4CDMA 3OTWA 1MJHA 5H16A 4EG6A 4ND6A 2A88A 2A86A 2JANA 3UC5A 2CV2A 1JECA 1COZA
chains in the Genus database with same CATH superfamily
1JLHA 5IKOA 3TEJA 3AOGA 4LX8A 4RCVA 2VRCD 2YWFA 1EHIA 5EMNA 3B6JA 4R8LA 2J59A 1JLKA 4HO1X 5DM1A 3LQ4A 5E7QA 5F7XA 2BGTA 3M9XA 4H6PA 1D9XA 2GF2A 1WM1A 1A3CA 2ZUVA 3H75A 3ZUPA 4HLDA 1IBRA 2XUZA 3C8DA 2OSBA 3FUUA 1PZNA 3K09C 3LPLA 4P81A 2ZRIA 1HDZA 4TZKA 3DE0X 4QBHA 3RIHA 3K30A 3S1LA 5JYBA 1SUBA 4MTLA 3O8CA 1KSFX 4RC9A 5K7SA 2FQXA 5HRAA 4O4LF 1DMRA 3V3KA 4DYHA 1V3TA 4CMGA 2O52A 1JEAA 2IZ5A 4WBXC 2RBGA 5I5GA 2F1KA 3HR7A 2NO1A 2ZBPA 5KTPA 1KYQA 1ISHA 4K26A 1RWXA 2QVXX 4BCCA 4YPOA 5EVCA 2YBDA 3VDQA 1NF9A 1OYYA 1Y5IA 2ZRAA 3IB3A 3ONFA 1P2DA 3V8MA 5IP5A 1FRNA 4D4JA 4TRNA 3LPMA 4B4DA 5B5SA 3UGQA 3QNMA 2IHKA 3A6LA 4RCZA 4MVWA 4YDRA 3L9XA 1N2BA 1FUYB 1SXJC 4YECA 4D0GA 1V0JA 1P5FA 1WV0A 2AL7A 2R66A 2YJNA 5CCXA 1JH9A 1TB4A 4MQ4A 4Q3KA 3AERB 4BO7A 1NXQA 4RM3A 4ETNA 2HA5A 1E1KA 1QS0A 4CF6A 3SR3A 5EWMB 4AL4A 1XTSA 1Y5NA 2GCOA 4JN6B 1X0VA 4JCCA 1A1SA 1FVHA 2R6JA 4ME6A 3GJ6A 2XQKA 3PNPA 4Q9JA 3PFIA 3D4LA 4UQOA 4UUAA 2RK3A 4Z9YA 2JLBA 5KYXB 4V1CB 1AB6A 3CZMA 1AD2A 1VBNA 2WAXA 3BD9A 5EEHA 4BJHB 4H0NA 4JZKA 1FK8A 2FRVA 3OEHD 5D8DA 2FJ0A 4GI7A 3RKSA 3VNBA 2CXUA 2FPIB 3T9CA 3EZGA 4D9FA 4N7BA 2BTEA 1PP4A 2BFDB 2CJPA 2CCJA 2Q9AA 4HNAA 4HZUB 4CU2A 2Q6IA 4KN6A 3GU3A 2AFRA 4HDCA 4TTQA 4UPDA 2G9ZA 2LCQA 4RY0A 5CJJA 1EZ4A 3LC0A 5E6RB 2A9QA 3N86A 4TS1A 3BGDA 5HS4A 2QLLA 2P9GA 2XRYA 1N1DA 4RELA 4S0XA 4B7UA 4F9FA 3A28A 4L0QA 3NXKA 3VHXB 1UP4A 2QE6A 4MW9A 1EFRA 1QO0A 1J0XO 5IDVA 4LWZA 3CUWA 1KFJB 1V47A 2CZQA 3A26A 2QOEA 4QGAA 3PFNA 3WGKA 3GA0A 4UUOA 3TE7A 2UYHA 3FYTA 1TVMA 3KQVA 4DMUB 1JDZA 2OLKA 3ER9A 4QGGA 4RFSB 1SBZA 5CVUA 3VPDA 4BWVA 4FWTA 2O8DB 2YN0A 5EXEA 1FVOA 1XMVA 4EL5A 3ETLA 1IIRA 2OKGA 4LVCA 1QRSA 5IJ0A 2FW7A 5A4AA 2XODA 4MYTA 5CT6A 5JBIA 3P0FA 4XDYA 1XKLA 2YWBA 3I5XA 1Z38A 3C2QA 2E37A 4HLUC 1KMNA 1WMEA 3ZHBA 1MVLA 2IYLD 4BECA 4ESHA 5CDSA 5FPKA 1R88A 4D45A 4B9AA 5CVVA 3E9NA 1GIAA 4JUIA 1U2DA 2OZEA 4YONB 2XUQA 1HWYA 4YEDA 5JZMA 3KYDB 2UZ4A 3VTAA 2G83A 2O9JA 1ZEMA 2IYFA 2WYIA 1UC9A 3KT6A 5AKGA 4JI1B 1QQ5A 1PLLA 1FDTA 2NLOA 2QTVA 3BILA 3GRVA 3NYWA 4DEXA 4WMLA 4NJEB 3DLBA 4F3CA 3JR3A 4YCBA 1M8JA 2NNWB 1IXSB 1BA3A 5AKEA 3LE8A 1ISGA 2BBSA 3LBIA 4GHWA 3JS5A 1P7WA 3IBFA 2GJ8A 4HWRA 1DAHA 4RK6A 1NAHA 5M5BA 4W5JA 4QARA 3ZHVA 2QN1A 3K2BA 2YHBA 1HYEA 3G1WA 4G1CA 2R8XA 4GKBA 3BFVA 3ABRB 3CTMA 1Z3IX 3H86A 3ZDCA 3W5HA 2I80A 3H9CA 3PUIA 4MVJM 2VJLA 3A1FA 4B85A 4POOA 2VYNA 4KI7A 4B45A 1Q74A 3FCXA 4ZI2A 5EHNA 2PJRA 2I2BA 3UJDA 2C92A 4UNPA 4ZO6A 4ED9A 3I9NA 1M34B 4LF6B 1JWAB 1LV7A 1VI6A 3M6FA 2CLFB 3WJ1A 3SJ7A 5FBQB 1FMJA 1UZUA 1B6TA 4ARZA 3UGKA 2WHYA 1GPLA 4BHRA 1RR6A 1WKBA 4JYAB 1PR3A 1GARA 1THMA 2PUJA 2AQHA 3E2MA 3DLCA 1UCFA 4Y1RB 1ELOA 2JBAA 3OO1A 5E6SA 4HXYA 4EECA 3TRJA 1T25A 3A3YA 4S1NA 1TTTA 2HU7A 4NV3A 3T54A 2BHNA 2W6JA 4EI9A 1EFAA 2J8ZA 2OV8A 2OQ2A 3AV3A 4HYQA 4EYSA 1T6ZA 5JXWA 4RO0A 2AN1A 2D1SA 5H9VA 4AJ2A 4U00A 2O0HA 1E2IA 1ZSVA 3QJGA 3E53A 3SY8A 5AVYA 4BQRA 2Z0MA 2WSBA 4B0PA 1JIKA 2IP4A 1NKTA 2UUOA 2EX0A 4KR9A 2IUUA 2VKTA 2HIAA 2YHAA 4HTFA 3URMA 2NAPA 2Y76A 3L7MA 4C4ZA 3F7NA 4ECAA 3AW8A 4H6WA 1OGJA 2WM2A 4YFYA 3PRKE 3V7NA 1OPXA 2R5WA 1HZJA 4MUKA 5KOJB 3L1JA 4HADA 5KYNA 1FA9A 4NV1A 4N3CA 2ZIAA 4QDZA 5IW8A 1TJ3A 4MVYA 1CP3A 2NZ8A 2XVZA 1QYIA 2YJ3A 2R8RA 4C07A 4LY3A 1J8DA 1XN1A 5KDDA 3TW8A 3N8NA 3FUWA 4ZIRB 4Y2GA 3DV9A 1WG8A 3AHHA 4K9QA 5BYJA 4UAJA 3I23A 2JK1A 2VYVA 4LVOA 2B1RA 4MHOA 5TC4A 4JQSA 5C4IA 2GZMA 2GT1A 1BSVA 1SU4A 1X94A 3ICOA 4HDMB 1SOWA 2J08A 2QN6A 4R51A 4P6VF 5HUHA 5KOIA 1WCYA 5BNZA 3PFCA 4YAJA 4XIFA 2Q9UA 5G0TA 2DTEA 4NVRA 4F5WA 3I0NA 4FEYA 1A82A 3DMFA 3FDFA 2EAUA 4GS5A 2BGLA 2I9PA 2OK7A 4RZSA 4BP3A 4W5TA 3MRTA 4FXPA 2XOKD 4B81A 1XMOB 3LQ2A 1GRNA 1T4GA 4LTDA 1MO6A 4WZ6A 3CNNA 1SCUA 2P1DA 5GADl 1REQA 3RROA 4URXR 3DVLA 1Z5ZA 4ZO9A 1A5SB 1HYGA 2ZANA 1R66A 3ZHCA 4HH3C 2JHPA 2BN4A 5PGMA 5BN4B 1EEHA 2CXTA 1HBJA 1ADCA 2E0IA 3HHEA 1CDOA 4BNTA 3GT4A 2JLRA 1XPJA 1RLIA 1VBKA 2ZUBA 3NB0A 2SCUA 2AOUA 3W34A 2IXBA 3LUBA 4HFMA 1M0EA 1SGWA 1K08A 4WV3A 2B2CA 3SP1A 5DDIP 4L73A 5F2KA 1BOOA 2WAOA 3RJMA 4MHTA 3ZCQA 4FYXA 4BGEA 2XQIA 1U63A 1H4TA 2O8EB 2EJWA 1T1RA 3OOSA 4RS4A 5JVDB 3G85A 3KQYA 3UCXA 3K8YA 4LPKA 3RNLA 4N9WA 1Z0UA 2LUOA 2RAUA 1QYDA 3PP8A 2CWDA 5BR1A 3ASUA 1USWA 3PRHA 4RMIA 3S99A 3Q7PA 2H9IA 5L53A 2IH5A 1K3TA 4TTVA 3DVSX 4YC7A 3C24A 1K7FB 1CLUA 4PTLA 