4DDMA

Pantothenate synthetase in complex with 2,1,3-benzothiadiazole-5-carboxylic acid
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
molecule keywords Pantothenate synthetase
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
total genus 92
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddmA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddmA01
2BTEA 1WXGA 1YI8A 3A05A 3ILVA 2V0GA 2BYTA 3HFJA 4MUHA 1K4KA 3FOCA 1U0BB 1X6VA 3X1MA 4RUKA 3IVXA 3X1JA 1EFPB 1T6ZA 4MUFA 1FYDA 5HG0A 2CYBA 1MOPA 2WQ7A 1BS2A 3ND5A 1JIKA 2DETA 3PNBA 3KT6A 1O6BA 4MUNA 4MUJA 4UZEA 3LE8A 4XSVA 3GUZA 1JECA 1JZQA 4ND6A 3MXTA 2PFSA 3Q12A 1F7UA 2QTMA 3AFHA 2X0KA 1MAWA 4EG7A 3P0HA 3FETA 2CUZA 2GM3A 1YIAA 1PFVA 1XJQA 3IUEA 2PZAA 2YY5A 4XFJA 1R6UA 1N78A 4MW5A 2AZXA 2JA2A 1TFUA 2PZ8A 2XRYA 1NZJA 4FZJA 1WZ2A 3ZUGA 1MJHA 4MVWA 1Q77A 2A1TS 4KPUB 1MB2A 2X1MA 1QTQA 1LI7A 1QJCA 5KHAA 3KT8A 2CYAA 2GKSA 3CLTD 3RFFA 1QU3A 3SEZA 4KKVA 1LI5A 1IVSA 3I05A 3HZRA 3X1KA 3ZXIA 4YP6A 2PXHA 3MMXA 3SYTA 1KH1A 4MVYA 3DV2A 3ND6A 4JFAA 4CDMA 3N8HA 3IVGA 1O96A 3IVCA 1N2BA 5KWVA 1EE1A 3AG5A 3FY4A 3PRHA 4I6GA 2A1UB 4DDKA 4HPWA 5F23A 4ARIA 3ZGZA 4JYZA 1O95D 1O0BA 2CT8A 1N2OA 3RJZA 3SZ3A 1SURA 1A8HA 4MAFA 3FNRA 1OBCA 5FNZA 4MW0A 4ZCTA 2NZ2A 2A84A 4MW4A 1KQNA 2I1LA 2E0IA 1IQUA 1O94C 3SEQA 4DLPA 3IMGA 2DUMA 1N1DA 1GAXA 2HGZA 1N3LA 3ZIUA 1J1ZA 3HV0A 4R2LA 3RBAA 1EUQA 3P52A 1NUPA 4H3SA 1WOYA 2IJGX 3UMVA 4E1AA 3LCJA 1T9GR 3ZJVA 1G8GA 2QJTA 3VRHA 3MLAA 1Q19A 1PG2A 3Q10A 1M1ZA 1B6TA 3CVXA 3F3MA 1PG0A 2H29A 3CVWA 1YIDA 4EF6A 4R0NA 3TQOA 3P0IA 4YBRA 1CT9A 1WKBA 1KR2A 4OJMX 3TQIA 2A7XA 4QBTA 1TYBE 1J70A 1EXDA 4MVXA 2QUJA 4MW9A 1N77A 2WSIA 3FG9A 3D6VA 2Z08A 3CLRD 4S1OA 4PY2A 3DO8A 4XFDA 3JXEA 1Q11A 2E18A 2AKEA 2G36A 3L93A 4K03A 1O97D 1F7VA 4G5FA 4L2IB 5HUJA 1GLNA 3L92A 4G6ZA 1IQ0A 3FWKA 3KFLA 1N2JA 1F4LA 2QUKA 3A4IA 3OTWA 1NUUA 1DNPA 3UC5A 4ZT4A 1M8KA 2HMAA 1I2DA 2QUHA 3S3TA 1X8XA 3TNJA 4ZT2A 4MUIA 1VBNA 4YP5A 1QNFA 2DLCX 4RPIA 4MUEA 3A04A 4DJAA 1G8FA 1TYDE 5FO0A 2VTBA 3HL4A 3MUEA 5BNZA 1KAQA 3QE4A 4ZCRA 1XNHA 4DNXA 2J09A 3CA8A 2CSXA 3H97A 1O5TA 1V47A 5J58A 4EFKA 1OWLA 3CVYA 1M8GA 3HGMA 3AKZA 4EG4A 1XNGA 1F9AA 3FH0A 1H3FA 4OUDA 1GTRA 2J07A 2DEUA 1Q15A 1WXIA 1KP3A 3FI0A 1IH8A 1COZA 4WNYA 2D13A 1I6KA 1EFVA 1ULHA 4NAUA 3IOEA 3TZEA 4J75A 3COZA 3ZJUA 1KAMA 5TEWA 1ZUNA 4A91A 3NV7A 2YWCA 2XRZA 3FHJA 4ARCA 1FFYA 2CFOA 3RK1A 4ZT5A 1M8JA 1OWNA 3SP1A 4CQNA 3CLTC 1KQOA 2DPLA 2CV0A 3OP1A 2C5SA 1T6YA 4DDHA 4DE5A 1MAUA 4K0RA 4EGAA 3UOWA 4MULA 2IELA 1RQGA 4TS1A 4MWCA 4MUKA 1ZJWA 1LW7A 1K92A 2Z09A 1N2HA 5JBNA 2IP1A 1OD6A 3COYA 3UY4A 3CLUD 1MB9A 5TS2A 4ZCQA 3TS1A 5LFAA 4JXXA 3IOCA 1U7XA 3UK2A 4JXZA 1O95C 3DLAA 5H16A 1WJGA 4MWDA 1IQRA 5DK4A 4I6JA 1KH3A 1WXHA 3CLSD 1P7PA 3E27A 3IMEA 1VBMA 3K9WA 4ZT6A 3CR8A 1H3EA 1KKUA 4G5YA 1O96B 3Q4GA 3G6KA 4MW6A 3SZGA 2VXOA 4J76A 1JILA 3G59A 3ELBA 4EG5A 1J09A 4EG6A 2RD2A 1OWMA 2R5WA 1WQ4A 1YUMA 4DDMA 4EG1A 1H3NA 3N9IA 4EG3A 3KT0A 3ND7A 5DB4A 1MBZA 2YXNA 1YULA 1VBKA 1EFPA 1JEEA 3IUBA 4YP7A 1JMVA 3IOBA 3C8ZA 4NAHA 1I6MA 1R6XA 1N2IA 4NX2A 2A86A 2HZ7A 1TEZA 1WQ3A 1NI5A 3G5AA 4BWVA 4ZCSA 1JIJA 4NZPA 1M8PA 3RK0A 2J5BA 3FDXA 4GRIA 2ZUEA 1NUSA 3CLRC 4KR9A 4MVCA 4MW7A 3PNVA 1NP7A 2QUIA 5H7XA 4P2BA 1O97C 1GZUA 1K4MA 1MRZA 1WY5A 4ZT3A 5J59A 2A1TR 2JANA 1YUNA 4ZT7A 3TZLA 2TS1A 3BL5A 1I6LA 2J08A 1WXEA 1IHOA 1M8FA 4MW2A 4KPUA 3DPIA 3KT3A 4GU5A 2X1LA 1KQPA 3AIIA 1ZH0A 2A4MA 3AG6A 2RE8A 3H9BA 4CT0A 1NYLA 1QRSA 5HUHA 3IH5A 1ILEA 5K0TA 3VGJA 5LLTA 4QRDA 4U8HA 4F3RA 2OV4A 2OQ2A 3NBKA 3GLVA 4MQ6A 3PXUA 5KCMA 4Q93A 1TYCA 1GTSA 1S4MA 1IFXA 2WB2A 1NURA 1TYAE 1QU2A 2A1UA 1VLHA 2J4DA 2DXIA 3INNA 4KR6A 2WQ6A 2YWBA 1GPMA 4WSOA 2EJCA 4X0EA 3COVA 1H1TA 1JEDA 4U7JA 5IJXA 3IMCA 1TQ8A 1U7DA 3CVVA 1UFVA 4ZCPA 4Q16A 3FIUA 4JZYA 2DR2A 3N2YA 1KP2A 5TEVA 1OWPA 1QRTA 3M5WA 2VTBB 4I6EA 4R2MA 1KORA 2EL7A 4UZFA 4AQ7A 2AG6A 2JAXA 2X3FA 4KR7A 4QREA 4PBTA 3ISJA 1N2EA 1N75A 2ZUFA 2O8VA 1G59A 1OWOA 3D6UA 1JIIA 2O5RA 1G8HA 1Y42X 4EG8A 1O0CA 1V8FA 3H9CA 3GMIA 4AS1A 3PNYA 1T6XA 5EKDA 4CDNA 4OUDB 2PIDA 4F4HA 2E89A 3HMQA 5AHWA 4NATA 3QTTA 1EFVB 4MUGA 5IHXA 1O94D 3AL0C 2H2AA 3IODA 1U3CA 3VU8A 1EUYA 2QTRA 4MLPA 3CLUC 1PFWA 3QTBA 4NDAA 1KH2A 1HYBA 1NSYA 4HK4A 4HJRA 2A88A 2DERA 3LOQA 2CV1A 5DASA 5K0SA 1PFYA 1OBHA 3RHSA 1R6TA 1ZH6A 3CLSC 3K32A 1EJ2A 4L2IA 1QRUA 1M83A 5LM3A 1QQTA 3P0JA 2PZBA 2NSYA 2QJOA 3MLBA 4U63A 5FO1A 1J21A 1PFUA 2V0CA 1NUTA 3ZJTA 1JZSA 1MC1A 2D5BA 3U1VA 2CV2A 3A2KA 2QJFA 4ND7A 1WXFA 2Z3VA 5TGTA 3IDFA 2CYCA 5J5AA 3CVUA 3H05A 3COWA 4PBRA 3H99A 4YMIA 2D54A 2ZP1A 3NBAA 1IRXA 1U3DA 2E21A 1NUQA 1VL2A 1D2RA 2QTNA 3ZXSA 4MWEA 2PG3A 4MWBA 1K97A 2GOYA 1JGTA 2B7LA 4MW1A 4HJXA 1XNJA 1T9GS 3SDBA 1J20A 1GN8A 4PBSA 3N05A 1J1UA 1N2GA 1JHDA 5DEOA
chains in the Genus database with same CATH superfamily
1VSVA 2ZI5A 1WXGA 2FY8A 3ILVA 1VTKA 5FBLB 5F9FA 3HDJA 2JIQA 3O9ZA 2VSQA 5AM3A 3S68A 2WR8A 5EN4A 2O2IA 2PMKA 3NORA 1V48A 1Z29A 3QVSA 1WEKA 2EYUA 1XCJA 1CJUC 4OQPA 4MUFA 3E9YA 4PYNA 5KDLA 4C78A 4ETNA 1TQHA 3E7DA 3K09C 1V9CA 2C9DA 4ZGGA 1NE7A 1BMFA 1BS2A 4A8PA 3V2HA 1F3OA 3FX2A 4HHEA 4RSMA 2ID9A 3H2HA 4X6LA 1V1MA 2XCRB 1X1RA 4HNTA 1JHXA 1CQIB 1G16A 2ENUA 4U2KA 3RYCA 3L40A 1JZQA 3R5XA 5CW2A 3Q12A 5DBHX 2V0NA 1E5TA 3JQ8A 3QXCA 3QEOA 3Q3GE 2O1WA 2VJKA 9ATCA 1U6IA 2WFAA 2ORWA 2W6CX 2XGSA 4CKYA 1L4KA 4IVQA 1LKZA 1IY1A 3E22B 4Q1BA 4EENA 3OZ7A 2BFAA 5ALQA 4ZARA 5LQNA 3EZ6A 4UU1A 4DPKA 3MSCA 4WEQA 5I7RA 1M2WA 1QS0A 4GGMX 2CVOA 4O29A 2I34A 4Y1RB 4DV5B 1YJCA 3LVBA 1TFUA 5LWHA 3IQEA 1B4DA 3AFGA 2O8EA 4FZJA 1DKNA 2GILA 1U8ZA 2J3IA 2WJGA 3LUPA 1A9XB 2LIPA 4M98A 4BCDA 4K6GA 3HUDA 4TWRA 5F12A 3MCUA 1K0UA 3MIIA 4CUZA 3Q7SA 1UK6A 4BXOA 3HO1A 3FOFC 3CLVA 1IWOA 3GEIA 2GN2A 3MGAA 1XXHA 1GPDG 2DHQA 1XA3A 1WEHA 1C9YA 3T9FA 4UPDA 5EE3A 1WDMA 1RI3A 2VCEA 5TF4A 2HR1A 3OCZA 3PJGA 1SC4A 2NWQA 2X15A 5EHIA 4DEVA 1KDVA 2GUWA 5J2TF 4CVNA 1MQSA 1FU4A 2ODQA 4KN5A 3VAYA 4ZVUA 3ZE8A 4DQLA 4WOCA 1SKBA 2WSSD 2A33A 2DWQA 4YAGA 4C6TA 3QI2A 5DHFA 2HU8A 4U7GA 1EE1A 2F48A 3AG5A 4ZO6A 1XQVA 5D00A 4V38A 3ZNQA 1T5IA 4GL2A 4J2HA 4TWBA 3TXYA 3QPWA 1TADA 1RZRD 3QNUA 2QTVA 1XQ1A 4US1R 1FYEA 4DDKA 1NPYA 2GLTA 3DMTA 4HPWA 3UAZA 1EMDA 3VDQA 4TTTS 2WEKA 3AMVA 3EWSA 4OMUA 5AQEA 3BWDD 2GHRA 4JGIA 4RHFA 4B35A 4Q7MB 3ZLBA 3UB3A 3QE9Y 2JEOA 4ISBA 2CT8A 3C3XA 1CZOA 3HNRA 5BYBA 3GOHA 3DMGA 4YI5A 1MRSA 3LQRA 2NU8B 4YRLA 2QMEA 3RS4A 5CCXA 1HTTA 5GZ3A 4K86A 2PA3A 5ICGA 1GNLA 1ZRNA 4TLBA 1ZCBA 4JXKA 1SCQA 3BE4A 3UJAA 3OEED 2EFDB 2L0XA 4JYAB 3FRIA 4YRPA 3WBBA 3OE7D 2AYZA 5JJKA 3R23A 5KOJB 4P4UA 4AM8A 4ML3A 3EOBI 1TVEA 4PLVA 2VDJA 5ITZB 1JIVA 2WU8A 2WWGA 1J1IA 3C5WP 3NBMA 3STUA 4DNQA 2QTWB 3QE2A 1DXYA 2NV0A 2FSFA 1Z73A 4FVTA 3H9EO 3W6UA 2ZRMA 5C8YF 1OYWA 2PUAA 4HQ6A 4AS3A 1NNLA 1U1EA 4X60A 3ETGA 1O95A 5D5QA 3DTNA 1XCMA 2JJ8A 1SHUX 2O8CA 1YSCA 3HCDA 1FVOA 4IXTA 3ROMA 3CW2A 5JJCA 4IILA 2JI7A 2BKUA 2PWYA 2ZATA 4GOMD 5FR2A 1RYMA 3R9KA 1X9HA 1RBZA 1CP3A 2JD0A 1JAXA 1DBRA 4EEZA 1SXPA 1U28C 1H2YA 5AYVA 5JSHA 1MC8A 1N92A 1RHMA 3GLSA 3O4JA 2JBAA 4KXNA 4Y9TA 4F4JA 5J5VA 4ZAZA 5I7WA 5TQVA 2L82A 3HJNA 1JDVA 1SXJB 1OBFO 1C1DB 4ZXPA 2FAXA 1CUAA 3GMDA 5CB0A 4HRYA 5KEIA 3Q7RA 2NNLD 1N5KA 3WLSA 2ZRHA 4R3WA 4K9NA 1C3LA 3ZG6A 2NZYA 2FPWA 1WSWA 3WYCA 4AUMA 5HZHA 1C0EA 1EUDA 2V6IA 4UU7A 2F2TA 4H35A 3UYLA 2X13A 1II8B 1KKLA 2D2FA 2EJWA 2OYSA 2Z9DA 4G6ZA 3SC2A 3FWKA 5JXGA 4NY1A 5HGJA 3I92A 3KFLA 4YJ2A 1ABBA 5CT4A 2OB1A 2B4AA 2C4VA 2I6XA 1Z6PA 3DJYA 4FZVA 4O4IB 4DF3A 3COPA 3QKSB 2X6QA 2GPYA 3SYKA 1I2DA 4MGEA 3WGHA 3P5SA 5EMJA 3L77A 4OK5A 3Q8WA 2VYND 4LJYA 1BMDA 5GV7A 4DLRA 4EKDA 2ZJ4A 2WU4A 2FX2A 2JFFA 3WXMA 8OHMA 5FQNA 1Q7EA 4H7FA 1PS9A 1U94A 1XRPA 3SYNA 3VZCA 3D4NA 3D4PA 3A2LA 3KLOA 4ZO7A 1L4GA 2ZULA 2D5AA 1MTOA 2CL7X 2WK1A 3LX6A 3QSGA 4O4LB 4Z9FA 3SVZA 3QE4A 1ESZA 1RWKA 3DDWA 2JL1A 3MW8A 4DDUA 4JX8A 1E1NA 2CWDA 2QY6A 3EG5A 3A32A 3GT0A 4XI9A 3CE9A 4EFKA 2LCFA 3I8XA 2G63A 1BVHA 3NM6B 1R5OA 1FYXA 4IOJA 3HGMA 4EIWA 1PHPA 1DQZA 4FFOA 4RKFA 2I65A 5AKKA 4A2PA 2BI4A 3DMPA 1DAEA 3GBSA 1IXSB 1YIOA 4YIKA 1Z5GA 2PGOA 3DOOA 1QP7A 1IAQA 3EMKA 1K6JA 1OW3B 4DNPA 4YT2A 3GNLA 5AOBA 4WA8A 4UU8A 3N0XA 2EGHA 5JXIA 3FPGA 1KMQA 2HGSA 3PCXA 4HGQA 1W36B 2FR0A 2ZAIA 3COZA 2R8EA 2XGOA 3L7DA 5FUBA 1XZEA 3KZKA 4J0GA 3TKAA 5JFOA 1WZEA 3ER6A 3N7UA 4J90A 3KJHA 4H0NA 3SC6A 4MYSA 4NBWA 1YRQA 2PYDA 4EG0A 1VFNA 1ZMOA 2QT0A 1SIUA 3AJDA 4GSLA 4OFXA 2DPLA 2ARKA 4PYMA 5HIJA 3ZWOA 3V7UA 1RM0A 3VI4B 3EGXB 4HQ0A 2K4MA 3MF4A 1ULUA 4ZVSA 2JJYA 2X2EA 2Y1WA 4CT5A 2FW6A 4RFSA 4DCMA 1ZSVA 3P9NA 4MWCA 1UEIA 3SJUA 1RKXA 2GAOA 3OUUA 5CLHA 2X9LA 5ALFA 3SZRA 3A0RB 1U0OC 1TA9A 2DVMA 1Y3HA 3TLKA 1SXQA 1R88A 4YRSA 1OD6A 1M34A 3TXAA 1SOMA 4F1KA 1KI9A 2EWVA 3N2GA 3TNDA 3S1AB 3MCAA 1DFGA 4HOYA 3HHPA 3ZDBA 2IVFA 2VJAA 1TA4A 3PQ6A 4JB2A 4PONA 3SEAA 1EP9A 1S2NA 3LUGA 3LG2A 1VCIA 3ASZA 2OFOA 4R71A 5EP2A 2VKQA 2QKYA 4Q66C 4JJ4A 1J2TA 2VJOA 4X63A 4DJTA 4A23A 3NUGA 5AVJA 3E27A 1KPIA 2Q41A 2ZUWA 4ZN6A 3I9JA 4EGSA 2BJWA 4JK3A 3R9WA 1IXZA 2BHLA 3V5NA 4HQOA 3FKJA 2CNDA 3LQQA 2BHNA 3EEQA 2WE8A 3INTA 4JXJA 1L7EA 4C06A 4MR8B 5CH5A 3LFTA 3QXGA 2AUMA 2BFEB 4GYKA 3ADKA 3RVMA 2LMEA 2H1HA 4JV5B 4CZ2A 3HCPA 3W3ZB 2IHYA 3GFRA 5LUBA 5TRTA 5JCOC 4RTMA 5JZ9A 1KY2A 3EK2A 1EGQA 4FDMA 4K6CA 4YR9A 2NO9A 1XZDA 1Z35A 2GRUA 2ZIWB 4OKNA 4RGVA 5EVCA 3VX4A 1QR2A 1AXEA 2IE0A 1D2CA 2VI5A 3FKQA 3D81A 3ND7A 4LDJA 1YZUA 4QYXA 1CNMA 1TW3A 4RA6A 3PUYA 1LA2A 3DW3X 1MJFA 4WUTA 1PO7A 2ATXA 3OTGA 4LYEA 3CEPB 4NX2A 4IY1A 1U8EA 4R2KA 1LBHA 3MC1A 3UUGA 3CFHL 3P9RA 4BPRA 1R0RE 4D98A 4NHOA 1GZ4A 1NAIA 1QFYA 1ZJYA 3NAQA 3P2EA 4GBGA 4YN3A 1KHHA 2IGTA 4BNVA 1R4NB 1DPGA 1U6KA 2GRJA 3CTPA 3EXHA 1MX5A 4XEUA 4Y6GB 4E51A 1E8MA 1XI2A 4BWYA 1SUCA 5CM8B 3MTGA 3MOGA 2L42A 5AKEA 3LPCA 5E1DA 4BKQA 2G5CA 4D9IA 1NMZA 1JHUA 4HYTA 4OJQA 2HWWA 4NEQA 3TNFA 2YFKA 4L8WB 3QFFA 5EVJA 2OPHA 4ND5A 2ZR0A 4DDWA 3QA9A 2JRLA 1KI7A 2LIVA 4HUTA 3FLAA 4YCAA 4HH0A 4MP3A 1RRGA 1WM1A 3AUKA 1Y5IA 1HETA 1JG6A 2P8JA 2ZETA 4GPD1 3S7ZA 1HORA 3NANA 4A73A 4IEFB 4IIVA 1QH1B 1Z08A 3BF8A 1GFIA 3DHVA 3KTFA 1ZH0A 4GOND 2ZOSA 4X1IA 1G7CA 