1JYEA 1PJQA 1XALA 2ZRDA 1QCDA 3EDOA 3F46A 4KACA 4IHJA 4N8DA 4XX0A 2IBMA 4RV5A 3TQHA 1GITA 1LSJA 4C4TA 4LQCA 1CXZA 3DKRA 4GEGA 1EH5A 4RL6A 4FILA 1T91A 3DPSA 3PTZA 1BS2A 3DL0A 3W5DA 5CUQA 5EHZA 3BDAA 2UU9B 4OQDA 1KDPA 3WL4A 3KKNA 1NM5A 2DUUA 4RIGA 1F5NA 3AJEA 3G23A 5FAXA 4PSCA 3HLTA 4CGYA 4DSTA 2VLBA 5CCBA 1JKXA 4TV9B 1PRYA 1WSAA 3HCDA 4FCVA 5JISA 3ZGXA 1JT2A 1OGYA 4QA9A 3SYNA 1T43A 3OM1A 5ADVA 1HPLA 2Q1XA 1I2MA 2HF2A 4NARA 1K6JA 1XBTA 1DXYA 1JKIA 2FR0A 3TXAA 3ZDAA 3NIGB 3AQ4A 4I0WB 4EUNA 1C3OA 2OBMA 2PT6A 3ISJA 5KSPA 1EJBA 1E1QA 1Q3KA 2HCJB 4E32A 4AJHA 3NIDB 4IS3A 1QIIA 1W29A 4WEQA 3ZDFA 1ZMTA 1JHZA 1SHJA 1NBOA 2VH5R 2ZYVX 2H4FA 1ZG3A 4OIMA 5DE3A 4P93A 5K8IA 4LRSB 2DH6A 5DHTA 1R74A 4JXJA 4PZDA 5JC1A 4C7KA 1JDJA 4KWEA 2QSYA 4OQMA 3SJUA 4TLCA 4KIFA 3V4RA 1IBSA 3FYDA 1Z7BA 1Z6AA 1D0IA 4FGSA 3S70A 3FCYA 1L4UA 5CFRA 4IYJA 2NADA 1F4LA 3OWOA 4CMKA 2BBTA 3EZ2A 4M0DA 7AT1A 3N7AA 1CNEA 3AMVA 3CR8A 2IITA 4JUBA 5CH3A 5JAUA 1W47A 3K0CA 4X64B 3CE9A 3Q3CA 2OL4A 3IHWA 4LY9A 2ZSAA 3RHFA 2FZEA 2XHEA 2Z1NA 3MTAA 1D4FA 4EFMA 1MJ5A 4RA9B 4ZREA 4G0NA 1GPDG 4GF5A 1JPNA 3RSGA 3ZJ4A 2REQA 2CDAA 5EE1A 4BY9E 3AG5A 2VDKB 3OQJA 3R40A 2P2NA 2X0KA 3IEKA 2QM3A 3IEIA 1OFIA 3IQHX 5WRFA 1R4NB 1L7VC 1M1NB 2GX6A 1W2WB 3W8NA 2A84A 4MUFA 2EP5A 4V03A 1PNVA 2NSJA 4OKIA 1VKHA 4RVDA 4HBZA 2ECQA 3QMVA 4WNAA 3WNVA 5B2FA 2WTMA 5LQMA 1JLSA 1QGOA 2Z08A 4PYKA 1C9DB 4DKJA 1JG3A 4C2BA 5DTMA 5CFPA 4H7IA 4MXDA 4RBNA 1COWD 3LTEA 1A2BA 3SSOA 2JLZA 1DJLA 4O2BB 4G1MB 2DE0X 4XGRA 1NXOA 3SQDA 4DR1B 2BEJA 1FLNA 3OJ0A 4Q4AA 4FFDA 4CIWA 3ZD7A 4IJUA 1KNQA 1J2UA 2HU5A 4BUZA 2QPLA 4DV7B 2IUTA 1RADA 3HJGA 4D9CA 4QRHA 4WVFA 1G0NA 4R1SA 5K4GA 4JI8B 2R11A 5ETJA 4CV1A 1NL3A 2O7SA 1AHIA 3E0QA 3EODA 1E62A 2O4CA 1YS2X 2GQ0A 4O6VA 5CB0A 4M49A 1XYVA 1Z2AA 3OLQA 3OT4A 4ZOCA 4QQRA 1NOKA 2YYAA 1J8MF 1TUBA 3DMTA 3I9V1 3L4EA 3LV8A 2NOAA 4KRXA 3PNLA 1E4OA 4I5EA 4LNUB 5DIZA 2UXBB 1P1FA 1Z25A 1TF2A 2V6BA 3S7ZA 1IXKA 2GXQA 2R47A 4HQFA 3PFHA 4QLBA 2C9MA 5HTKA 1VPTA 2W2OA 2V0CA 1CZLA 3COYA 3FCOA 4LMBA 4RYDA 3UQYS 3I1JA 1IRXA 4BRSA 3OUTA 3DWFA 3KJEA 3GRKA 3K70D 3V8NA 1PFUA 1QRRA 1XZQA 2VAXA 3F9RA 5CEJA 3JRWA 1EWRA 3H11A 2XE4A 3H2SA 4RHEA 4UDXX 4FD2A 5IEBA 3WL3A 2PYDA 5JWOA 3QHQA 2XT6A 3QYAA 3V1MA 3W06A 2G0AA 3DW1X 2YZ2A 5H59A 1YK1A 4QFCA 5THKA 4JMLA 4UM9B 2AVDA 4ATNA 1M7GA 3EW7A 1XQVA 4JP2A 1KMHA 5A4IS 4RUKA 5DSTA 5JANA 4MLCA 5C9ZA 2AD1A 1GCAA 5BW0B 2V58A 1C9YA 4QNRA 3G0OA 4TQAA 4QOEA 3USES 3V8PA 4BTEA 4OHYA 4GZLA 4CQNA 4UEJA 1PE0A 1BXZA 2I2WA 3PSHA 3R44A 3QGMA 4O4LA 4OMUA 3GHYA 5LDDC 4JYBA 1VMEA 4ZYLA 1EUDB 2IPAB 5CDHA 3ULKA 1OI2A 2AOXA 1LDYA 1PVVA 3K2EA 4J0CA 2Z5VA 3ONEA 2PHZA 3A2NA 5CB4B 4DUGA 3SZ3A 1BZYA 2QZSA 1EX9A 2D00A 4MAMA 2ZJ0A 2PUTA 4HHEA 4MQBA 1FRZA 3EPLA 5A0FA 1PYGA 4Z8YA 2HK6A 2ADOA 1PLJA 3EDMA 5H68A 2VEDA 3UYLA 1E6MA 2JH8A 1T6NA 3QVSA 3RV4A 1K3FA 2EU8A 2JGEA 3HE3A 3PQDA 4B3MB 1TT5B 4KUGA 1L0BA 1E8DA 2PGAA 2JH9A 4B43A 1RHJA 1AHPA 3CXUA 5BYBA 5TQ0B 4NI5A 1YZ3A 3REQA 4JMPA 2ZQZA 2AZDA 4YREA 3WNQA 1ODSA 1QP4A 3L8DA 1QR2A 4EG6A 2EJBA 2QPOA 1JG1A 2VT2A 3BDVA 3N8KA 4GPEA 1MEEA 4ND6A 4OBWA 1J23A 3DR5A 3U39A 4A7PA 3D0OA 1FTQA 4X5OA 4W9NA 3R9WA 3WGUA 2FYTA 3OZUA 2JHAA 1GY8A 5JD5A 1E61A 4F6CA 4J4HA 2GXSA 5AKIA 4ZDWA 1KO7A 1GZ7A 1KZ9A 2HTFA 2JFGA 2HQOA 1M6NA 4YRSA 3U62A 4C22A 3ML1A 4PR3A 3PD1A 3QA3E 1DBPA 4NYIR 5BPFA 3G49A 2RAFA 3MT9A 2QMQA 1ZUHA 4LYDA 2X7XA 4LVNA 4TV8B 4A6PA 4NYMR 4FQ7A 3KQTA 1E7WA 4L9SA 1TT7A 1KIMA 5KQSA 5FWYB 2P4EA 1PR2A 2XVYA 4G0XA 3GRRA 3OPQA 2ETXA 1SZPA 3V4VB 4KJZA 1FDWA 1M8FA 4KFUA 4LX0A 1HG0A 3H0CA 3AWIA 4OMFG 1YJCA 2ZIXA 1U2GC 3T7RA 1W2HA 3NEJA 4MP8A 5AW4A 1EXVA 1DFHA 1E89A 3GUVA 1ZW1A 1C1YA 2DHQA 1P9LA 4X1IB 4A0QA 1SKYB 2A9VA 2HAEA 3NBKA 5GJVC 2QSUA 4FWIB 1NVAA 1LJLA 1PHRA 2NPIA 1C7RA 4H7FA 4XQEA 3GROA 3W6NA 3R8XA 3X1WA 4ZRNA 3EPHA 2BJVA 4CRWB 1C0KA 1YA8A 2DECA 2LKCA 2PTGA 3O26A 4IIYA 5I51A 2B9VA 3KR1A 4F60A 1RMYA 3VR2A 4F96A 4P0QB 5TGTA 1YJQA 1RM0A 4PCUA 5A05A 5IAEA 4BZXA 5EJ2A 4N48A 1JEQB 1T10A 1KO4A 2VDRB 3IAHA 4P5DA 2OBYA 3AF1A 3RUIA 4CXMA 1QRUA 1M1XB 3LUKA 3ZGVA 1WAMA 2Y77A 5ERXA 2AG8A 2H8GA 2YJ6A 4WSOA 1TU0A 2Q3MA 4IEFB 1SN7A 5DTEA 1QRTA 3W6PA 3D7SA 4OAPA 1GKIA 1L8LA 1WE2A 2ICAA 3FVVA 2GPNA 3IT0A 4UTZA 4EA9A 1XCJA 3CR7A 4D46A 3N0XA 1OWNA 1THTA 3ER6A 5GGXA 4WXPA 3VSDA 4ZI7F 3EGCA 5JXIA 4R2MA 2BFAA 2OAGA 3FOCA 4KG7A 2ZUWA 3UKOA 3W5SA 2FZ5A 1G2QA 3GJTA 3IBYA 1LC0A 2BAGA 2I6GA 3ZWNA 5JSUA 3GLGA 4HGQA 2XBLA 5IWAB 