2C84A 4OGFA 5LP6B 2ECOA 3D2AA 2D1TA 4JBLA 3G0CA 3SXUA 2JAUA 1RXSA 1S8AA 5K0TA 5KQLA 2DRIA 3DZDA 2ETVA 3BL6A 3WLOA 3NFYA 1XMIA 4KI7A 5TJ9A 4D6YA 4TXHA 2ONKA 4EA6A 4NFYA 1MVOA 2BONA 1U0TA 1JHQA 3GLVA 1GGHA 2OFXA 4Q93A 3D4BA 2HMVA 2W58A 5IF9A 4P3KA 1GQ2A 4L73A 4K46A 4B4UA 5KYYB 3IUYA 1UBFA 2GR7A 1XHEA 5BVGA 3GD5A 1H2EA 1NVTA 2ZJOA 2J9FA 2QRVB 4XOIA 3A1NA 2NN3C 1M2OB 3A36A 2CLIB 5E9WA 2EJCA 4IEIA 4YRCA 3F5QA 1F2UB 3ETHA 4J0HA 4U7JA 1BJKA 1QIKA 3RVJA 3T3HA 5MN5A 4LRQA 4AN0A 4KJXA 2PZFA 4JI6B 3SGLA 1MC4A 4PCVA 4B34A 3NP9A 5K3OA 2JRCA 3D5TA 4L8FA 3HDTA 3WQQA 1ZOPA 3E70C 3MEQA 3HBLA 5CJ2A 4DHWA 4M1MA 4N5LA 1I0ZA 1GGEA 4N9WA 3I6MA 1FSPA 4HFJA 5KVAA 4MKXA 4KR7A 4QREA 2PSJA 4YAKA 1Z2EA 3AEUB 1SXJD 4TTIA 3G9QA 1LQ2A 4O4JF 5TXGA 3E48A 5JYEA 3A25A 4HPJB 4DT1B 3Q0IA 3UKOA 5F35A 2BGRA 1YBFA 4EMTA 2BKXA 2XHEA 3ZVRA 4HXFB 4BNXA 3EXG1 1OE0A 2MJLA 1X2EA 4Z53A 3D7RA 4P92A 1E5VA 4NIMA 4OFBA 1GPLA 1EJ6A 4TSFA 1VHJA 2DAPA 4GBED 3UXYA 4MGIR 2VT6A 2PAAA 1JI0A 3ZWXA 1YRBA 1TM5E 2I8CA 4RO0A 4OFWA 2LV8A 1OFGA 5NLLA 2BW0A 4BFUA 5FX2A 1T9DA 1XDGA 1EP2B 2QYHA 4XM0A 5IJ9B 1IUPA 4Y18A 4KC0A 3IODA 1IUNA 2OCIA 1V41E 2J33A 2XF8A 2XVAA 3A6EA 4RKQA 5F76A 3CXUA 4O1MA 4YASA 5I5EA 3CURA 3EGVA 2BFMA 2I4RA 2QPLA 3UMRA 1KO5A 5JROA 1R9MA 3DWGA 5UKDA 2AKAB 4BVBA 2B9EA 4ZDKA 2AX3A 3AUSA 4M89A 1OGJA 3AQIA 5A71A 5FH9A 2AF3C 3DS8A 4OBEA 4WECA 2ZM5A 3FPCA 4CMKA 4I1RA 3TE6A 1KGDA 3N7TA 1G20A 3BSYA 3SDZA 3ZE1B 1UMCB 3I9FA 3KQHA 1LY1A 2B83A 1VJGA 3KZXA 4LFAB 5G1OA 1P0FA 2B5OA 3SQLA 1HKUA 4ZMRA 1C9EA 4WESA 3EQ9A 5LM3A 2FW1A 5CA1B 4PGMA 3DLHA 3FBWA 4CCSA 2QJOA 1CZHA 5CNJA 5EJMA 3JQGA 1RZRA 2WYIA 1VZ3A 2Y27A 3OSZA 4U7HA 2M6KA 3DEYX 1PV4A 2Z2XA 4RACA 4G5SA 5DYIA 1NR7A 2V3WA 2QJFA 1PBTA 1RWWA 3U56A 4HH1A 2Z3VA 4ZV7A 3AFIA 2VH5R 2WV7A 4IG4A 4JR2A 5ECYA 1NMXA 1R6BX 1XZ8A 3LQYA 1SVNA 1NVGA 1EWTA 2JCGA 1L7AA 5A9TA 5JQWA 5FTKA 1W36D 1E3JA 4M1YA 2XB2A 1DT5A 3H1TA 2E21A 1E1CB 1NWCA 1KZ1A 4PHHA 5CGZA 3WTBA 3C5HA 2V1UA 2Z8ZA 2BMJA 3AGPA 5FEMA 1GDDA 1GYPA 3T1YB 1FFCA 3SDBA 1T9GS 1NATA 4URVR 1USWA 2O5VA 4LJKA 1FBTA 3HKCB 4UE6A 4URUR 3K71B 1GG2A 3N05A 4E46A 1E2IA 4G25A 5EZ5A 4C4XA 2I7TA 2NVUB 5BSWA 4F97A 1JHDA 2GN0A 3ADBA 3MN1A 1SY7A 2XVZA 2PRKA 5EYPA 1Z36A 1F5SA 2Q5JA 1P7YA 4PIVA 4E7OA 1V16A 3HUUA 4BIIA 5D3KA 4IZIA 1ECJA 1FYDA 1N2ZA 1TKRA 2IIBA 3SZOA 3L6BA 1W4RA 4CV3A 3ZD7A 4AKSA 3ONDA 3OO1A 3RASA 1TOAA 1E6EA 2IHVA 1HFEL 5TLSA 3RYHB 4KAJA 4DB2A 3O92A 1LJLA 5A4KA 5LQDA 4RLFA 1IZ9A 2KLBA 4DFDA 4ZQCB 1GZ5A 1JFVA 1CQJB 3GUZA 5AVZA 3RB8A 3MXTA 2XKAA 4L16A 3E58A 4TM8A 1JU4A 2P9GA 1XZIA 3NW9A 1OYOA 1U7ZA 1B26A 1F0PA 2I62A 2D1SA 2NU7B 1YIAA 3D4IA 3GJ0A 3PUVA 4IQ0A 3O4VA 3WBFA 4HTFA 4MV1A 3BGIA 3M6AA 2YC4C 1ZNZA 1DTSA 1NT4A 3N5KA 1Z9BA 3ZCQA 1XX6A 2WIAA 5T3UA 2VT7A 3PGA1 2AHRA 1G6KA 3HSKA 1D2GA 4HLDA 3SHOA 5KWSA 3FHTA 1O57A 4EZIA 1YOBA 2XRFA 5CJPA 6ABPA 3X1DA 4LRXA 1QBGA 4QUBA 3SN6A 3QA3E 3S29A 3H0EA 3LW7A 2NSJA 4EJMA 1C30A 1NIJA 1ZS9A 1T3ZA 2OOKA 2AI1A 1KI1A 3HY4A 3I6QA 1RYHA 3RFFA 2EQAA 4RF3A 1NFRA 4RL6A 1H8ED 3OOJA 3HB9A 1GEGA 1ZVVA 1ND6A 1O87A 4ARUA 5HRAA 2YTZA 4MVYA 1YZKA 1FX1A 2WD9A 1T15A 2OM6A 4C0KA 4PIMA 3GQVA 1X94A 5DBIA 5B53A 3ZGLA 2YS7A 4L8GA 2F64A 4QFMA 4Q9HA 5M7EA 3U3ZA 1XTPA 5AT1A 4UJ3A 5BOSB 1AHPA 4JWTA 3R7WB 4FJ0A 1NW8A 3RTDA 4H7PA 3M7IA 4KPFC 2KM1A 3HFSA 3IS3A 3A7EA 1AQYA 2HZBA 3S4YA 1DKUA 1HLDA 2XSZA 9LDBA 4CDRA 1TAUA 1P4HA 4GE3A 4Q02A 3CCCA 3WNBA 2A8YA 2VC2B 1X7ZA 1XVVA 2PT6A 5CA0A 3L7OA 4R7TA 4TN1A 5BQPA 2E4XA 4JLJA 4TKUA 3FNRA 4PW0A 4DW8A 5FNZA 1UK7A 2O57A 3IAXA 2ASVA 3HN6A 3KYDA 4U0JA 4YO7A 3T1VA 1MP0A 3U7EB 3U7QA 4MUMA 2R11A 1VPVA 2VUIB 3KBOA 3LP8A 2EOAA 3NYIA 1FXWA 2GLXA 2BMAA 1TCCA 3OU2A 1WZIA 5DTIA 4ZALA 1R0CA 2YRXA 3GH3A 4OP3A 1CUGA 1JXOA 3ONVA 5DH9A 2IH4A 3H2JA 2O6HA 1GTJ1 3DEFA 4BZPA 4BFLA 3NHKA 4P98A 4H3SA 1CPYA 1UP7A 3E0QA 3RLIA 3UMVA 3H75A 3QUCA 3DEHA 4KGXA 1YONA 1E9FA 4BGUA 1SCIA 2ZYVX 3ZJVA 2Z6QA 3PL1A 4RK5A 3DLTA 3TL3A 4TXNA 1UPBA 1PJ3A 3X1XA 4I50F 1BG6A 1B6TA 3KQWA 3LWZA 4RQAA 1PVOA 2GJSA 1HQYE 2GYYA 1YIDA 4QO8A 2ZEJA 2FCAA 3CVWA 3B52X 4FW8A 4OP2A 4C03A 2RHWA 4N7BA 1O6FA 4CIBA 3F9CA 2YL2A 4JB0A 3NPMA 2XGGA 2V7PA 1EFDN 1EVZA 2QGNA 4P6VF 2W4IA 5B4TA 2GPWA 2IHJA 4OU5A 4TMTA 3FGNA 1A4RA 5ALEA 1ODJA 4KK4A 5CW1A 4IJ6A 2O3RA 1QP4A 1JDUA 4K9QA 4Q9KA 4B76A 4OJKA 3BQNB 5J43A 4QELA 1ZD4A 5AXDA 3GNSA 4GP9A 4H4DA 3BWYA 4Y3UA 3DB1A 1RKBA 2D5IA 1OC4A 2F59A 1HG0A 3EIQA 3GFBA 2NO4A 3MMNA 1GU7A 4RBNA 5LOVA 2CUTA 1F51E 4HC4A 3PD0A 2A9OA 3P8ZA 2CDCA 1WMDA 2C98A 1IN8A 1PN3A 1YCGA 5HTKA 3CZQA 2OAP1 3GRFA 1MG0A 4YXWA 4A8JB 2G4LA 1SR8A 3OIUA 4TRJA 3VR6A 1J4AA 3WIUA 5K8TA 1UM9B 3TAXA 5ILOA 1IXYA 2EKDA 1E0JA 4YCJA 3E7XA 1V5EA 4DIOA 5A3JA 4ESEA 1AA9A 3ZWQA 1FTNA 3FB1A 3SJBA 1QZTA 3H6KA 1L1EA 1CRPA 1PL6A 4KVFA 2IYUA 4MPTA 1J56A 2Q3JA 4MLZA 1FOEB 1IATA 2G1PA 1GPYA 3TNYA 3VH2A 1FY2A 4CV0A 1HNXB 2D06A 2DJ5A 1A9OA 3DVAB 1USUA 4DGQA 1DP4A 4N18A 5TPZD 4O3FA 3TW6A 5A4JA 1TPZA 2EHDA 3BGWA 4V0KA 4KAAA 2EYQA 1E79A 4PFQA 2GR8A 4L1KA 2VTBA 4WN9B 1OOEA 4WERA 5TR9A 2H1LA 4XOUA 1YF3A 