5HXAA 3QX3A 3KEOA 3D3NA 3AKEA 3FSJX 4JIGA 3ASZA 2G71A 5ITSA 2HF7A 1WIWA 3MWKA 4AKTA 2YWEA 4FNAA 3MWDA 3NH6A 3SDZA 1NI4B 4P4NA 1ITZA 3RVKA 1S7GA 4KVAA 4KQ1A 5K3FB 4F93B 1N5KA 2BH2A 3GJZA 2PKQP 3EQ2A 4JJ4A 5HQJA 3ZGNA 3HRKA 2HIMA 4CL8A 5K9ZA 1RRGA 5M04A 2EGUA 1TO6A 2MMGA 3EVCA 1H22A 4AIIA 2HI0A 4QFBA 3V32A 1P44A 2AFVA 4U8GA 4CETA 1G2PA 4OGKA 1DEAA 5GMOA 2F3QA 3NNNA 3EA5A 3CJQA 3HU5A 4S04A 2B8WA 1AV6A 4K9MA 2J0EA 4AURA 1M2HA 4NRDA 2J46A 3F5MA 2WA2A 1VGVA 3WKDA 1IULA 4MR9A 5M2QA 2CN1A 3NKLA 1XZKA 3MJDA 3TQOA 1GYRA 2OCIA 2BFMA 5I9SA 5C1OA 4IO0A 3IAUA 5JH7F 3CVYA 4YAFA 3DWEX 4U2EA 4F9GA 2PIDA 1J2JA 2HJVA 2XWSA 3GCXA 4BN5A 1ZVVA 3G5TA 1XD2A 3PT9A 1D2EA 4PRKA 2IGBA 3PXXA 5B3LA 2HC9A 2LIVA 2VQFB 1UZLA 3S2ZA 3LYUA 1L8AA 3LECA 3ECSA 3GRFA 4KE6A 3RVOA 3T4XA 4RD1A 3ZIUA 2HZ7A 5I6DA 5JJKA 3LWBA 1JDPA 1ZC3A 5GONF 5DFAA 2HEGA 4UHBA 3RFTA 3ZNPA 4BMZA 3HCWA 5JTUA 2WYHA 1UJ5A 2FZWA 3H4IA 4TS3A 3FHJA 4RZQA 3JAMA 2EP8A 3HP7A 4ZVRA 1OKKA 1MJGA 1T5OA 3MJEA 4HT3B 3AF3A 2ODNA 1YD7A 2DBQA 4HGZA 1Q12A 4MW5A 4NBSA 5CNKA 3WL8A 5E1DA 5K0LA 2Y0EA 4JELA 4PS0A 5DHAA 3UWSA 4WKBA 4I1VA 1V8DA 4ARCA 1L4NA 2PNJA 4P58A 1FFCA 4UBLA 5DMXA 5IDQA 4GBED 4UE3S 3D54D 4PC7A 3QEMB 5L3QA 3NANA 1V8ZA 3K0FA 4IIDA 2DTXA 1KKUA 1XX6A 1NU6A 2ZIFA 2FFQA 3EMBA 4LDQA 3C4VA 4KC0A 3KB1A 3WK9A 4HB4A 1TF5A 3TTVA 2YYYA 3AH8A 3RGWS 5HK9A 1Z9BA 1NQVA 2ORIA 3QPAA 3V4ZA 3T7EA 4FFRA 2HA3A 4J07A 4XB2A 4O33A 3BXOA 4OQPA 2WKPA 3LGAA 3P20A 4KPGA 1D4OA 1MQAA 2WSMA 4Q1VA 3VSCA 4G1VA 2B2NA 1P75A 4MS1B 1PSZA 5LYJB 2ATIA 4IIBA 4ACAA 1EUZA 2CXHA 2KYRA 1R0SA 2DWPA 3DF9A 4BX8A 4HMQA 4Y2TA 3D6AA 2HM7A 4HEA1 5FLKA 4QYSA 4ENSA 5HCIA 4YNBA 1U9CA 2O1WA 4YBRA 3L40A 3M3DA 3OQMA 4DLBA 2VDLB 3E8XA 1PSDA 5K3BA 3AUKA 4DAOA 1A9XA 1VJ0A 4N18A 3TVYA 2NYAA 1Y9ZA 3K05A 4RK0A 2ORYA 3ZCPA 5EN4A 1QDLB 1VLZA 3C3AA 4NCHA 2QP9X 1N4DA 2P8JA 2K2QB 4LBVA 5DTRA 2QRVB 4QBKA 5DBIA 1W46A 4J0EA 4COOA 4HVLA 1YR9A 3OETA 1XZMA 4I2VA 4AN0A 4AJNA 3NTRA 2ZRNA 4HFNA 4P35A 3WMWA 1Y8QB 4G2TA 4A8JA 1NQOA 1XZ8A 3U48A 3A4IA 5EPOA 2Q46A 3S2IA 2Z6QA 1KGSA 4NMLA 3ABQB 4Q66C 2DY1A 3U60B 3GMIA 4W82A 5C1PA 8MHTA 3FDIA 4IDHA 1U0RA 2XDQA 4XFKA 3UAWA 5FUQA 1WO8A 2XDAA 3GYGA 3IHKA 1U4NA 4OM8A 4WKNA 3PHCA 3QU9A 1L5QA 5H5JA 3SS9X 5IVPA 1VP3A 1JQLB 2P9QA 2R00A 3MJ4A 1DCKA 4FZVA 4Q7KA 4EMTA 2IWRA 4I1SA 3DBLA 3IDFA 1C4XA 2DUJA 4Z0HO 7MDHA 3N28A 3ZY2A 5JMWA 1ZUWA 2JA2A 3C43A 4KQWA 5K8LA 3W6ZA 3B89A 3MM4A 1IY2A 2OBLA 4JUAA 5TPWA 2P9CA 3VR5A 5BUCA 5MHTA 2AI2A 1QG2A 2X1MA 4P2GA 4E21A 1U1IA 3I1IA 5CJPA 5FORA 2ZIVB 3FNHA 3KJZA 4EM6A 1Y63A 3M34A 2HSDA 3HDGA 1YB5A 4IQGA 3ZQ4A 1QAOA 3IAAA 4HN2A 4QODA 3WRXC 2A59A 2JIZD 1WUKS 4EJ2A 2LXNA 4C6TB 4WVLA 4ND3A 1J39A 1T3SA 3A6JA 3TOSA 2TMKA 4MJXA 3MXTA 2VXBA 3TTWA 1QE5A 10MHA 5DRTA 4UTOA 3E6AA 3L5OA 3KXIA 5FOUA 2H2WA 2DSNA 2QJTA 4ACBA 4JI7B 2DWOA 1HLGA 3A9SA 1JEEA 1D8TA 2WNHA 3U7GA 2KWIA 3SF0A 1NSYA 4I8XA 1ZVMA 3D4OA 5E8JA 2AJCA 4P86A 1YVDA 1IN1A 4D9HA 2BFEB 2GLXA 3NS7A 3WSTA 5HR5A 2GOYA 1MEOA 2NSYA 4DOMA 1OVGA 1UJCA 3FYSA 3TMYA 4EKEA 3HB1A 2DLNA 5CD1A 5C37A 2DFVA 3OFJA 1XRNA 3BD6A 4ZJUA 3LRPA 1I33A 3O8OA 1G21E 4Q18A 3BH7A 1FFXA 1LPBB 2D2IA 4NZNA 3OJOA 5AMXA 5DTIA 1CEQA 3T7CA 2FLVA 2UXCB 5KWIA 3I0ZA 4MAAA 1RM4A 4D9BA 2ZFUA 1Z8HA 2QNRA 2EOAA 3EVZA 1EVYA 3TNYA 2WTUA 1DT3A 4IGAA 4L85A 1EFPA 2ZU0C 4BKQA 1PUIA 1GPWB 3VKUA 2ZS9A 4BO2A 1IYZA 5F51A 1NHWA 4AX8A 5A3RA 2HSEA 3DONA 4ZAVA 5EKTA 5KU1A 2KX7A 1YJAA 1U0FA 1BWRA 2FK8A 2QN9A 2VPXA 4MUEA 4GLLA 2VP9A 3T3HA 4ZMBA 3U09A 4OI4A 1H2HA 1RWKA 2XGGA 3RWBA 5KYGA 1XRMA 4CKXA 5LQRA 1CUCA 4UHDA 3ND8A 2X9LA 5K8VA 1GKUB 2VJPA 2JIPA 3G9ZA 4IV5A 5FR1A 1GNRA 3Q88A 3PR3A 5DYNA 1PJBA 4MVJG 2BTQB 4FGJA 2AYZA 3D8SA 2DHCA 3EXFB 3NXSA 1YIAA 1A4UA 1I0IA 1L8XA 1EXDA 3CI0I 3E15A 5DCWA 4KN5A 2B98A 2O7RA 3TW0A 1QH1B 3Q5GA 3K6KA 2DERA 2H08A 3RTGA 4DSZA 4YDQA 2OFXA 2E18A 5AT1A 3IV6A 5NULA 2RFLA 1UMCB 1WRBA 4GVXA 4ZAFA 5KMGA 2C84A 3HJCA 3D4IA 1QHYA 4MB6A 1SHZA 1NRXA 3JYOA 1GKLA 3EHEA 2NO9A 4J0FA 3PA6A 3AESA 2DQYA 3ZW9A 3RU7A 3ZBTA 5EWJB 4EG1A 3MGAA 1RPNA 3EFHA 1KI8A 3LUCA 5BNFA 2HF9A 4YRLA 2IHYA 3WYEA 2CHFA 3CM0A 1FQOA 2C4MA 3R23A 1KAGA 4X3CA 5AI5A 2EBWA 1IM2A 1I4EB 4ZV7A 4ZCPA 4W6QA 1DV2A 1UBGA 5B3AA 2ZE7A 4FB5A 1CW2B 1ZUD1 3BN3A 4CM8A 2PZAA 2YIDA 9LDTA 3KLNA 1BXKA 3DZHA 4R7ZA 4B74A 1S3SA 4ZO7A 3GV0A 3FF1A 3C87A 4Y9UA 5C3UA 3TLXA 4WKOA 4BBJA 4AT1A 2GZDA 1AC5A 1KAMA 3W3AA 2FF5A 3HWSA 2F3UA 3QF4B 1MO4A 1QJ4A 1VJCA 1YBMA 3N2YA 5F21A 5G3ZA 