3VC2A 4YUWA 1KSGA 3GK3A 1ID1A 3RUFA 3S2IA 4N0PA 5CDTA 3PQDA 1CUZA 5KTRA 3UANA 3EZFA 4OHKA 3R75A 1QIJA 1US8A 3C85A 4TSRA 1IL0A 4H1VA 3L1UA 2FHSA 2XJ4A 4HAXA 2DQKA 1V71A 1QJ4A 4ADSG 1XR3A 2CDAA 4DV3B 2P90A 4O59O 2Q4BA 2KBEA 5H9WA 1KPGA 1N9KA 1VMEA 4IFEA 5ADWA 4C0LA 1ANKA 1XVLA 2B2NA 3KEFA 1COZA 5IM5A 1R4ZA 3GB9A 4MPRA 4TTPA 1Z3CA 4LSZA 2OC9A 1RRCA 1ULHA 2AFHA 3THYA 1DJMA 4OXQA 3P2IA 1KNQA 3WWDA 5ITWA 3PITA 2P2DA 4TTQA 1DG3A 1IZYA 1R64A 4DNFA 1SWVA 3OCXA 1OI2A 5FBHA 1VP9A 2PLWA 2PBLA 2HJSA 3H5OA 2AFIE 3F3YA 1LSJA 3RK1A 1OWNA 1GAQA 1YMVA 5IVDA 2IS2A 2HK6A 5LA6B 1IM8A 5FBZA 2GA8A 1NM5A 3T4XA 2X4LA 1XVUA 1WDTA 1AUQA 3E81A 3EA0A 3V32A 4A92A 1L7DA 2FPIA 1JWAB 4P7GA 4XDYA 3GJ8A 5D3MA 2AF4C 2VA9A 3FCOA 1KDYA 3KTAB 1A5AB 4UM7A 1RQGA 4I36A 1RWPA 2ZVPX 3TIIA 3OM1A 5IYZA 2QTFA 1UKEA 3RSOA 5KNDH 1JJBA 3JYHA 3LZDA 2XKBA 2OLJA 3I5MA 1DWOA 2EERA 3COSA 4ARSA 2BVNA 3RFUA 3WP0A 1E9RA 2IKSA 4BO1A 1IHDA 1Y8RB 4GGPA 3WO1A 4IRXA 2ZJFA 3I9OA 3I2KA 4EX7A 3AF4A 2D1YA 3RVKA 3PBKA 3BD7A 3C1TA 2I2AA 3UJNA 4GYWA 4QJ5A 3OKPA 3T9DA 1KYZA 2XAUA 3EFBA 4H08A 5JRZA 2JFNA 1JG7A 1K9VF 2Q3MA 3BB4A 3FLBA 2G77B 2IU4A 3ILSA 4NOKA 2UYCA 2TMKA 1XL0A 5DK4A 5DYNA 4IGFA 3GEDA 1RP1A 4I3HA 3VGPA 3JZAA 3KNZA 2XIQA 5DOZA 4CLOA 3K9WA 2YJ5A 2AMJA 3ND8A 4ZJZA 2PN1A 2YBEA 2KJQA 1E89A 2A0WA 2E9SA 4MW6A 4B9AA 3N3BC 3ADCA 3WV4A 2VHXA 1VDZA 1RE1A 1RYZA 2QG4A 3A1VA 4UAJA 5BQFA 3EW7A 3RANA 2ZI6A 1QH8A 1EDOA 4CMEC 1NVKA 3TLMA 1KQFA 4H6WA 3GPDG 1PR9A 2FP4B 3AH8A 2PWBA 3MYYA 4WXYB 1XZAA 2I3ZA 4ILEA 4NFLA 1KI6A 2C0CA 3G2OA 5DB4A 3EWIA 1YV9A 4Q03A 2JGJA 3BXPA 1NSTA 5DTRA 5HVNA 3IUBA 1WZUA 5ISMA 1AN9A 3UEOA 4MEJA 2F7SA 2X1VA 3E8SA 1SKQA 2C9ZA 1GEEA 3I6BA 4GEKA 2YNMD 3AZOA 3RBVA 3JRWA 4YJ3A 2GKGA 4XX1A 2QAGA 2JCBA 1WQ3A 1JKFA 3OD5A 4XH9B 4AYTA 3GY0A 1ST3A 2WVGA 3NO4A 4V2IA 1YR7A 2MHCA 2QX6A 4CG0A 3OE4A 2L17A 1MJGA 5K51A 3BFXA 2H7XA 4NZZA 5TJHA 1OZGA 1WCIB 2BLLA 1HE5A 4RD0A 1GCAA 1RM3A 4Q3CA 5I47A 5JD4A 1WB6A 5C7OO 4KK3A 1QRAA 2NZUG 3CPEA 5EWJB 2QUIA 2PT9A 2H6EA 1H05A 1PGPA 2OD7A 2GCPA 2WRZA 5L4LA 1NVDA 3JYOA 2FPGB 3ANYB 1MX9A 1J9EA 1N3BA 4ZT3A 4RVNA 4A1FA 4F3NA 3DDCA 5K0CA 4ZT7A 3AZPA 2JAOA 1PR4A 4P33A 3W8FA 3AKCA 1DKMA 2J08A 2H31A 4H3HB 3NTRA 1E2EA 3X44A 1OR8A 4CMIA 4XYLA 2HSWA 2P6PA 3HR7A 2QE6A 3ZHRA 2JIMA 1MG5A 2ZRDA 1DRUA 3C5VA 3BFJA 4X7PA 5EZSA 1NYQA 1J33A 2BP7B 1LBQA 5EC8A 1KY4A 3WICA 1OVMA 1ZN2A 3QEKA 3TECE 4M0MA 1P74A 1WCYA 4N7MA 5CTAA 4UNRA 5DKFA 1WRBA 2ZSEA 3H9GA 3NHWA 2K6GA 4DV4B 4WI1A 1UKYA 2H2FA 1PGJA 1W34A 3O8BA 3P9YA 4G26A 4OYHA 2FDRA 1NVMB 2QUZA 5KCMA 2I5PO 1ZA2A 2F3RA 1JEQA 1X3SA 2VPYA 5KQRA 2VDWA 3C7KA 4G0OA 2F9FA 2CLEB 3EZ2A 1TQ2A 3HDVA 5ELMA 1P2DA 1CDZA 2XADA 5EJ4A 4LFBB 1AQ6A 4RYLA 4EYOA 3I0NA 3P45A 1QGAA 2ZI9A 3CGWA 4HN2A 4CTKA 4CL2A 1E0SA 5DIFA 2TSYB 4GG1A 4JT2A 3WGJA 3WK6A 4JEMA 3GVCA 3WK7A 4MV3A 2V59A 4UBIA 1VA5A 3E4CA 1DHRA 1E2FA 1OPRA 2NNWB 3AB7A 1EB9A 2HWYA 3H19A 3WK4A 4DJJA 3EAFA 4Q16A 3UENA 3N0WA 4DN6A 3R44A 3EVTA 1TA0A 2AOUB 3A3KA 1KP2A 2ZBUA 3GL9A 5BSTA 4PCUA 2ZKLA 3JAWA 4B0OA 4Y9SA 1SCUA 2XVXA 3D3QA 3P4XA 5JJBA 1JALA 3GA5A 3U5TA 1QOZA 4YH1A 3PHIA 3GX1A 3W78A 2AG6A 1DEKA 3W8DA 1C8VB 2I4OA 2HWUA 4P83A 4X7MA 4E6PA 5LQKA 2V96A 3FTQA 5K0ZA 4PCLA 2XDAA 4KSCA 1EGAA 4TOIA 1ITZA 5CXXA 1X7XA 4BUZA 2R6JA 2GTHA 4MYTA 4OAPA 3VKWA 1EAYA 3EODA 1S2OA 1TTQB 1HK7A 2CHUA 3JVVA 4TLLB 1OZHA 1YDHA 5EJFA 1T0PA 1E69A 5K4AA 3WS7A 1T6XA 3C7TA 1E3LA 3IDAA 5E7JA 4NPHA 4C4OA 1M76A 1H4TA 1NLFA 1TLLA 5AKHA 5E7MA 1OZFA 4YY3B 3BMNA 3JWPA 3PFIA 4RTLA 5CG2A 3AR8A 3EUWA 3DBLA 3H8VA 2W70A 3KPUA 1JE0A 2BEWA 1YBVA 3PC7A 3CV3A 2C7GA 1XDBA 3ORSA 4MWSA 1ZUNB 4GDFA 3V8NA 2JFXA 3IAM6 1H4SA 2SKCA 4JNCA 4UD6A 1MORA 3EEBA 3LJKA 3DC2A 4CKWB 5IVKA 3UMBA 1VL6A 4QOJA 4JBYA 4KACA 1DKQA 3D7KA 1Q7CA 5CP8A 5BUSA 3B2EA 3NI2A 1FS6A 5AICA 1YQ9A 4YHBA 5C81A 3AI3A 3ZE6A 1FVXA 1GZVA 3F5DA 4EI7A 2IYOA 3AI2A 2XUPA 2JFWA 2NX2A 1CB7A 3C1UA 3QJ5A 1QE3A 3TGWA 3AHIA 2X86A 3QE0A 4AZSA 2E4UA 2WNSA 4LWPA 3ADDA 4I1IA 4HNSA 5EMLA 2AZDA 3KM0A 4BLUA 4UXIA 4QXMA 3TPFA 1DO8A 2OILA 5ICEA 3ECAA 2O1EA 3DL4A 4OXXA 3ZJTA 2JFUA 1ML3A 2A9QA 3TW8B 5JBIA 4OMDA 3H6GA 4J9UE 3T61A 4M21A 3U1VA 2WIBA 3CBGA 4CMJA 4UNQA 4F3KA 3M34A 3WWCA 3COWA 5C5EA 5LYYA 3OKAA 1PFKA 3V34A 2YJNA 4HNUA 3KAJA 3LK6A 3P4UA 1DC4A 4PZLA 4MKZA 4J07A 2ZYWX 3K73O 3R76A 1XRJA 4A2QA 4IINA 4FDTA 3M6FA 4EZEA 3MAJA 5C5DA 3K5WA 4ALIA 2EZ4A 5K3DA 1Y0BA 4B3RB 1C7IA 2LCIA 3GUVA 1PJ2A 3PSAA 3X0DA 4XWAA 1ADCA 1Z7YA 5EJ6A 1D7AA 1PTKA 3ST7A 3RFVA 5AP9A 3ZHZA 1OT3A 3D6MA 2EV9A 4LC9A 4W63A 4Z1MD 1KK1A 2E4ZA 3PS9A 3OT4A 1Q6YA 1SRQA 3PA6A 4WCVA 1N4AA 4AVYA 1ADJA 1RXVA 2GCIA 4FOSA 2VRCD 2A5GA 3RC1A 2FN4A 4HATA 1X1SA 3EPLA 3PZRA 1DB3A 3SI7A 1MR3F 3H1PA 4D9GA 4F93B 1JQ3A 3I1IA 2B6NA 4BNLA 1UXKA 3PUJA 4C87A 5TX7A 1ZUWA 2I99A 2X77A 2HF8A 4K0KB 4ZHQA 3QMPA 1ZHHA 4KQXA 3NG1A 1RWVA 1Y63A 1ZMTA 3CU5A 4TL7A 3I3OA 4QPNA 4Q4HB 4IIJA 1Y89A 2ATEA 2IPXA 1UT8A 2RDMA 2NQ8A 1T1JA 4UEOA 4M1KA 4K88A 1ZGBA 1JJAA 3REQB 4TWAA 2F3QA 3QX7A 3X3HA 2PFSA 3SBXA 4K9DA 4OJYA 3K5HA 4PLYA 4CKBB 4N8SA 2PH5A 1EFCA 1SG9A 5FA8A 5TVGA 3QU7A 4YQFA 3FOAA 1CBUA 2ZCVA 1B15A 1AX9A 1QQ7A 1XZLA 1DZ3A 3URMA 1R16A 1NX9A 3IUEA 1L4UA 4IJQA 4MEBA 2ZBGA 2N42A 2X7JA 5CFLA 1IU9A 1EM6A 1YR1A 2G9RA 2VUSA 4BYGA 3BERA 2OESA 4HT3B 4KRGA 2ZLBA 2VRWA 3ESAA 2PTHA 1O9BA 1UCFA 4UU0A 1RLMA 3X2EA 2C8KA 1N36B 5CLGA 1VL1A 1JSLA 1MB2A 5JWOA 2BD0A 8GPBA 4JLAA 5M04A 3ASYA 5LB2A 4DRZA 5EMMA 2GN6A 4Y9UA 2YX1A 3CLTD 3IDSA 4NV3A 1SCBA 1SBTA 2FW7A 1RLJA 3SEZA 2GBFA 2FKNA 3ZXIA 2GXSA 2PXHA 1NW9B 4XQGA 4I2VA 5CB4A 4CDMA 1HZJA 4X6UA 3TO5A 5AK3A 4XWYA 4ARAA 2TECE 1WWKA 2W2KA 4EDHA 1YCHA 1LPSA 1KS2A 4PSUA 1YH3A 1Z2PX 3K9NA 3PP8A 4JJEA 1IEXA 3GJ4A 4NCHA 3FCUB 1V7ZA 2PGNA 1P0IA 4RNDB 4AUNA 2C4KA 2HQ1A 3PT9A 4KXYA 2QX7A 1SHTX 5FLXA 3O83A 4MX8A 4B09A 2FK8A 1YZTA 3S70A 4P58A 4IF6A 4NH0A 3V9PA 2FR8C 1MMFB 2Y1LA 5SZJA 4E14A 1UJMA 3AY3A 4BUJA 4Q6BA 3VSBA 4QXQA 4RPHA 1AD2A 3C24A 3ESRA 5EIBD 3AYZB 4EW3A 4R2WA 5LN1A 4QVKA 2WHPA 1DBQA 4UULA 4UDXX 4F7DA 3EIWA 2PJZA 3FPKA 4BQFA 1J23A 2EFYA 3PTLA 3GWZA 2HIAA 1B6RA 4IR7A 4XDHA 1S2LA 4CU2A 2PUGA 3MWJA 4TKVA 2I7CA 2VAXA 1NUPA 1OFHA 1UMDA 2IWRA 1GNQA 2ZSAA 4I66A 2D59A 3AV3A 3EXEB 4IV5A 4OXYA 4L6CA 1BDHA 5ICFA 4QEZA 4CKXA 6AT1A 4AP6A 1W6UA 2R4UA 4XM1A 4YJFB 5U1PA 3Q10A 2YVAA 3BIOA 4KQJA 2QZ9A 4K9KA 5DWDA 1LUAA 5E9AA 3ESDA 4JBWA 4TVOA 3EWNA 2GPSA 4LY3A 4TLAA 5LSAA 3UV7A 2DGDA 2Y71A 1VPTA 5ALXA 5TY0A 4BVEA 4DMRA 4YPOA 4RF2A 5EIAA 3DUWA 3IQWA 4Q4JB 4WASA 3CCFA 2YHIB 4G0VA 3NMUF 1C1XB 1JQEA 1NFFA 1E98A 2C9OA 4L0CA 5IZ4A 3T1TA 2CF6A 4ON9A 4EY5A 3U61B 2GXAA 1L5HB 4FUQA 4N1AA 4P5DA 2FGKA 2CVHA 4P0PB 4B6RA 1QF6A 2Y1EA 1MDBA 4CLEA 3OJEA 1KJNA 4PVDA 2B37A 4FKMA 3N07A 1L7BA 2P4UA 4PY2A 2E1RA 4FFNA 4KQHA 4D8WA 1HE8B 4BVLA 1OLSA 3O7WA 3E5RA 2O2JA 1TU4A 3BYZA 4LG1A 4O2BB 4WLEA 4NG5A 4CE6A 4D4HA 1O97D 2W6JA 1VQ1A 4W9NA 3JAKA 1QC5A 2WKRA 1GLNA 4KIFA 4B6GA 5AHXA 4LOLA 3U5ZB 1WLYA 4UNNA 5IDVA 2AK3A 4R8VA 1R37A 2PRIA 2VZ9A 4MUYA 4N40A 4X1KB 4IIBA 3WSWA 3LL4A 2PLNA 2A9JA 4B3DA 1UINA 1MO5A 3DP7A 3HYSA 4LAFA 2EZ8A 1QG6A 4H16A 3LXXA 2P78A 1VI6A 3TD2A 2WIFA 3LBYA 5K3EA 2RGNA 1NBIA 3B5IA 3OF2A 4Q15A 4WCFB 3TNJA 1NW6A 3W7VA 4CYMA 2YBDA 2RC6A 2WAAA 1J8VA 3BAFA 1EE2A 3EAGA 4BZZA 5JVDA 2B2CA 2MR5A 4MV0A 5DTEA 1YHNA 2G07A 3EIOA 3EZGA 3G2KA 2IT1A 3QKRB 2AOVA 4YJ2F 3BEOA 1U8UA 2P2SA 4H9GA 4WTOA 2YNMA 1L5NA 3ZQ4A 3KL2A 3VO1A 1ODSA 3MUEA 3A14A 4OI0A 1JEJA 4Z2AA 1TXGA 3KOZA 1KAOA 1NJGA 2IXBA 4QNRA 2OAQ1 2J09A 3GGSA 3MBKA 4F45A 1J2JA 1YB6A 5AKZA 2C0QA 2Y92A 2CXHA 5KHLB 4L9SA 4NYJQ 4OLHA 3U60B 3SXPA 1OWLA 1DAFA 3B3AA 3KQLA 1WG8A 1DAHA 4WK4B 1JHMA 3SFZA 1ISMA 2B8TA 5DI3A 4IX1A 2HRDA 3IEXA 1CLEA 4FMDF 5E95A 2VH1A 1T25A 4NJEA 4ZICA 3R8CA 3C3JA 1QBKC 3IJEB 1KVUA 4YXFA 3SFTA 1T2DA 3FB4A 1HZZC 1JSRA 1XELA 2JGDA 4NL4H 1WR8A 2XTJA 3AILA 1R3DA 2IHBA 3GEMA 3KEGA 1A5SB 4RMGA 5AHRA 5DFAA 2XPCA 5KNDD 1W5SA 2JCYA 1I2AA 3DOJA 4ARCA 3QFRA 2C00A 4BC0A 1MHTA 5EHQA 1M5TA 1T6BY 1W85B 4PPNA 5G2OA 2YJ6A 2JF0A 3BMOA 3CF4G 4Y6OA 2AQIA 3JY6A 2BN4A 2Y05A 1EVJA 2PKQP 3QXJA 4IDEA 1OFUA 3V8RA 3UTDA 1FYWA 2FSVC 3WMWA 3WK9A 4LHWA 2G72A 1KO4A 5KX5A 1MAUA 1LSUA 1YD7A 2G8NA 1KTVA 2AXEA 2I2XB 2ZUTA 3SX2A 4D42A 1DJNA 1G3RA 2EW2A 4MULA 1Z26A 4B8WA 6REQA 3LRTA 1DTWA 4CEHB 1VPEA 1RPNA 2BKVA 3VSEA 2PNJA 4MQEB 4S0XA 5C3MA 3GJYA 2H92A 1TGVA 4CEJA 1PNRA 4CKCA 3QRWA 4O3MA 2J6CA 1H6DA 3GOQA 3W05A 2YC2C 1EDEA 5JSZB 1KO1A 1PQ4A 2CJPA 1E5DA 1Y48E 1Y82A 2WJYA 3U3KA 3IIEA 4IYJA 3UY4A 3GELA 4JUDX 5GJWC 2W8BB 1M54A 2YCBA 3UJHA 4IQ4A 4MI9A 2JFOA 2YWHA 3DMDA 3K8ZA 3A3NA 3OJ0A 1MC5A 4DV1B 4QOFA 3FBTA 4YCLA 5EKTA 4PXSA 4OQDA 1U4OA 4F1JA 3KG2A 1QLJA 1K63A 4D0SA 2JZCA 3LUKA 2O2HA 1QHHA 1AVTA 3CR8A 3GPLA 1KKUA 5E7QA 3G7SA 2G06A 1BE6A 2PZGA 3G6KA 2FMHA 1NOIA 2F3PA 3BWXA 3QLVC 4J76A 2CLOB 4K9MA 4X85A 2AQKA 1E2JA 4EO7A 4UOZA 2FG6C 5C37A 5IARA 4RSRA 1GV0A 2Q1UA 1ZISA 4LE2A 4GM0A 2VTDA 1U1CA 2FSPA 4FBGA 5EZ6B 3H4MA 4I9UA 4QGFA 3WYGA 5JAZA 4EG1A 3UV6A 3F5FA 1PJAA 3GBVA 3G0BA 1R9NA 2VNSA 3OQBA 4ZC8A 2ISQA 3H2KA 4YV7A 2HB6A 3GNTA 1GKYA 3P0EA 4Y0VA 4YTEA 3RT1A 3GG2A 3EEOA 2BH9A 4YP7A 2UVPB 4IXDA 4X3PA 2P91A 3S55A 1ZVKA 3C70A 1S89A 2EKQA 1UODA 3OF3A 4GZ3A 3FF1A 4J29A 2JAPA 2FWRA 1Q0SA 2HZ7A 1TEZA 1YKSA 1CP2A 1ECFA 2NU9A 3RTCA 1Z2CA 3HXKA 4FQ8A 4X20B 1XRLA 4XYGA 3C3AA 4WKNA 4ZCSA 5KMGA 1E3WA 3S5JA 1F8FA 1B2LA 1XKQA 3FDXA 4WY2A 1YBMA 3VNVA 3RC3A 2GD1O 4YT8A 2OV6A 3HNOA 2YXLA 2C2GA 4HMPA 4LJ6A 2IOYA 2R1VB 4FMCF 1UC8A 7ADHA 3RS5A 1RAIA 3PNVA 4GPTA 1JQBA 4FYHA 3TH5A 2W71A 2QRLA 1AKNA 1IHPA 2AJ8A 3PHCA 3EAQA 3U7RA 3S6JA 2VXCA 5CLFA 3DBHB 3HWSA 4OF4A 2OSBA 3BXXA 1B6SA 1KEEA 3KZOA 2H4WA 4XA8A 4KPUA 1E2QA 4DWWA 2Z5VA 3RU3A 1Q20A 3H04A 4XXHA 2WF6A 3DUFB 3DPSA 2HA6A 2P2GA 2HFJA 4ITVA 5F7OA 2BGLA 1IY2A 1ZP6A 3IH5A 2IDKA 2VBCA 1VL5A 1MJGM 1IONA 4C43A 4PX9A 3EH2A 3RJ9A 5E1BA 4I1VA 3JYPA 4OOFA 5JH7B 2QR3A 2ZI4A 1K5HA 2QF7A 2GZRA 3FWHA 4JUCA 4ZI3A 1CEXA 1ZLYA 2P11A 1M1YE 1KYVA 1XQ9A 4AD8A 4AICA 3QKWA 3WO0A 4K6OA 3PNOA 4P1ZA 1S4MA 2K2QB 3NYWA 2AX4A 2OHJA 2WFMA 4QXOA 4LPKA 3WLFA 1VLHA 3KV1A 1XZFA 4KTTE 2KS6A 5B7NA 2DXIA 1EFHA 2IS1A 4CETA 