1E59A 1HDCA 2JEOA 4LCJA 1G6OA 1ZZGA 4J03A 4IZHA 2OQRA 3E7XA 4L0CA 5JY1A 2XXBA 1LY1A 5EESA 1A9YA 4TYQA 1WVGA 2DFTA 4ZZIA 1XMQB 4PQEA 2NQ8A 1U5CA 2WFZA 5KYYA 3DZGA 4WNYA 1NQUA 1SXHA 1Z18A 4NPHA 5JATA 3QF7A 5JAQA 4CV0A 8OHMA 1A50B 4PWYA 4X1KB 3GLHB 1VL0A 3SR0A 3UOWA 2OYCA 3HWX1 4QPZA 1I7PA 3IVXA 4X94A 2AMYA 1C8LA 4UW9A 3AM1A 4TZ6A 1AK9A 2RI0A 1BCSB 3WHPA 4DBLC 4HFRA 4G4JA 3FNGA 2OE2A 1M8KA 1ZHHA 4FI3F 4H7DA 3B60A 5FOWA 4WN9B 3TKAA 1HQDA 5K6AC 1C4WA 1UZMA 5AK6A 1Y1RA 2QF7A 5FD8A 2R7KA 1BEUB 1P0IA 5AK5A 4B6SA 3IIJA 4RZUA 4FPXA 4MV7A 2FPSA 4FE3A 2PAFA 3K0BA 4LJ6A 5KYUA 4OHZA 1R0CA 1JZTA 4J43A 1K7XB 4PO9A 4EEZA 1PJTA 2GDJA 2FFJA 3EAGA 4RQAA 1S2LA 4GOXA 4JFAA 4D9JA 4DV1B 1TE2A 2JH3A 3UAGA 1YR8A 4BYMA 1M2JA 4JGBA 3CW2A 1I2BA 4CPDA 3HBLA 2X9NA 1U9ZA 1E3QA 3NX4A 4CLHA 4B3TB 3R0IA 4FHEA 4NWIA 1HL7A 4O4HB 3H2BA 2QQEA 1O5TA 1UMKA 2IXAA 3U4QA 1U99A 1UP7A 3F5QA 2P4QA 2NTEA 4RPHA 3VSBA 4YRNA 5AESA 5GWXA 4U0JA 2HTEA 2FP4B 5KREA 3DMYA 1TJNA 4L0DA 5C7OO 4U7HA 2I67A 3O93A 5AVVA 3GLIA 1FLAA 5BYKA 1ZLYA 4O0LA 4PXSA 4Z5XA 3FSGD 1M34E 3GJ3A 5TXGA 3O2NA 1KDVA 4A0SA 4M1WA 2PX4A 4IDEA 4A0FA 1ORVA 3B7GA 4RXMA 3TZHA 4I1PA 4J9UE 1QR6A 5HJEA 2W6OA 1QFJA 2JI8A 1UXKA 1WPGA 3DEAA 1MH1A 1CWUA 2H1RA 1N9GA 4JKOA 3JARA 4K6KA 4B3JA 3KZKA 5GZ6A 1E2QA 1JU4A 1NBIA 4RMJA 3RARA 4B46A 2AQ8A 1X1DA 2AGVA 4F5EA 1F7VA 2Z4TA 1JPUA 2XY4A 1RJWA 2HKIA 1BRMA 1OREA 4PX2A 3UF0A 2C2HA 4MLDA 4B31A 1S9DA 3H6KA 4KMRA 4Q7LA 4DHWA 4WX2B 1NIJA 2XITA 5L6LB 1JVSA 4J1TC 5K0EA 4Z4QA 3GAZA 2E4ZA 3EEQA 4YMSA 4E4YA 5SYAA 1H0SA 3H2JA 5I7SA 1CRZA 4MB0A 1EHYA 3MJVA 1TCUA 3E5NA 5JECA 1V5GA 4QICA 1RRMA 2JGMA 2JANA 2Y1CA 1J2RA 1SIUA 2OD2A 3CGGA 3E1SA 3I2IA 3PC2A 4X3OA 4B6QA 1C0LA 4DY6A 2XKKA 1NR7A 3LVFO 1SZCA 1WW2A 5EFZA 4TZ0A 1R3DA 3BIOA 2FOLA 2WSYB 3FZEA 1G59A 4ARUA 4QT4A 3FYHA 3HL0A 5D00A 2BWJA 1TEZA 4IZIA 4MUHA 1F2DA 1X7ZA 4MRNA 5HW0A 1Z6TA 5IT0A 4OHFA 3BWYA 4G65A 1W73A 2WLSA 2D5LA 1UDXA 4NECA 1XTRA 2AD5A 1KYZA 4KPFC 1JSZA 4ZI7A 5T7BA 2XNKA 1JHYA 2C4VA 3FVWA 4IW3B 2AFHA 2EL7A 2ZG6A 1XP8A 4PPNA 3QVGB 5AFSA 1DCTA 3AVYA 1IOWA 2WM9B 2W2VA 1AQYA 4H0CA 4OIFA 3LCUA 2R44A 2E7ZA 3K1AB 4DIEA 1A96A 2QUKA 5EZSA 1UUFA 2PRJA 3D7LA 3WKEA 4HH0A 1TJYA 4X1YA 4F12A 4MCIA 3COZA 1YHZA 4D3SA 4FJ2A 4GUAA 4WE3A 5H81A 1R5JA 3TL6A 4DCSA 1SD1A 1YAHA 4EKNB 1D6NA 1GCGA 3TD9A 1U02A 2R8YA 4ZVVA 4QXMA 3DBHA 3EIXA 4NAUA 3GBVA 2AE2A 1ZAKA 4UMEA 1IPEA 1XMPA 2BZ1A 2HK7A 1BW9A 2JJYA 4QXPA 4FMDB 3W3ZB 4H0FA 3U7IA 3VNVA 5AW2A 2RHGB 3OPYB 2I9KA 4JYMA 3F6YA 1M6HA 5F12A 3E27A 4AM8A 2XW6A 4POAA 3BYZA 4OKSA 2GAOA 4OQEA 2H59A 3T1NA 1OPRA 2PV7A 4MS3A 4IVRA 1RS0A 4CLRB 2M6LA 5SY6A 4DFDA 1LWNA 1DIHA 3Q87B 5CVEA 3RSSA 3SLRA 1O89A 3IVMA 3STVA 1F1JA 4BP1A 1EE9A 4RDIA 5IYZB 1L4GA 4CTNA 2QUZA 3JVDA 4DG9A 1ZD2P 5JH7A 1TYCA 1UK8A 1NW8A 2D06A 4K88A 4K9NA 4PG5A 4RF4A 3AG6A 4V3BA 3A7DA 2EX1A 4MJ7A 1RHRA 2D5IA 3M4ZA 4UUMA 1ZOSA 2WR8A 1PT7A 4DDTA 1ZVJA 3CH6A 4PNZA 4EA7A 3MG9A 5AI9A 4U6QA 1AU9A 4Q3DA 3DNFA 1T36A 1FMLA 1DLJA 2A9RA 3GEMA 3SOPA 4ABYA 3GLFB 2ZZMA 3TAXA 1KI1A 5GONA 4MS4B 1ES9A 1ULZA 1QK3A 4J16A 3E5MA 1ZUNA 3COPA 2GJKA 3GK3A 3AY3A 4ER5A 1Y7LA 2PRSA 2W37A 1NBWB 2ZATA 1M2OB 2OSVA 2VS1A 3LI2A 3S2SA 5EL0A 5K3CA 5HOEA 3S2FA 4OJTA 5DEIA 3EGXA 5DB4A 3SG0A 2FUCA 5A0VA 3AINA 1NI3A 1FJGB 5H4GA 1UANA 2Y92A 4CM7A 3B78A 3I30X 3LNCA 1QPBA 4YI5A 1IK6A 3CEHA 1T35A 4NCXA 3LHFA 4IVPA 4BKOA 1JJAA 4Q48A 1PZXA 5IVHA 2VHCA 1DS6A 4UTNA 5REQA 1J0BA 4Y7CA 2R96A 5E4YA 3TCKA 4LQLA 2GTIA 3QKTA 4GC5A 4M1TA 4GPTA 3AF6A 2O4UX 4AF8A 2FMUA 1XAGA 2J07A 1EWQA 3EXIA 1UBTS 4B2PA 1GGFA 2BDEA 3LU1A 2NPOA 3WLMA 3AKCA 1SA0B 3F49S 1L5GB 2IY8A 4QYXA 4YPFA 1IHYA 4AZ3B 1BROA 1OXMA 2YVLA 3LT0A 1V16A 3MCTA 2YINC 2AFIA 3CX7A 3IPAA 3T99A 1V1MB 3EZFA 8ATCA 1ZGAA 3R7DA 3CTPA 4JDUA 2JKYA 3EFOB 1MB2A 2ANBA 3QMPA 1JAZA 4UCFA 5TPZA 2C7VA 4QEDA 2GM5A 1HUQA 4G5FA 4HRVA 4MKZA 3RUDA 4F5YA 5SY4A 5L45A 1QRDA 5BSHA 4PO3X 2WHQA 3FSEA 3QH4A 3JQ8B 3A4LA 1ORWA 1IY1A 1DKUA 1UOOA 2W43A 3P32A 2FMTA 1J9ZA 4WOJA 3BWBA 1TDJA 1WHTB 2PGJA 1E79A 4J6EA 2XXAB 3H5AA 4BHTA 2B5VA 5EJ4A 1CR6A 4JLMA 5KPDA 1LC3A 1TF7A 2YY6A 4Q9AA 1E5QA 5DMHA 5EE9A 3T9BA 5GJBA 4FM9A 5BOSA 4H77A 4KU4A 4KXXA 4WDRA 3DV0B 3CLTD 4EGQA 1VQ1A 5B4VA 4D3FA 1X42A 5F5XA 4MKGA 1QZZA 4FCWA 1H6BA 5K20A 1PQ4A 1M2KA 1N25A 2X42A 1Y1LA 1HX7A 3OMLA 1DKQA 3O4HA 3WQBA 3WK8A 1DQSA 4WBNF 4CG0A 1TD9A 3R0VA 4I4TF 3VZRA 5AWFC 3O95A 3H1AA 3NVKI 3KDAA 1FSZA 3AB8A 4TPKA 3IQXA 2KBFA 5K4HA 1N33B 5FKJA 1MD9A 2EERA 1Y4AE 2OG1A 3CPJB 5AKJA 4JZYA 5J5CA 4KXQA 4BB6A 1R2QA 1YL7A 2K2WA 3PIDA 5ITZA 1XXHB 3T9FA 4JWTA 1R6XA 3W4KA 2QTLA 1JKJB 3OY2A 1W25A 1EFLA 4H1UA 3SHQA 5JU6A 1E9BA 2GPSA 1CHDA 4QDOA 4YQZA 1W44A 1S5PA 5FNZA 2AWOA 3DT8A 3MCWA 4WNIA 2F8SA 2XRFA 1ECPA 2RMKA 4LJ5A 3HCOA 5FHRA 4OQQA 4NQRA 5TDHA 2BSXA 2D7CA 1QTIA 1ZOPA 2G06A 1PFKA 1BQ4A 2ILTA 3EASA 4MO2A 1A9OA 1PNQA 2G67A 1E92A 1WHSA 4UPVA 4ZC1A 4M1EA 4EUKA 2YV4A 3ABZA 4R16A 4ETIA 5HJ5A 4DWWA 3GBPA 3V5NA 2Z3ZA 4BN0A 1A77A 5KWEA 1XDUA 3PLNA 1I13A 3VBCA 3IP6A 2P90A 2ZK7A 2P6RA 4WI1A 1N0IA 3KL2A 2GBLA 4J0HA 4DDHA 4YCNA 1FYEA 2A4KA 4BTLA 1QQTA 1QHHB 2G5ZA 1I4OA 1SBYA 4JLJA 1DAIA 1U81A 1RNLA 1LRKA 2AKYA 2GZRA 1CQWA 2ZBFA 3IP3A 4XWOA 3M33A 4B3GA 1F8YA 4HAWA 3C48A 4RTOA 3OT1A 4BNHA 3FVQA 4GLBA 2FP3A 1QQBA 4MARA 3R77A 3RVPA 1FYFA 4GUDA 2O19A 4X9XA 2G3YA 3DMHA 3OLCX 4BIIA 4BNIA 3FBWA 5D3ZA 4DADA 4N01A 4OHXA 1L4LA 1WPQA 5B2ZA 5C46F 1WS6A 5E4JA 4HBGA 3ZW8A 3UJ7A 3S4YA 3REFA 5LQUA 4ZU1X 4RV9A 2ZJYA 1BGXT 2W11A 4AY3A 1TVKB 5FA6A 3PCXA 1YDWA 4WZAA 4CQMB 4CKWA 1J8YF 2LD4A 2GRJA 1H6AA 3DKVA 3GA7A 5DULA 1N78A 4HH1A 4IUCS 4OUDA 2ZCVA 3V2HA 3WGTA 4IVQA 5AJYA 1GKKA 3BXXA 3IVRA 1YFJA 5CFQA 4BO9A 1Z6QA 2W00A 2ZIWB 2OCPA 4PCVA 3DGFC 3AL2A 2XB6A 2H0AA 1FS4A 1NZDA 3C6KA 2ZSDA 3GB9A 1YZVA 4QHYA 3H2IA 4TS4A 3Q8XB 2L18A 2P5YA 2YXBA 4M9CA 4OBEA 3GRPA 5LZ9A 4C2TA 2AW5A 2UKDA 3IBSA 3DD1A 2PLWA 4KLAA 1G2IA 3IKTA 4B9EA 1NMSA 4KGVA 2PLAA 1JEYB 4E08A 3Q11A 3WICA 5A5GA 2Z83A 5E2BA 1E2HA 1WMSA 2H31A 2EDCA 3IUYA 5HF8A 4YRZA 2CNWA 3GIWA 3FH0A 4DSUA 3A11A 4EB6A 1EZZA 1OA1A 5K03A 3JZFA 1PJ8A 4OXNA 1GV0A 5CP8A 5BW5A 1BGWA 1FFGA 4LZJA 4RXTA 4WERA 4LJYA 1Y6QA 4D4KA 4DLRA 3C98A 1TZ2A 2HR1A 2XUDA 2XVXA 1IZ9A 2Y6VA 1K0FA 3NKFA 1HRDA 1AUXA 3C3KA 4NHOA 5G4KA 1SM4A 3IV7A 4ZVPA 2VJAA 2BFOA 2ZJAA 3U3ZA 2HQ1A 4LGYA 4YMLA 4YYZA 4Z4EA 4RJTA 2Q0HA 3EUAA 5EP3A 2AW3A 5B12A 2GEUA 1CUDA 2PM8A 4CM4A 1Z2NX 1OVMA 1T5IA 3DO5A 3GR6A 2ZB3A 2V7EA 1P4AA 2GM3A 4KLZA 5SYNA 2G76A 4EW6A 4PIVA 1HE4A 1OX4B 1SD5A 1Z47A 1ZMBA 4IG9A 3PI6A 4KQGA 3N70A 3T9EA 4D0NA 4DMCA 3AR5A 4CN9A 1CUXA 4FFSA 1NUHA 2EARA 3IHLA 4OA5A 4M0FA 4EQ6A 7YASA 3AY7A 4RQUA 1M8GA 3ZCTA 4U8HA 5JS1A 2WF7A 4QDTA 1V96A 1SXJA 4W7SA 4B1FA 2CYBA 3D3WB 2JB9A 4H1TA 4EG7A 1ORIA 3KU4A 3AIOA 2BEWA 4IIHA 1PWYE 2OG2A 2WOOA 2ZE8A 3LAWA 4R2JA 2XNSA 3VAZA 2ZSFA 1FTYA 3GG2A 3OPMA 4YJ2B 4BNFA 5JCOC 2JI6A 4XQ9A 2X0JA 1KQNA 2NTNA 4E0BA 1CS0A 1RJ9A 1VHWA 2I71A 1WPRA 1UDCA 1TX4B 1L6RA 4MV9A 4H59A 3KXPA 5EG5A 2PO7A 4M46A 3WMEA 1D04A 1OTHA 4XAQA 3TS1A 2R8PA 1VKRA 1Y7TA 2O8CB 2O6LA 4XFJA 1ACJA 1U9YA 1L3CA 3K0KA 1ISJA 5IBPA 1NA5A 1QIHA 1V11B 3CX6A 2HHCA 5KNDH 4GL2A 3KKKA 1VP9A 4R1TA 2C5SA 4DF3A 2GFIA 3R6WA 1ZOLA 3KD2A 4EGSA 3OEEA 5CAEB 2IW3A 1NRIA 1GTG1 4P54A 2WVGA 3C3WA 1H2EA 4WK0B 3RVNA 2WKRA 3ENVA 3E9DA 5FUVA 2DY0A 1H3FA 2RB4A 2V6JA 1E9AA 1ACLA 1JFLA 1XZPA 1XL0A 1VA5A 2A78A 2GDZA 2ZOSA 2PXAA 3H5TA 3KUCA 4LHXA 4P9NA 5FL3A 3C5CA 3WRYC 1IN8A 4RGVA 1N5MA 1UOEA 4IDBA 3NJ4A 3HBNA 5JD4A 3VU1A 3ESAA 1SIBE 2TMDA 3VU3A 2A67A 4AKEA 3MLBA 1I5EA 2FPLA 3QIVA 3VJMA 3CVUA 2AVNA 4OFBA 4W9RA 2BBWA 1KDTA 1M0SA 3EXG2 3FNEA 5BN5A 1KKMA 3H1EA 3HCRA 3FGPA 3D1JA 1TQ4A 1FP4A 1ETUA 4X62B 1MC1A 4Q03A 5T67A 3TR6A 1EUYA 1O95D 2IIQA 3A27A 4HAUA 4ECEA 2I3AA 4PSDA 4X6YA 5AHRA 2ZI5A 3VJKA 4ZN6A 5ARDA 4DSNA 4UM8B 1LDBA 5BQFA 2FZGA 3WR5A 1W8DA 1Q2XA 2FWRA 3S6JA 1GG8A 1NRWA 2W6JD 1P2FA 4WIAA 1P4SA 1AK2A 1D7AA 4PZUA 5F2NA 1XWIA 4QPCA 1E3LA 1PI3A 3GJSA 3RW9A 3S7TA 1X80A 4BFXA 4DA6A 1GAWA 3CKYA 3HDVA 3AXTA 4KREA 4GAEA 4HPXB 2VHXA 3KWLA 3TMAA 2A9PA 4IO1A 1S2IA 3ZDZB 4ZANA 4QEZA 1MB4A 1FQKA 4Z7JA 1ESMA 1GADO 2JFPA 3FKSD 1M2VA 3ZZMA 4ZMRA 4I1RA 4C7MA 3E8SA 3AETB 1GL7A 4L4ZA 4MNTA 2QBYB 3N7TA 4KPUA 1K5DA 3VYRB 3JD1A 8ABPA 1UAGA 2EFYA 4LVUA 3Q9NA 1L5RA 5CA1A 5IG2A 4QNNA 3P9CA 4B75A 1J09A 1PK7A 1NIPA 3IR6A 4FE4A 3ST7A 1J1IA 2F8TA 5B3JC 2LIPA 4WLEA 2BHTA 2OM6A 3E70C 4KIJA 2JNWA 2ZIUB 3Q10A 4F45A 3A37A 3D8HA 3OMXA 2EGGA 4TTJA 4ISCA 3LOQA 3SZOA 2AG0A 3NU1A 1GQFA 4BE7B 4GP7A 4NAVA 3P9SA 1L4EA 1T5BA 2BEUA 3HVHA 3VDNB 3OPYI 2OHGA 4YRIA 4CMBA 1GN8A 5EJMA 2OP0A 5C2JB 2EWWA 1GRVA 4OU4A 3UG6A 4LF7B 4BDTA 3EC7A 4N12A 3EF1A 3QUTA 1D1TA 1N3YA 2N3ZA 3FMFA 3G0GA 4HPWA 4RZXA 4M38A 4LI3X 3GHHA 1VE6A 4N5MA 4L78A 2ODPA 5C52B 4XYBA 4HH4A 4NDZA 3Q7EA 5BUZA 1K4KA 3DV2A 3V1YA 3HUUA 4P7BA 2LDXA 4XX1A 3RU2A 1PJLA 5DSZA 3MELA 3EQ7A 1GL3A 1B8PA 4DARA 1L4YA 4DM7A 4G0QA 4MULA 3LP6A 4Y2QA 4DR4B 5GOTA 5BUSA 