3BWBA 3FGZA 1SBQA 3P9KA 2C54A 3ORFA 2CW5A 1FZTA 3SSAA 1DKLA 4HYYA 3BHNA 5IHPA 2FOLA 5HKKA 5HKAA 3NTLA 4FD3A 3IAS1 1SZPA 4PLPA 4DQ0A 3FKSA 4Q7KA 1EBBA 1GPUA 3GMTA 3FVQA 1UBRS 1O6CA 3B82A 3UPDA 3VVCA 4CCYA 1VCMA 4HG2A 4UARA 4G1FA 5GIPE 3AFOA 3M3HA 3Q6IA 3EPHA 3WAGA 1AOXA 1TU3A 2JAWA 1P4RA 1DCMA 1BHQ1 4I81A 1CJTC 3B3GA 4ARVA 4MQ4A 4I55A 4B7UA 2EJUA 1ZFNA 3QF4A 2Q6LA 1JIIA 4WBSA 1D2AA 3L0BA 2ZJ2A 3OFND 4BVHA 4EUNA 1EIWA 2A5DA 2WINI 5CDFE 1FMLA 2BPOA 1XYVA 2H9IA 4FYJA 3O3OB 3GMIA 3M89A 1P0MA 4EHIA 1PR2A 1RBYA 4XLTA 1VIYA 2BRUC 1WP9A 2E6UX 2WJWA 3DONA 5EEGA 1NVXQ 3ZCRA 5CVUA 4B3MB 4RW0A 3RRMA 5IZCC 1WKCA 3THXA 5DWQA 2PVPA 4PPFA 1CS0B 2A5JA 3JVEA 2IPMA 3A1TA 2C2YA 3NOOA 4EFLA 5H8WA 1U90A 3OFSA 1KJ9A 3V8PA 3HJFA 1Y5MA 4FB4A 3ONNA 2CNLA 2ZXUA 4KYUA 1PT5A 3E5MA 4PHCA 2WI8A 4OB6A 4RV4A 2VSYA 5B2ZA 1XLUA 2P6UA 2IP4A 3F4BA 3L0PA 2ZBRA 4X93A 1MAHA 1VE5A 1A8UA 4POAA 4DTIA 1WVMA 2A88A 4ZZ1A 1HWYA 2GLUA 3DZKA 4X61A 4F92B 1VCOA 4ISCA 1CETA 1OI4A 4X3CA 2VSNA 3QNWA 1VLLA 5ENZA 5LWQA 1UIRA 2GSWA 2BFPA 1KVTA 2DF8A 2VDOB 1SBHA 4IZ6A 4DCGA 5CPFA 1Q3TA 2QDXA 4UTZA 2BLNA 4FE4A 1MRNA 4MCIA 1EJ2A 4XX0A 5IAEA 5MGNA 3MQ4A 4BVGA 5FL7A 4B2LA 1Z7GA 2CLSA 4C30A 2CDRA 3L1HA 4FYYA 3L7AA 3KP1A 3A9TA 2RAPA 2OXRA 2UYYA 5GQSA 2IQIA 1BN6A 2PKWA 3MLBA 3N28A 1ONOA 2QNIA 1HBJA 1ADFA 3SD7A 4GUAA 3U1TA 3U9LA 4BKOA 3NDPA 1QSGA 4URFA 5BORA 1JZSA 5HRCA 3OFVA 3AGQA 2VJLA 4N5NA 1THMA 3X1ZA 1PKEA 721PA 2P41A 4E2ZA 4EO9A 4MNTA 3ZE7A 3EOAI 4I4TB 4IWNA 4MQFA 4E5YA 1F14A 3L1JA 1C9KA 4HNHA 3GZTB 1HRKA 1R8SA 3GVPA 1OLXB 4OQYA 4EATA 1GFZA 4JEHA 1I6WA 1RLIA 1KMIY 1KDOA 3RV4A 3T5GA 3V4SA 2WZQA 2FP3A 3WJ1A 6NULA 1EWVA 1IOLA 3D5QA 3C3DA 1J8YF 1GCGA 4HDSA 4Q05A 1BH2A 1F8XA 3I04A 5ENVA 4XD7D 5CX1B 4ZP1A 1ONBA 2NQTA 3F4KA 1XD8A 5TQ2B 2Z8YA 3EQ2A 3BULA 1RYBA 1WVIA 1DC7A 1CJKC 2QIPA 3IIMA 4KV7A 1PJLA 4YJKA 2NTYC 1CVLA 3KTOA 4CM1A 1YFLA 4NCAA 2QLNA 2Q3CA 5DEOA 4R81A 5K3FA 5IPFA 4AZ3A 1QFSA 3TQHA 2EDAA 2Y1GA 1M2HA 4KE8A 5IKPA 1G60A 1M33A 3PFFA 1XTTA 1A97A 2OEPA 3IC5A 4DDVA 4L85A 4OXKA 3A4VA 3CSSA 3DZIA 4WNCA 4O6VA 1VJCA 3X1JA 4EY4A 2GVDC 1T6ZA 3D8NA 2C2XA 3CJTA 1OX4B 1DO0A 4JJIA 4W82A 4DLZA 5KOHA 3QW2A 1U7PA 8MHTA 4FNAA 4M1QA 2D74A 2XQFA 2PH1A 5BMVA 8ADHA 2H7VA 3BHIA 4HDCA 3CT4A 4XCXA 3ZR4B 1NBEA 1RP7A 2GARA 1KVQA 1LF0A 2W43A 3E7WA 1QYIA 3K2IA 5D7BA 3D6HA 1FJHA 1N3IA 1P2TA 4G41A 1F60A 1QFZA 4XSVA 5F21A 3C97A 2GEUA 3RRJA 4ZOLA 1FU7A 1Q0LA 2C7BA 1B0UA 2R8RA 1YA4A 1JHAA 4G09A 3O90A 4IXNA 2OCXA 4JJ8A 3CPHA 4YMVA 1DC6A 5KJFA 2P27A 3RAEC 3CUVA 1AUXA 1OC2A 4DS3A 2YN2A 3E03A 2YY5A 3HADA 4GE0A 4MYUA 1GP2A 3WA6A 5ALZA 3SHTA 5G0VA 5B58T 3WHPA 5BXYA 2O19A 2NAPA 3FMOB 2VDRB 1QGZA 5CYFA 4HVAA 4JCCA 3HYCA 5TF0A 2RGAA 3DDZX 3ORRA 2RK6A 3ZUGA 4HWSA 1GSOA 2IRWA 4MVWA 4V3BA 3VC1A 1BXRB 1FSFA 4X1YA 4AWBA 3HKDA 4Z2YA 4D3SA 1IY0A 1M0SA 2XNSA 4XPIA 4J1TA 4E22A 1N8KA 3AF6A 1J2RA 3RF7A 1PJTA 4HPXB 4FEGA 3VU3A 1X8KA 3W6OA 4EYQA 4N3NA 3KOYA 5ALHA 3PUXA 3QVWA 1QRTA 5FNVA 1LRLA 1AXRA 3L5OA 5BV8A 2R97A 1KK3A 3G7UA 2FJPA 3IOYA 621PA 4X8OA 1M6VA 3WRYA 3JZFA 4C4RA 4NEGA 4XGIA 1Z74A 5GM2A 3RU9A 2JGIA 4D82A 4H2DA 2GPAA 4MA5A 2AKYA 4WVFA 5CVVA 4HYQA 3U19A 3WDSA 1QUFA 3KJFA 2HBQA 1SUWA 3K9HA 1C0PA 4TXMA 3TZ6A 5BSFA 4C0XA 3QX9A 4B4OA 4DC9A 5I48A 3PWZA 4L3OA 3A9VA 3UZUA 4E13A 4NOLA 1L7MA 1PL0A 3OIGA 4JENA 4LYHA 3I3SR 2IYNA 3DE7X 5JUWA 4B3TB 3VAZA 1WQ1R 2GN1A 5GM1A 1QE5A 1GQSA 4B4DA 2ZYGA 4IMPA 1SURA 2P75A 4YMGA 1G8MA 4RHYA 3R0JA 1U9ZA 4N7JA 1QWOA 3V7FA 2PZLA 4TUYB 1UKVY 2EX0A 2V6GA 2GEKA 2QLMA 5DISB 5LYJA 3GP3A 3HJRA 1VJTA 2CHVA 3AR9A 3GLUA 4NCKA 2E0IA 3SKXA 3WLLA 4LF8B 3QEAZ 4LKOA 4LVCA 1PLKA 3KHKA 4IOKA 4EVSA 2PMEA 4E30A 4NBRA 1EUCA 1XXHE 3DHYA 4I4CA 4RDIA 1C4KA 2WAYA 4TZKA 3T1NA 4D3ZA 1KMNA 4XPZA 3BK1A 5CA0F 1MPXA 4ZYYA 2J4FA 1S3IA 1BHJA 1FK8A 2XQKA 2ODPA 5ETJA 1Q1AA 1YVPA 2SKEA 4LW8A 4GPIB 3R3VA 4MKFA 3PTAA 1N8TA 1ZU4A 3RYTC 2P0AA 1QHEA 2MSWA 3F3MA 3KB6A 3KYCA 4HI0E 1FXWF 3T95A 1KJQA 3VDXA 4D74A 1Y9EA 4A4DA 3P0IA 4RZ2A 4AJHA 2W2TA 3M3PA 4A26A 4YBRA 1I5RA 3RHZA 5LD2B 1V8OA 1E64A 3LY7A 4GOLD 1EFUA 4FJ1A 4JD5A 2H48A 1QMGA 2HMUA 3DGEC 3KE9A 3QHPA 3DFMA 4FD2A 3V7YA 4D3FA 1LLQA 1ZVQA 3EA4A 2F3SA 4NE9A 4UUAA 5ALPA 4XB1A 1OREA 3Q7EA 4FBMA 3F73A 1V95A 3R20A 3W5JA 3MAGA 5DPMA 4AURA 4DAEA 3WY9A 4ENWA 2XODA 2PR2A 3P97A 2IYZA 4RHXA 4P0QB 3OCJA 3FCEA 4IUYA 4Z3DA 2KB0A 2KBFA 3N58A 1AUPA 4W6QA 5TPWB 4UTOA 5HCIA 2C42A 5JD3A 3TVDA 3L7JA 1HC7A 2FMFA 4JU9A 4FHCA 4D3YA 1YNSA 4QDTA 4RQUA 4HDNA 2R6R1 4LNUB 4F04A 1YQQA 3MMSA 5E6UB 4FQ7A 1IQ0A 3WXBA 1WUIS 5FUYA 4UEQA 4FU0A 4FYIA 5G0SA 3I5XA 3QLTA 3CX3A 3MA0A 1KZGB 1A9PA 1GRQA 5B1HA 1H93A 1RW4A 3D2BA 3IUPA 3HM9A 3HXOA 4Z4GA 3S3TA 4E5SA 4J3JA 5KDDA 1RLTA 2BC9A 1KZHA 1CUEA 1Z2DA 3TSYA 1YQGA 3LHIA 5JMPA 3ZDZB 4XJSA 1R0ZA 3O4RA 5HR5A 4F0JA 1A04A 4ZWNA 3O26A 4IDAA 2YUTA 3IUQA 2WTMA 4RX1A 5SYNA 4DJAA 1NVEA 3DDUA 3P9QA 1VHDA 5G40A 3AUTA 4GSYA 3RAJA 4D8UA 1GUBA 4KEAA 2FQ1A 1I33A 2MDTA 2FFQA 5BNZA 3KYJB 5AOAA 4DA6A 3CZ9A 1TVMA 1XNHA 3LSTA 4KAXA 5D3QA 4LNHA 2XBLA 1Z6YA 3RS9A 5A4IS 5JZSA 1PP4A 