2WKSA 3H2GA 1LX7A 1UJNA 4TTTS 3VVCA 4DNQA 3S27A 4BKMA 1NX6A 2GZHA 5LUAA 1GVNB 2W0SA 1QIGA 4V38A 2J45A 2FMKA 3K20A 4AZ0B 4AXXA 4DEYA 3TOCA 5JJCA 1PK9A 3ZCRA 2CC2A 1YF3A 3G82C 4JL8A 3AUJB 4DT1B 5FUMA 1RI1A 4UM7A 2BKVA 3K7EA 1U04A 3GI1A 2BISA 4KWHA 5H70A 1ZXXA 4BFVA 4D56A 1GILA 4UBIA 2IQ5A 2IA5A 4QGBA 3WWYA 1EVJA 3CRNA 2IOFA 3C16C 3GP8A 3JATA 1RZVA 1VSBA 2QPTA 4LN1A 4N1AA 1IEXA 4MV3A 4RHXA 1L5YA 3IBGA 5CT8A 4JXXA 4LHWA 3IHTA 4NATA 5ECYA 4EWLA 1E0AA 3PF9A 1QIDA 2OZLA 4I50B 2O2GA 5F23A 2CLKB 2UYCA 1P8JA 2J9FB 2IYEA 3T61A 1ZUIA 4YLYA 4HDNA 4C0AC 4D8XA 2RAVA 1CYEA 3QX9A 1XRPA 3MAJA 4ZVOA 4U6SA 5LP1A 1M6VB 5FPHA 2Z2YA 3FI9A 1GNTA 1I2CA 3E9EA 2XB4A 1YR1A 4L5YA 3BE4A 3DLAA 3Q3GE 4XRGA 4LSWA 3VPHA 3WTBA 1G19A 1RAHA 4JU9A 4L8LA 3PC3A 4M36A 2O50A 3M6WA 4R1LA 1QGED 2BOVA 3ETCA 4LHVA 5E2AA 4ZAZA 3H5RA 3UN1A 2LP4Y 1A98A 1HL3A 2AB0A 4Z9AA 3DZDA 1WULS 5ALWA 3MPOA 3G0BA 1K7CA 2BHRA 2EKBA 2W8BB 4N3GA 4W7IA 6YASA 4NOLA 1WMBA 3L3BA 3RRXA 1R6BX 3EQ6A 3B5EA 5LN1A 4EELA 4EI8A 4BGVA 5L8VA 1XNRB 1XLTA 4S0ZA 5TLSA 3SX0A 1ZI6A 4NKRA 3BRSA 4UJ5A 1RC8A 4PLWA 4AO7A 4H1WA 4DR2B 1MU0A 5T4FA 2F9FA 5M29A 3E9MA 1H23A 4IXWA 1QORA 3I5UA 4MQ6A 3ZXSA 4PCAA 2BM9A 4CKCA 2JAXA 3KPUA 1P19A 2H2GA 3DE6X 5LU8A 1QOPB 3RHSA 2YYZA 1NG9A 1G4AE 3N0WA 3E05A 1W6UA 3FUCA 4MR7A 1Y3BE 2D7JA 4Q1CA 1MX1A 1SZJG 2DC1A 1C0PA 1FP7A 2GD1O 2HLDA 3O6VA 5E38A 4B0OA 5K99A 4YFVA 4JJ6A 2FMHA 4ZO4A 1RYEA 2I8AA 1SWVA 2HRBA 2ZB2A 4MB2A 3OBBA 3QX7A 3TQQA 4F7DA 1W2GA 3RYCA 3MMPA 3U19A 3N59A 1PZFA 1ZBQA 2WFLB 3UMVA 4P36A 3W7VA 3BMQA 2Z95A 2JKZA 3F6BX 4LSZA 4WKGA 3K71B 3L6CA 1BVYF 3ILYA 1FTSA 2CCKA 2ZDGA 3D4BA 5FI5A 3SBDA 1FOEB 4L5CA 1CDZA 1ZVKA 1SKQA 2H1CA 3PNBA 3PQ2A 4FQ5A 4JQCA 1P0QA 4M3NA 2CCGA 1D6SA 2A9FA 1MT3A 1QWSA 1SU6A 1X7HA 3H6HA 5JDCC 1NVUQ 4EYEA 5CLJA 2WUFA 2D4AA 1RCUA 1FP6A 4KMSA 1MRSA 4G23A 5DO9A 3I4CA 3PHJA 4Y6GB 1RJGA 1P5JA 1T4CB 4YO8A 1FMTA 1ND5A 4QO8A 5CYGA 1Z73A 2DPXA 3JCZA 1YULA 3CLHA 1XIVA 1ISFA 2YMQA 2ZREA 3LSTA 5TV2A 1IXRC 1X1TA 3P9KA 4O4IB 1W5SA 2PZLA 3HU3A 3I6IA 2QMYA 5HZHA 1G5HA 2RK6A 2W6ZA 4BO6A 3HSKA 4J0GA 3OZSA 4B2LA 4NQZA 4OG2A 3IUSA 1B76A 1XEAA 3INYA 4WBNA 3ANNA 1ZGBA 3N76A 3NCTA 3ELWA 4I4TA 1XTPA 1PWXA 5JASA 5ES3A 1Q5PA 3I8XA 4D0RA 3V2IA 4H7EA 1VHTA 4OL0A 2W5UA 2G17A 2B61A 3H9GA 4BX0A 4IGIA 4NYJQ 4X65B 5A5EA 1DO0A 3HVRA 4DLAA 3EXHC 3TR0A 2PH1A 1Z88A 4GYKA 2Q9BA 1NMQA 1F0PA 1M6WA 3NHRA 4DB2A 4V0OA 3C8ZA 4M0CA 1QUEA 2JVJA 3CLSC 4I81A 4R31A 4OXXA 5GM1A 1KXZA 3QIAA 1KI3A 2X4GA 3JQ7B 2J5RA 5TNXA 4A0HA 2B21A 2WZQA 3HGMA 2X1LA 3UV6A 2OCLA 1ZN9A 2X86A 2W6QA 3NZEA 4RLSA 1NTOA 3DHEA 5TE9A 1Y9AA 2WJIA 3KQOA 5AKHA 3UJNA 1ZM2A 4LOKA 4QTUB 4YMWA 3SYMA 1XKTA 3E3OA 2OR3A 2C77A 3H4TA 2JGKA 1MC8A 1V3QE 4CLDA 3BIFA 1OAKA 2H06A 5IK2A 2ZI7A 5HBGA 4CR7A 3EBLA 4QASA 4UNIA 3RVMA 2QMHA 3T3GA 3FF4A 3PFKA 4G5RA 5ABPA 4AJIA 3NTXA 4KQXA 2ZTUA 5F4BA 2IDJA 4AP6A 1VPEA 5I7VA 3GJ7A 5K3DA 4EQZA 4EY4A 2W2PA 2HMSA 3OA2A 3C6XA 3ROQA 4I08A 1IPFA 4K2AA 3M1LA 2ZYHA 1F4VA 1XVTA 4QRDA 4M60A 1GHTA 4YBZA 4JUDX 1EVEA 1SVSA 5EA2A 5AYVA 1HOTA 1VIAA 4IV8A 3RAJA 1JU9A 2CLSA 4Z51A 3PTAA 1PL8A 1JQ5A 2QL7A 4PLTA 3JD4A 4DUGD 3OOWA 3SFVA 1QK5A 3ME5A 5BVHB 3MMNA 1A7AA 1BWPA 2JFZA 5CK5A 3O8LA 3RSCA 4P4UA 1C0EA 1RJDA 1W0KD 3GLHE 3UMJA 3D7KA 4DJDC 1OHHD 1FDUA 1JGTA 3JWHA 3WYDA 2A7QA 3AIMA 1QCYA 2A3RA 3D64A 3GZ4A 3HUDA 3NIWA 5K3AA 3WGGA 3ZLUA 5BSVA 2A0FA 2Z58A 1O2DA 1P7PA 4E5NA 2ORVA 3Q9LA 3TZKA 3THWB 2QGNA 3TJMA 4Q9IA 1B3BA 3L8EA 3SXJA 4JLKA 1PDOA 5HUQA 1WMAA 4CCSA 3QV2A 3HKBB 1IMOA 2GBPA 3D7RA 3QKSA 4KSYA 1BYUA 1Y1QA 1O54A 1XZHA 2VDWB 4X63A 5E4TA 3RRYA 4BYGA 1G1AA 3NT2A 3FN4A 3P0RA 2XWBF 2DVMA 1Y81A 3JQQA 3TIFA 5LP6B 3E7PA 3WFIA 1IUKA 4JSYA 1Q95A 2W48A 1VYTA 3F6SA 2WFMA 3H2ZA 4RKYA 4LHEA 2VUHB 2R6HA 4ZQGA 5A9SB 3DBRA 1LPOA 1OAOC 5D6NA 5AK4A 3ZYCA 4B5LA 3TIIA 4OQYA 1KE1A 5DNWA 4B2YA 5EMJA 2GMWA 3TSAA 2P6MA 4J3FA 1A5TA 3BDIA 4MK4A 3GIDA 1KBOA 2VYQA 3LBAA 3ZWVA 4B6EA 7ADHA 2XYPA 4M8IA 1NU8A 3Q2OA 4P4TA 4X7PA 3C8HA 1HNXB 5BWNA 3CFFL 1GTL1 4DY4A 2VWQA 4TKUB 1EFDN 1KC3A 2JHGA 2BZSA 3KJNA 4GD3Q 3G2MA 1Z22A 3OFVA 5FA8A 1DTWA 2DHEA 4N0MA 4QQ8A 3LQKA 3V4FA 1IL0A 1S2OA 4LS3A 5DIFA 4PG4A 2IBSA 4CM1A 4JJZA 2Q5IA 4K2HA 1QGAA 4KDRA 1YB2A 3KSRA 3LW7A 4KQEA 4WEOA 5AM0A 5JMOA 3EH1A 1C7FA 3RKUA 5KZMB 5F7OA 1IQPA 2A5JA 2ADMA 4JJKA 5LU9A 3PX3A 3EG9B 2GN6A 5I7WA 1BMQA 3UJ6A 3HFJA 2B7BA 3UPUA 1Z33A 1R0LA 5C35A 4YJFA 2VK2A 2BW0A 1NNI1 2Z57A 4KBFA 1HT0A 3BX1A 3IQGX 3PKIA 3TYXA 1AHHA 