3CA8A 3WB1A 2OAEA 1W6RA 2UDPA 1SKMA 5J58A 4REQB 1NQWA 2CNKA 1G41A 4ZAFA 1DEAA 4LDRA 2PUWA 5AW5A 1QK4A 4CFSA 4DC1A 4EMBA 3O1LA 1BW9A 3V4FA 3Q3CA 3AY7A 4NJOA 4JLNA 5H0IA 3GZNA 4F91B 1TD9A 3RH0A 1PJCA 2WUDA 4G23A 4LGCA 4F2PA 2AVDA 3AESA 4Q4CA 5A9SA 2VZEA 3E61A 3KQKA 2HLHA 5HXAA 2AD1A 5IBRA 2CXPA 5FTLA 3L4EA 3OJXA 2FPUA 2YHUA 1B8UA 1C8LA 1PVDA 1EIZA 5JZVA 1KF0A 2QSJA 3QV1A 2UYQA 2WM3A 1IBSA 2MSEB 4P9NA 4YX9A 1COWD 1V45E 4Q01A 4D02A 1ISPA 2F3UA 1GZ6A 1KBZA 5BN3A 4NTZA 4PAQA 3QK7A 3HJTA 4HAYA 4V0SA 3RYIB 4EBFA 3K3PA 4ZDJA 1LVUA 3IHTA 4BN0A 2CCKA 2ZRKA 2A9KA 4D6PA 2E5LB 1P1BA 4IIDA 2D1FA 1OY1A 1TK3A 4U6SA 2DY0A 1H5UA 1VHWA 4JAVC 1N3YA 4IIYA 4MUKA 1DCFA 2O0MA 4YAOA 5J2TB 1M0TA 2Z09A 3BSSA 1P45A 4YBZA 1FP4B 3A26A 1PFGA 2IQ5A 4QBHA 5J2UA 2I1QA 4C6HA 3L9WA 3GRKA 2GZ3A 2VWHA 1QAOA 1YHYA 2QX9A 3D6NB 3OQHA 4KLRA 3BBPA 4MKIA 2B4TO 3CLUD 1MB9A 3Q1LA 1TUIA 1X7YA 1JP7A 2J5KA 4G2NA 4HQFA 5AHKA 4LVUA 1U2DC 2CDBA 3VDNB 3UK2A 3VR2A 5A06A 4JXZA 5L7WA 4HDKA 4L27A 5CX4A 1U3WA 3IAEA 4LJSA 3QU5A 3CNOA 5HS4A 5BWOA 1QHIA 5IYZF 2Z4SA 2HNAA 1JJFA 3MJHA 4IH9A 2QORA 4PC6A 1FFWA 1BN7A 3DWFA 2H63A 3AUYA 3HMKA 2JJ1A 4Q6WA 3CLSD 4EKEA 1Q22A 3I5YA 3R0XA 1NVUQ 3MILA 4UD2A 3W77A 1Y81A 3SJCA 1S96A 4QASA 3DXZA 1TU0A 2FRXA 1O96B 1U5BA 2IYAA 3HB5X 1Q1NA 1XRNA 3L05A 3OC0A 1NXSA 2IFTA 3QPCA 4U7TB 3WB0A 4BP3A 1NHGA 2G9ZA 2C2OA 3M1YA 1ZI6A 4BZXA 1OXKB 3IBGA 4YV0A 1U2ZA 3O4IA 3N75A 2R5WA 1ZQ9A 4RTJA 2Y2VA 4EGJA 4DDMA 1V9LA 4Y7DA 2PUCA 1NF2A 1TKCA 3UT5B 121PA 3U09A 5CAEA 2EZ9A 2HDHA 2NUAA 1Z62A 2IXEA 3DR3A 4P8RA 4IDBA 4RGQA 3OPXA 3H16A 1K86A 2DKNA 3HKEB 5FRDA 5AM2A 4XIYA 3K8OE 3NEPX 5EUCA 1HYGA 1P81A 5F4BA 3T4EA 2CF5A 1M34E 5C8YB 5IAGA 2JFBA 4LMAA 2RHTA 5JD6A 1DLIA 3O1IC 3F8WA 4UEWA 4DLXA 3V7NA 5JYDA 1RC1A 3VR1A 4LYJA 4HP8A 3G5AA 1SVMA 3B60A 5A2GA 3O21A 5E3HA 1AKRA 3F9RA 4FFBA 4PF1A 1G3IA 1TM4E 3BXFA 3QU4A 1SHZA 2GNAA 3BFPA 1WZNA 4LHZA 3S40A 1UBHS 5CDHA 3CLRC 4AECA 1E3SA 3WL3A 1QDLB 4K6MA 4G07A 4MS3A 1CEEA 3GJ6A 1BO6A 5P8WA 2QU7A 4Y7CA 4KN9S 5H7XA 3TQQA 5LNK6 4M38A 4GS5A 1WY5A 2FZLA 2GA9A 1R74A 3C4VA 4YJ3F 4HX5A 3VTKA 1FFSA 1YUNA 2C9CA 4WACA 3VPGA 4IDQA 1RRMA 4J49A 1P72A 4F11A 5F5NA 3MTQA 1BKYA 1TYZA 1NR5A 2O7VA 4FC6A 1KA9H 3V4PB 3DVRX 3K9GA 4HDRA 3KSAC 1ZR4A 4ZFNA 5IU6A 4IVNA 3O8CA 2B5VA 1E4EB 2IYXA 2N0SA 2C3UA 5TDHA 1NJ6A 1BX0A 4Z4EA 1MNQA 3WNCA 2VHEA 1E1LA 2HIGA 3VR4H 3TTYA 4KDCA 5I7FA 4O4LF 1UOOA 4L3VA 1QRSA 1NYLA 3GGOA 2JD2A 1Q3HA 2FEWB 5EIOA 3QLUA 4WDRA 3T6KA 3ZHTA 1D03A 3RS0A 3SLKA 1Y6FA 2BFBA 3PCTA 2H1OA 4ZZIA 4CIAA 4PSKA 1D0VA 2OYRA 4KX3A 4S1NA 4PG8A 4OYRA 1C7FA 5E3IA 3GJZA 2W83A 1T2AA 1YI0A 4JC0A 5I7AA 3HA3A 4UDNA 4B32A 4CQMB 3LC1O 2FWIA 2PGXA 2P3QA 3UFXB 3ZQKA 2YW9A 4D4LA 2MMCA 3OM0A 3VR3A 5BUCA 1TYCA 5ABPA 1SB9A 1F6WA 2B30A 3GLGA 2ISSD 2X0FA 3O31A 2I67A 1QYCA 4CF7A 3HRHA 1QU2A 2A1UA 1W73A 3JWIA 2PX0A 5K2OA 3DKKA 1QPBA 1Y3CE 4KR6A 3L4BC 3U3DA 1XLTA 1NXOA 1YBAA 2AFIB 4GZ6A 4GP6A 5DRTA 1L5KA 4LF4B 1WMBA 2R6AA 1GR0A 4M2LA 4PANA 3T3IA 5LXTB 1T8SA 5AW3A 2CXOA 1K5PA 2BHRA 4YWJA 1T8RA 3I61A 4IDHA 5LXTA 1CUYA 3O2SB 3G1UA 4K40A 5FWXA 1AUVA 2O8BB 3P5BA 2HUNA 1G4AE 2DE0X 1O5IA 3FSRA 1Z7BA 1Y4AE 1WP4A 2L19A 2OTCA 1UKCA 1XZQA 2J6BA 1UFKA 2J7PD 2JAXA 2PTGA 3SF0A 2O3SA 4M4SA 4ZJUA 4RH1A 5BN4B 4EHFA 1NC3A 3BD9A 4FR5A 3JATB 3E2MA 4GQIA 1LV7A 1N75A 4JUFA 4WK0B 4A16A 3ZY3A 3AR6A 2RHGB 1D4ZA 1CSEE 2ZIUB 3KR1A 4TKMA 3KUXA 2ZRBA 3FYUC 4JC8A 4MJLA 4Q3BA 2BMWA 5DXAA 5DTJA 3W7BA 1B1CA 1QO0A 2C96A 4FIZA 4BKPA 1JKJB 1QHYA 4M9CA 4CDNA 4KIJA 4ZODA 2AXPA 1EG2A 1WHTA 2A5FA 1DAKA 1H2HA 1E7QA 2R751 1E63A 1NW3A 4F4HA 5ANRB 1GNPA 5FOXA 5A4DA 3IVMA 4CIYA 1ZJJA 2XB8A 2JDIA 3KOXA 1CVIA 4C0HA 2IY9A 1JHZA 3W6ZA 1EK6A 4UHJA 2W00A 1LI4A 1NPTO 1VE9A 3BJZA 3DMFA 3HPQA 4QC2A 4R40A 5B57C 1HL7A 1I9CA 1QLHA 1W29A 2HBYA 1M72A 4ALMA 1UBTS 3V2UA 4DLKA 1NNEA 1NT2A 1U1DA 4MHSA 4OMCA 1A9RA 3J7TA 4NCBA 2NZWA 5DLYA 3TIFA 3W1EA 1QIHA 3FNIA 1E66A 4D3XA 2Z3ZA 3T5TA 2AN5A 3DT6A 4IF4A 5KTTA 3F5SA 4TYYA 1H0SA 1M1NB 1Y4ZA 3C7CB 1BVRA 1JG1A 3B20A 3FCCA 1Z18A 2JGFA 2RI1A 4KXMA 5D2CA 2BSXA 3SLGA 5HZKA 1QQTA 1W2WB 1HFWA 2H4FA 4JBHA 1VE7A 3ZDYB 4UNPA 4YUYA 3QXHA 4G9EA 4B48A 3MERA 3JALB 1BNCA 3FTPA 2VZ0A 1LSSA 4OVKA 1WW8A 1O94A 1LF5A 1TNDA 4F6RB 2AFRA 4QGBA 3LY8A 2IXGA 4JQZA 4LPSA 1DEHA 3WNDA 4MRRA 2GXQA 5IAKA 1ZJ4A 1QVVA 2P2CA 5H4HA 4JJAA 2JFVA 5DLDA 5I4BA 4YMIA 4RKEA 1I8TA 3NNDA 2WE7A 1M6NA 2VP5A 3ETJA 1ADGA 1D0IA 2RCYA 3EZXA 3JCZA 4QUDA 4UUNA 1N6RA 3R8XA 4JOBA 4ES6A 2X6RA 4EFNA 3SR3A 1U8XX 3RSHA 3PXGA 1Z45A 5HJEA 2ACKA 3AERA 4OSPA 4PLZA 4UHEA 5BSHA 5C0OE 3AJAA 4OHMA 4F5EA 5JTUA 3RVDA 1J0CA 1QFJA 2BBSA 2IL1A 3EF3A 1FUKA 2G16A 1II0A 1D04A 1NWHA 2A30A 3FHLA 3K2QA 3M6LA 3O3CA 3A9SA 4FI3F 1G20E 3CRZA 4Q4DA 3QU2A 2ZSFA 2Q1YA 1S2MA 3DG9A 4MITA 1K0FA 4M9RA 3HL6A 4TV8A 3FOCA 3EGOA 3CPSA 3DO6A 2FB9A 5C80A 3FWNA 2WTUA 1HTWA 4WZBA 3EVCA 3PRYA 4A7PA 4XLZA 2VN8A 1EFPB 4HR7A 1H0KA 1PD0A 4UXHA 5H1YA 4XRGA 3KLNA 1LPNA 5HG0A 3LBNA 1XVAA 4OO3A 1RQ7A 2IIVA 3MRTA 4F8EA 3FSGD 3KB1A 1G9XA 1KYXA 1ZC3A 2G4VA 1IN7A 3PNBA 1ND5A 4MUNA 1TM1E 2HD4A 3QMVA 2JLQA 5EQFA 3COJA 2Z1NA 3SVTA 1CS4C 3LE8A 1U8AA 4Q4AB 1EWYA 1GGKA 3I04M 3TLBA 3WHLA 3JRXA 1Z0JA 1AO3A 1G4UR 2HCFA 5BQ5A 3U39A 1Y1KE 4ZEMA 2IXAA 5FV4A 3RYFA 1II9A 1AO0A 3RS8A 3C2QA 1CVRA 1M2GA 1SBIA 3N3AC 5B3KA 4JI5B 1R4MA 3FHCB 4YAFA 3IV7A 2QBYB 3TRDA 4DXHA 4Y2RA 3L46A 4KXFB 4ZHQF 3W4JA 4R1UA 1E99A 4RVFA 3NVAA 3SQDA 3W5IA 1PJZA 4ENPA 1BEUB 3V1NA 2ZBFA 4Y6SA 3P0FA 3RGGA 2F4NA 2PZ8A 4FX2A 1DL5A 3D02A 4GPAA 3ZOKA 4EJ6A 1I13A 1RMQA 1RXCA 1CLUA 3EVDA 3FAKA 2P9HA 1W4AA 1QTQA 1FFXA 2X41A 1T2UA 2BFOA 3E3OA 2GEDA 4BZQA 5BVHB 1QJCA 2EFEB 4GAEA 4JLKA 2YR0A 4C7VA 3UQZA 4IM7A 1JYEA 2VKTA 4O2LA 4F72A 1F17A 1FPMA 1V1RA 3W3AA 3UK1A 1VIDA 5B5SA 3I05A 4Q9NA 3X1KA 5J1SB 4MQLA 1T43A 1RR6A 2QDKA 2X5JO 1J49A 3K2EA 2C20A 3M5DA 3G5MA 3O9MA 4UVEA 5FTNA 4CG2A 3IR7A 1P4SA 2PJRA 2VRBA 4GM4A 2JFQA 2XD4A 5LMCA 1WSAA 3O91A 3NJ4A 5DF1A 4EHHA 1XK6A 4MB2A 4ENSA 5EJ2A 1VYHA 3DEZA 5KYUB 3GA0A 1Z22A 4OB8A 2FW0A 2GUGA 3EIUA 4AX8A 2I6FA 3DAOA 4FYXA 1IPHA 3DVSX 2C9BA 2ZIXA 3PEVA 2HYIC 2QSUA 1PLLA 2XA2A 3ANLA 2GZ1A 3EA5A 3UC9A 5IKXA 4M0FA 4O4JB 4RZQA 1T9BA 3CW9A 4IFTA 1W19A 2YMMA 5BQ3A 2H8KA 3WFIA 2PUVA 3Q3VA 2O6LA 3ZVLA 5CB4F 4P31A 4P4NA 3VUEA 4DWJA 1H0RA 1VLQA 2OHGA 1JLSA 3CXRA 1OLUA 1ORTA 1SBNE 2JJ2D 2VEOA 4LBWA 2FN9A 3GG9A 1W2HA 1Y7IA 2NZ2A 4PGGA 4ND3A 2BL4A 4V03A 4XJXA 2A5YB 1AA6A 1ORRA 3NTUA 4QU9A 3ILHA 1CUIA 2C2BA 3KE8A 4P7FA 3HGQA 4CU5A 2V7GA 2WIKA 4S3MA 3KDSE 2CK3D 3C3BA 3IBFA 2QV7A 2AN4A 1COWA 1XCGB 1IBCA 2VNJA 3HY6A 4KYIB 4M7OA 4Q3DA 5K6RA 3B48A 1UBCA 1FUEA 1EQ2A 1UDXA 1DUSA 3OKFA 2C07A 3DSRA 3BJIC 2Z2YA 3LY9A 3MLAA 4DSNA 4UQPA 1VL0A 1H2ZA 2GHTA 4CQMD 2QQEA 3PUWA 2F62A 5B2EA 1LTQA 1Z6ZA 4U7PB 5KVCA 3PFCA 4GR4A 1NW5A 2IGBA 1KSHA 1XZHA 2P79A 4XLLA 1JJ7A 5LQRA 2YIJA 3CKKA 3PKZA 2HHCA 3NPAA 3RRBA 3SCZA 3JARA 3W2FA 4RA9B 4OJMX 5HKBA 1OA0A 3PK0A 4XM2A 5F1YA 3UGKA 4XWGA 3UKJA 4PYRA 5HF5A 3R09A 4YAEA 5IEBA 1NASA 4QBTA 4JEUA 5B1DA 1SA0B 3D6TB 4RK1A 5CTJA 1IZ8A 2QUJA 5KNCA 2WM9B 2VHQA 1N77A 4CTMA 1HDEA 2C3MA 2OFWA 3BCRA 2XA1A 4QBKA 2PX5A 4M8IA 2GCOB 1JLLA 2H7CA 1SU4A 3JSAA 4FC7A 5KOIA 3JXEA 4IDOA 3TIVA 3TSWA 1J8DA 2X0IA 3R9XB 1UXOA 1GM5A 1T4CA 4IGIA 2XI4A 4RXMA 3UWOA 4C6RA 4G0ZA 2CVFA 4I1YA 1W52X 4TROA 5AO9A 4BMYA 1PU2A 4MV5A 4EPXA 3ADPA 3L92A 5I6DA 2V45A 1AURA 4CLDA 3F71A 3UHOA 2HTEA 3HZZA 5JI3E 2P2NA 2C94A 1CY7A 3THRA 5TT0A 3UK6A 3VMMA 1EWKA 1LQUA 3CEJA 2HAEA 1X14A 3K31A 3M8KA 3OCUA 3PIRA 4HWPA 4DMFA 1ZAYA 4IVPA 3AVUA 3VM6A 4KREA 1U2GA 3VR5H 4E5VA 1A3CA 2QM8A 4DRXA 4QNMA 1R2QA 4JJ7A 4UMDA 1TZKA 2C78A 4ZAXA 4BQSA 5KREA 3R6DA 1W4BA 2GETA 1B41A 2I87A 3K05A 4L75A 3JQ7A 1E60A 1WOMA 1T13A 3VYVA 2IZZA 5E2IA 1LCIA 4G1EB 2ESRA 2HHHB 3EZNA 1H4VB 4OHZA 1SUDA 4XTRA 4JP8A 1P0CA 1GVNB 4UASA 5I9TA 1OT5A 3S5UA 2WNHA 4IRMA 1K6MA 1A4IA 1HYQA 4P82A 3M4JA 3P71T 4HZUB 4LQLA 1SH7A 1MB0A 4XYMA 2ECFA 4LJ5A 5DNEA 1CF2O 1NAHA 3B3JA 1JPVA 2XR1A 1WW2A 2O0JA 4NVRA 5JVDF 4DCTA 2LWIA 1KK0A 5B4UA 2MINA 2P77A 1M2EA 2XITA 1XTUA 3G0IA 4D9NA 5BWCA 1VI2A 5DJ5A 2C83A 1TZJA 3DGFC 2O2YA 3JSXA 5IK2D 4TMZA 4BLWA 2FPLA 3T7TA 3ORHA 1I6KA 3OPQA 2Y66A 2OCLA 2RHCA 4MS1A 4DKJA 1YC5A 1LV8A 3OOSA 1I7NA 3N2KA 3H1GA 5KKAA 3P9CA 3UTCA 3ZWMA 4C0SA 5LZ4A 1KEWA 3W90A 3H2GA 3F98A 4RPLA 2CFCA 1RCTE 2XRZA 3RSSA 4EGFA 3A27A 1TL7C 4L5JA 5JIBA 2MSNA 1N5MA 1UDCA 1Z39A 3MGBA 4LHYA 3TRKA 5I7VA 5AIBA 4U39A 2I9PA 1MT3A 2ZRNA 5EE5B 5CLIA 4Y1FA 3IURA 1NGSA 4U2GA 2OUKA 3AETA 4OXNA 4G8BA 1JN0A 5L53A 2ZIEA 3EFEA 2GZDA 3KKZA 4IGKA 3U4DA 4YMSA 2QJWA 2P9JA 3MWDA 4V0MA 4ZRDA 2IDMA 2Y1KA 3N76A 1A1SA 4M88A 1SRRA 2ZU6A 4RETA 5IVIA 1TCBA 1BKSB 1Z0KA 2RAVA 1A98A 2WJJA 4H0CA 2OZKA 2ZU0C 4RK4A 4WW0A 4ALLA 4JT8A 4FFLA 3BXOA 3STXA 2EXXA 2Q2OA 2ZYUX 3CVJA 4EA8A 4JLMA 2E82A 3BRCA 1WMEA 3RARA 3AVWA 2D8AA 1C9DB 2GTPA 1RWNA 3KZVA 2QRQA 1E59A 1GRNA 4S1TA 4NULA 4E4YA 4R1NA 1X7GA 1PIWA 2FMUA 2NQ2C 3ZNNA 4AFNA 1QAMA 4BQIA 3IEMA 1JIXA 3KXKA 3ZWPA 3KVVA 1HQDA 1YDMA 1TPYA 1WJGA 3IOMA 1Z63A 2I91A 2AMFA 2OBLA 2FMKA 1W4ZA 1Z2AA 2AFHE 2B3TA 2L69A 2OCPA 2VAMA 3AEQB 3DFIA 3PXDA 3W5CA 9MHTA 4FFPA 4JH0A 4JL6A 4DIUA 3PFNA 5BYAA 2ZW9A 5KTOA 1XMOB 3A7DA 1Z0FA 2YH2A 2YJGA 4MWGA 3VU9A 4A9AA 3NTXA 1H3EA 4EL5A 4BO5A 1AV7A 1FRQA 2EEPA 1P0PA 2ZB4A 5CFOA 3IO3A 1PR3A 3TM4A 3WL5A 4BLVA 1UK8A 4PRLA 2WTNA 2AUTA 3F6PA 2IEYA 1GHTA 3KDPA 4CKEB 1WQ4A 5C31A 5K8IA 4FLMA 1BRTA 3N9IA 1OXUA 2OCKA 1OUMA 1HNNA 1T26A 2C82A 2VDUE 3KJIA 2AWOA 3BCSA 3GRRA 1CNEA 1B8OA 4OP1A 2VYCA 3DDNA 4DA7A 1YULA 2PYIA 2V54A 4O8ZA 3CEMA 4QNNA 1R6DA 1ZNQO 1DC5A 1FQOA 1VRCA 1W4CA 3MPOA 5EKSA 4BJ1A 1PGQA 5M5BA 4I50B 4MZDA 1C4OA 3WBJA 4A0GA 4YUAA 4F86A 2P4SA 2CVPA 5GGXA 5A04A 1QIGA 3DV0A 4UEKA 1T2FA 2R7LA 4B5LA 4GWGA 1XRQA 4I8XA 1GKLA 2I54A 5JNUA 4BIMA 1JH9A 3FYUB 4AKTA 3KZ1E 2QL5A 2J5BA 4Z8XA 1NQVA 1VFPA 4RPGA 2ZB2A 4TMVA 2UZ1A 2DSNA 4FOOA 4C21A 2PXXA 5A4FS 1T4DA 2VLIA 3CONA 3VR4D 1LD3A 1KJWA 4DC0A 1ZIOA 3BIJA 3UMYA 1D5WA 2P9CA 3GLFA 1GZUA 4HSEA 3F3SA 1O7JA 2PUJA 4ZDIA 3EPKA 1K6IA 2O0KA 3FYDA 2JANA 4LBVA 5AQ1A 3RDPA 4DJEC 2RBEA 2X42A 4D97A 4BFVA 2C97A 3SIRA 2RJ3A 1F0YA