1M2NA 4Y0NA 4PGFA 2FPOA 1RQNA 3H16A 3VR2D 2YQ5A 3DW3X 1LK5A 4R1UA 1Q50A 1F0NA 2V7PA 3PUVA 4EI7A 1QIFA 1HG1A 5T3YA 1SRRA 3L0OA 1N8SA 1MA3A 3P4YA 2ZPUA 4BMPB 4BO0A 4EO9A 2ZJ1A 1NN3A 3MILA 3NH9A 4A03A 5JCZA 4ZOEA 1Z2OX 3I9V6 2FMXA 4RAQA 4RKEA 3RSOA 2ZBGA 2A1UA 3AKZA 6NULA 1BMFA 5CLGA 3DHVA 3NEPX 1M83A 2WTAA 4FOSA 3B82A 3INTA 2QA5A 3NGLA 4TMTA 4AWAA 3T95A 2RGNC 4TXHA 3DZFA 2R62A 4RQTA 2B20A 2XCSB 3QEBZ 1OE0A 1K8QA 3CFYA 3ZTWA 3DOOA 2GN8A 1HNWB 1CS4C 3C3EA 1VGQA 4OI0A 3GLUA 1V3UA 4BLTA 2QLFA 3HJHA 5CR9A 5DNYB 4YN3A 3HC7A 1AVTA 2RKWA 2R1TB 3I12A 3NJ8A 4A5SA 4R6WA 2JLQA 4XJXA 1XTQA 2DWQA 4IIUA 5KKCA 1GPMA 2RGCA 3LNTA 4F4DA 1U2GA 4CWAA 2QL5A 5A5VA 3E84A 2JFUA 4NLLA 2P9EA 1KOJA 1YBAA 1CQJA 2Q5CA 3GWZA 2FFHA 3LZ6A 3OM8A 4TQGA 5KEIA 5IASA 4QT0A 5ALDA 3TL3A 4YAGA 4B4UA 4OB7A 3K6JA 1I3OA 2PBZA 1KPIA 2ZRJA 3NRJA 1ZWLA 4QATA 3KSBC 1YZFA 1C7JA 1L3IA 1ONSA 1PGOA 4B40A 1TM1E 2CFCA 3D9QX 2OD9A 5E2IA 2JJMA 3HBJA 3AOEC 3INNA 4ND7A 3OVMA 2ZVDA 3LLMA 4QJ5A 4ZTBA 2VTBA 3ICEA 4NZPA 1ESDA 3TDKA 1FB5A 3AY6A 1AKNA 4E03A 1FZTA 1Q0QA 4LJRA 3OZWA 5A9TA 3I45A 5IVKA 1WB5A 2BVNA 1EGAA 3QVTA 4CQJA 2P9HA 5TSDA 4YDSA 5FWXA 5TVGA 3SXUA 4R1NA 1FPMA 5ER9A 2V4ZA 1QGYA 3N5KA 2RHOA 3LQYA 3PYXA 4YXFA 1QFYA 3G3EA 2ATCA 1S02A 1KAHA 2AWNA 1Y7PA 2FPGB 4M7RA 1D6MA 4FEEA 1A8PA 4KX3A 2FWIA 5B55A 2CJYA 3HYLA 3KV1A 3MA0A 4HMOA 4WCFA 2C9OA 4IR7A 2Q1UA 3N3BC 2XUKA 3TXXA 3GLFE 1KO1A 5E8RA 3I39X 4HRAA 4N0QA 1W36D 1MAVA 1OKKD 1NURA 1UK9A 4MQFA 4KQ9A 3C6YA 1LQTA 2K7FA 2G1AA 1SUIA 1GZSA 1MRZA 1J6UA 3CO5A 5B1HA 3RBAA 3RWMB 2PRKA 1QP8A 1YUMA 3ZV4A 1ECFA 4F84A 3AIKA 1QYXA 2R7MA 4NR0A 2IS6A 4PYIA 2V7BA 1KTVA 4HL6A 2YVUA 3RS8A 1W75A 3E5RA 3H3FA 1AXGA 3BMCB 3IE0A 3K1TA 4NBRA 3D5EA 4EX7A 1FBTA 1WZEA 4ZVTA 1HFKA 2J0UA 4BVGA 3DYVA 4F6LA 3K70B 4K6FA 3HP4A 3Q0IA 5LYYA 3WMXA 4WCVA 3PEUA 4D2IA 2O23A 1UDWA 1L1EA 2HGZA 2VAWA 4P7GA 1JHAA 2QL6A 3GZNB 4HQLA 1F12A 4BCBA 4C7JA 2IZ1A 3RYHB 4ENWA 3R09A 2E5WA 4PNHA 3HEBA 4CMEA 5EP1A 1RWQA 1NJFA 3GGCA 3K72B 4QJIA 3T5GA 4B7CA 1E64A 2V0GA 1E2JA 4EVSA 3BSWA 1SQFA 1WZNA 4ZQEA 3UB2A 3QLUC 3HJBA 4XGIA 1KYXA 4MQMA 4C0HA 1HDGO 1I7QB 1WBDA 4EGAA 2XNHA 2DFNA 3Q0TA 1NZFA 3KT8A 1E1CA 2I2FA 5I7UA 2CUNA 1KHTA 1NBMD 2YZNA 3OZXA 4RVCA 5DNDA 5SICE 1H1LA 3ZGZA 1ZH0A 4BLPA 3MN1A 1NXWA 1M1YB 5DLEA 1Y6JA 4DHEA 4P7FA 1KAOA 1U7DA 2J7KA 3FLAA 1RD4A 1S8AA 3LHKA 1RXSA 3L82B 4TXMA 4WXHA 1KC1A 3EN0A 5GGYA 5JSHA 2O8FA 1BH2A 1SU8A 4FFNA 1C7QA 1EP9A 1VMAA 2Y71A 4TT8A 5G2OA 5FNVF 3IX7A 3NP7A 1Q6YA 3ZXUB 3D6TB 3FAKA 1L5ZA 4KFTA 3W2FA 3H87A 5LJIA 1SEPA 5TMPA 1YRWA 4B5KA 1F9EA 2ZAIA 2ZJZA 2QLMA 2QN2A 4IZOA 5CLQA 2JZCA 1LVGA 5FBLB 4RJIA 4D8TA 5FUWA 4QDUA 1WXQA 2MDTA 1GAQA 2BFPA 2ACVA 3ZH9B 4DA7A 4L3WA 3ON5A 1E32A 1O5OA 4YP7A 2Z56A 1KA9H 3GNLA 1YA6A 2P41A 4GI3A 2W6IA 4JLPA 4PANA 3ENNA 2C1XA 2G28A 1UPCA 3DG9A 4LDAA 1KIFA 4BPBA 1L7EA 3WNCA 3JZIA 4EG4A 3FW1A 3WGIA 4G1FA 3I9KA 1M1UA 3JQGA 4NU8X 2DMRA 3W5CA 2RH8A 1JDNA 2G2SA 4MWCA 3OURA 2G63A 2X0IA 5GPBA 2Y68A 3L7YA 4MWZA 1CJMA 3N07A 5CU7A 3Q3IA 2AZTA 3GNQA 4L4YA 4MWGA 4X90A 3R7BA 3SVLA 1X1CA 5JADA 1DC6A 3K96A 3WLKX 2VJMA 3HPRA 3EIQA 3IE1A 1Y80A 2I2CA 5A0TA 3T7IA 1NULA 3B85A 4KPEC 3T9AA 2RK4A 1J56A 2AC2A 3DXYA 3QPWA 3I01M 1KWKA 4FYKA 2C2BA 4QRIA 2RHBA 1NW5A 4BPRA 3B52X 4QREA 2FG5A 1Z74A 2QU7A 3FCSB 2Q49A 3HABA 1X9HA 3ASYA 4MW2A 3ZHQA 4ESOA 3HJNA 4RGYA 5LZ8A 3AEXA 3MD0A 1VCOA 2QRUA 1G8AA 1E3WA 2X23A 2H9AA 4QHSA 5HP4A 3QKRA 1C7EA 1MJHA 4TL6A 4GZ6A 3MWEB 3QSGA 4R9UC 5JSZB 3P2MA 1YKGA 1PNRA 1KJJA 1JR3E 2I54A 3AFGA 4AS3A 3BTSA 1XNGA 3KQHA 4Q9KA 3BCUA 1G21A 4MIEA 4DUPA 2Z1DA 2QXTA 2OM2A 2EW8A 3ZV7A 4G25A 2JGAA 1H42A 5DNCA 1SUFA 2V8OA 4DTCA 2ZGVA 3R6DA 3BWXA 3UWPA 5LLTA 3GJ0A 3BSSA 4TWJA 1K86A 5D01A 3T1VA 3VR3D 3ZVNA 1KYWA 3L7OA 2J9RA 2PQ6A 1E6KA 2EW1A 2FEXA 4NPAA 2WF6A 5CB4F 5DYYA 4G2NA 3UA3A 1F0YA 3MOGA 3TO5A 4DVGA 3BGWA 4A15A 3AXSA 3VPXA 2WG1A 3IS3A 3ITNA 5JG7A 3WZ2A 1K68A 1WLSA 1YU9A 1FU7A 1ECBA 1SOUA 1MOSA 2VF7A 3P8ZA 4QUJA 4B3IA 1U8ZA 4RQBA 3MWYW 4ZYWA 3Q12A 2P5UA 4U5QA 1F8FA 2QAGC 2Q99A 4JSTA 4GR9A 3HGTA 3C7AA 1QAMA 2I6TA 3TQCA 3KQWA 2J9YB 3L6RA 3MINB 3AERA 4O5OA 1E1RA 2Z6VA 3IT1A 4IWXA 3VVLA 1JB9A 1TU3A 3RPEA 1VL8A 3JQCA 3RVDA 1O1YA 2HMUA 2HJHA 3RUFA 3EFEA 2HU2A 3H5OA 3JTEA 1TLTA 4BVFA 2BI4A 1I4TD 4GNKA 2FXIA 3G2HA 4J6FA 4IKOA 3B51X 2AHRA 1JAYA 1YVEI 1HFWA 4G4SO 4ZYZA 4YRDA 4WJKB 5KYXA 3NW9A 1WB9A 2IHZA 3A9CA 1J9EA 1XJ0A 3EE6A 3G5AA 1NR1A 4U3JB 3TINA 2KB0A 5FL7A 3H17A 4NZYA 2EWMA 5TMDA 1TA0A 2FPIA 3SJBA 1GXSA 1CRWG 1GVHA 3A9UA 2BFDA 5JEDA 1Q0PA 5J1TB 3NVMB 1U0EA 3OZDA 3L05A 1AKWA 3DMNA 5EIEA 2A5YB 1RLJA 1RKXA 2PEZA 4HZUA 3NDIA 3QQPA 1IG3A 4B82A 4EARA 4LOLA 3DEHA 3JY6A 4YRPA 3STXA 1RLUA 3UYKA 5BXQC 5I8PA 3ELYA 4DB4A 3ISVA 4R84A 2NUAB 2GN2A 2ZWPA 4WFQA 3P9RA 4A92A 3RHTA 2Q4DA 1ZW6A 4QZVA 2JCYA 5DHFA 3LPAA 4RLFA 1ZD5A 5EMLA 3WYCA 4EI2A 3TW6A 3RTBA 4NFSA 2QTFA 1SUWA 2BHLA 3LPDA 2EFHB 2O2DA 2FE4A 3UCFA 2BM0A 4AJ4A 2OYRA 2G5TA 1ZNWA 3L01A 2PVPA 3R5TA 4OYHA 1Q0SA 4PLCA 4CI9A 5BWBA 4C29A 3LHIA 4DUYB 5KAPA 1L4FA 4Q1AA 3RWOA 4FHFA 4MOWA 3E8MA 1SCQA 1N9KA 1Q1AA 1YZKA 2BUAA 3D02A 4WWHA 2C4UA 5D3MB 3VFDA 1RAAA 2OZKA 2V65A 1QH8B 5ALGA 2BLNA 4YJHB 4WECA 4RFSA 2CD7A 4TLEA 3U17A 4AUEA 2O8DA 1QFZA 3W3AD 2DUMA 5DI9A 5JFGA 2Q4RA 4UFNA 2XMGA 1UEXC 3PL1A 1C2TA 4XLLA 1ST2A 4O2AF 1NJ6A 1ONPA 2J87A 4RHFA 4L50A 2A92A 4CM3A 5CBKA 3ZXYA 1CUYA 5IHXA 1CR4A 3AFMA 3BL6A 4HNSA 2XF2A 1RAEA 1UL1X 4DMFA 3LIPA 3TQTA 5EHXA 2PK3A 3I37X 3ESDA 4GC9A 5IKPA 4BFSA 1GSIA 1QB8A 2WU8A 4RPKA 4NONA 2HPVA 3KYDA 5CGZA 1T15A 1N0WA 2H7VA 3EK2A 5CCEA 2PU7A 4KAAA 3OLXA 3V8BA 1VJ5A 2WQZA 4MQEA 3AHDA 5CLLA 3LUAA 1MTZA 3UUFA 1WP4A 3VM6A 2B1GA 4E31A 4G41A 4W5OA 3VZPA 4MPRA 4NJEA 3EY9A 3L02A 4J4BA 1SOMA 3FROA 3U16A 4EVIA 2ACWA 3B7WA 3SHOA 4C2AA 2M1ZA 3LF4A 4J75A 2ZB4A 3GEPA 5EAIA 4D26A 2PH7A 3IMEA 1QLJA 4F2GA 1ZL2A 2XUOA 4N3BA 3GOHA 5EERA 3KTDA 4K9SA 2QRZA 2MT9A 5ALVA 4Q4LA 2CVHA 4BZWA 4ES6A 3AW9A 2DSTA 2E5LB 4ZAGA 4UNRA 5C8XA 3URKA 3QFSA 3PKJA 4I14A 4C4SA 1XLVA 2OPBA 3R6TA 3P94A 4XDZA 5DXAA 3RSLA 4I4CA 1G8SA 4UD6A 2G8LA 2YQZA 3GUHA 2NACA 1ODKA 2ZITA 1RCFA 1BRTA 1M34A 2RCNA 4CF4A 5JS6A 1CJKC 2R60A 4DJFC 4UULA 1N6IA 1E1DA 4B6FA 2WPDA 4JFRA 5LFAA 3DTVD 1M2EA 5HEKA 1JP7A 1S2MA 4Y1RA 1OH6A 1AZLA 3PLRA 1WCXA 2O0KA 2XA9A 2ZIEA 3K32A 2FPPB 1Y8AA 4IL5A 5DU2A 4DCPA 5LD2B 5IJWA 2VAPA 4OLAA 2PMBA 4DDKA 1Y4ZA 3WQHA 5B58C 1AS2A 3DR3A 5JCPA 2ODEA 3QE4A 4NZ9A 1Z7YA 3A3NA 5BQ5A 3K9BA 2YWRA 2Q29A 3G02A 5KSOA 3B1WA 5F2OA 3IJEB 3RRMA 3I09A 1MABB 1E96A 2V3VA 1QP0A 3RV3A 1K89A 3OJCA 1IZYA 4LK2A 2X5NA 3U26A 1JW9B 3UHJA 4BMSA 4PC3A 3CCCA 2O54A 3V1UA 3JXEA 1Q0UA 2GFQA 2JCXA 5EINA 1KH2A 1YKFA 3S44A 2XEDA 1MCZA 3VYUB 1LW6E 2PS9A 3IAM1 3IOCA 3T7AA 1F8UA 2Q6TA 4HS4A 1VJGA 1BNCA 2WAMA 4PPYA 2NXCA 1D8AA 1EFUA 3KXKA 2YJGA 3WKAA 4FBLA 4ODIA 2F00A 5AKYA 2BTOA 3IR5A 1H8ED 2RETA 3LBYA 4HB0A 5JSFA 3L7CA 1JDSA 2DWUA 2B2XA 1FNSA 4HSEA 3ZGLA 1N5OX 2QSJA 1U5AA 2CMHA 3F47A 4IUYA 4MRAA 3QXXA 4ZIRA 5JAPA 2NTYC 2R751 3JYLA 1PYOA 4GPD1 3W2IA 2NP6A 2Q50A 3DUWA 5FPYA 3ZI7A 5JWHA 3WYGA 1XYYA 2NM0A 4NU0A 3P97A 1K0UA 5SZIA 2XUJA 5B1EA 1A0OA 2TYSB 3Q72A 4HDMA 4AP9A 1Z13A 1EQ2A 3O83A 3ZXIA 1D1QA 5G0SA 2FCRA 3A6FA 2R87A 3RTCA 3TD6A 2XVAA 3OAAA 1XI2A 2FG7C 3DH0A 2BE9A 3NALA 3VH3A 4ZYYA 2HA7A 4TMFA 1ESEA 1W1IA 4J4TA 1RC0A 4L57A 5FOXA 2HSJA 1FXSA 1OWOA 3PS9A 3RYTC 2QTGA 3I64A 1ZK2A 1GLNA 4DYVA 2GN0A 1SKBA 4DQKA 4GM4A 1JXOA 3RFVA 1TFRA 5I3CA 5JMTA 4JUCA 3BE6A 4LJ9A 4ZK2A 3LOPA 3HA7A 3PEVA 4K28A 3HLYA 4RTKA 2MSKA 4M21A 5GQSA 4NCKA 4Y6PA 1D2HA 3ITEA 1C1DB 1QTNA 2IHJA 3V7FA 1QIMA 1KK3A 2CLDX 3AEKB 3WLJA 5BO5A 5BN4A 5A3QA 5A5FA 2Q07A 4GM1A 2EYQA 2WZBA 2X77A 3HRIA 4HY3A 2QENA 5IBRA 3SBEA 4Y2XA 1D4AA 4D44A 1NVEA 2AK2A 2PSDA 2O2IA 2VPPA 3KVYA 4FINA 4U2GA 2QZ4A 4ZPJA 5LOVB 1NVMB 1JVBA 4QFDA 2QTWB 2VUIB 4KODA 3VKGA 4H3KB 3HH8A 4TWRA 3FCCA 5BY2A 3I1FA 4ZXPA 3CH5A 2IP2A 4W5HA 4KFCA 2O8EA 3TG2A 1ZNXA 2WWTA 3DDUA 4HNGA 2B8EA 2A0WA 4PIPA 5JTTA 5AI4A 4R8MA 2OQIA 4JHXA 3X0DA 3EVGA 1JL3A 1MO2A 2FEKA 1T2EA 5CURA 3QYFA 1A71A 1X38A 1FNBA 4LDNA 4LG1A 4MR8A 1JHDA 1YE3A 2GSWA 3LUHA 1USVA 2RJOA 1HXHA 2JCVA 5FI1B 2DQZA 5EPEA 4C0JA 2O7NA 1JQJC 3D6UA 3OCXA 4WTOA 5DW3A 2Q2VA 5C51B 3AQIA 4I9HA 4K9RA 3KOZA 4B3DA 4B7XA 1E7QA 4F8JA 5I4BA 3ZR4B 1GEGA 4DNXA 2JCSA 2E1RA 1D6JA 2PAAA 2Y1LA 3LYAA 2B92A 3K5IA 4KPYA 1E6WA 1QX4A 4Q12A 4FGUA 3CRQA 1L5KA 3MGKA 1UM8A 1TYDE 1TOAA 3OG9A 3PG5A 4IV0A 1N1EA 3K8ZA 1SJ9A 1AMOA 4P0PB 1TYAE 4E11A 1NF3A 4TWZA 1W0JA 4AYWA 3N2EA 2JD0A 3QXHA 1IZ7A 4JNKA 3F7TA 3CPEA 2W8ZA 4D1YA 1YV9A 1RP1A 1TKRA 3UMCA 1GOTA 2JHFA 2VTDA 2VR1A 3SKYA 1NONA 5I7EA 3VBEA 3DKIA 3QA9A 5DGTA 4MTCA 4C4PA 5KJ1A 2H4XA 1JIJA 4H35A 1BXRB 1LF0A 3H3XA 3CWCA 3HSSA 2WQ6A 1STOA 2VJBA 1L7RA 4CF7A 2WSSA 3UIEA 4EW3A 3GFPA 4YXWA 4DDVA 1T0BA 4EPWA 3UHAA 4IDNA 4JQZA 3N2GB 5LSAA 2ZB7A 4N03A 1F06A 1ZQ1A 3DT6A 4JQYA 4MVJD 5DTQA 2Z8YM 4EPTA 1Z8FA 3C4JA 3U5TA 1JAIA 4PGHA 4BFCA 2YJ5A 4BEVA 4BX2A <