5A0TA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
total genus 146
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0tA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0tA01
2YNVA 2I7TA 5HIQA 1KO2A 4Z60A 2BG2A 5ACQA 2Q42A 3BK2A 4UA4A 3DHAA 5KIKA 2BTNA 4O98A 1QH5A 2YNTA 3R2UA 4UWOB 3PY5A 2ZWRA 2WYMA 5AXOA 1YCFA 4Z67A 4Z6XA 3FCZA 2YCBA 2FU6A 3RPCA 4C1DA 5HIOA 2ZZIA 2ZNBA 1SMLA 5B15A 5K4KA 2BFLA 2BIBA 4EXSA 5ACUA 2BFZB 2UYXA 2GFKA 4ZEJA 2FU9A 4UWRB 4U4LA 5A5ZA 4P62A 5K4MA 5B1UA 4D1VA 5LCHA 4F6HA 2BR6A 4ZNBA 2BFZA 4D02A 2BG8B 2GCUA 2QDTA 1HLKA 4YSBA 3IOGA 4V0HA 4KEQA 2VW8A 2GMNA 5LCAA 1KR3A 2YZ3A 3T9MA 4DILA 4F6ZA 4XWTA 4TZBA 5EW0A 3X2YA 4EXYA 3IE0A 4PVOA 2BG8A 4TYFA 3F9OA 5EVBA 5EVDA 1A8TA 2Y87A 4NQ6A 5ACRA 5AEBA 4RL0A 5K4NA 4TZFA 4WD6A 4D1TA 3X30A 1QH3A 2M5DA 1A7TA 4AD9A 4YSLA 3AF6A 2GFJA 2NZFA 4Z7RA 4C1CA 2WRSA 3VPEA 5FQCA 3G1PA 1X8IA 2QEDA 1JJEA 4AWYB 2WHGA 1BVTA 4B87A 4FSBA 5FQAA 5B3RA 2A7MA 3A4YA 2NZEA 2NXAA 1WW1A 3DHCA 2FK6A 1JT1A 4FR7A 4J5HA 3ZQ4A 3VQZA 3IOFA 3KL7A 2YNWA 3KNRA 5AYAA 4C09A 5EV6A 2FU7A 4D1WA 1DXKA 5HH4A 2DKFA 5EV8A 3I0VA 2Y8AA 5ACVA 2I7VA 2FM6A 1JJTA 2OHHA 4H0DA 1M2XA 2Q0IA 3IELA 4HL2A 2QINA 3H3EA 5EWAA 2GKLA 5A0TA 3BK1A 4HKYA 5HH5A 2BMIA 4ZO2A 4D1UA 1K07A 4UWSB 5AXRA 3IEKA 4UAMA 2WYLA 1ZTCA 4AX1B 4EFZA 5LSCA 1VGNA 3SRXA 5LS3A 5ACXA 2R2DA 2Q0JA 2P18A 5A87A 3BC2A 3PG4A 3I14A 4C1EA 2AIOA 2CBNA 2OHIA 3ADRA 2FHXB 3S0ZA 3SPUA 3ZNBA 4RL2A 2BC2A 3I13A 5AHRA 3AJ3A 5KILA 5EH9A 4J5FA 3LVZA 2BG7A 1BC2A 4GYQA 5FQBA 4XWWA 4C1FA 5LCFA 3I15A 3ZWFA 3Q6VA 4PVTA 2XR1A 4TZ9A 2FHXA 1VJNA 1ZKPA 2WYMC 1MQOA 3RKKA 1XM8A 5LM6A 2XF4A 4TZEA 5ACPA 1YCHA 3T3OA 3DHBA 2BFKA 1DD6A 4BP0A 3IEMA 2YNUA 5HH6A 3IE2A 4ZO3A 2BG6A 2BGAA 2FU8A 2I7XA 5A0VA 1VMEA 2P4ZA 4UBQA 5LLDA 4C1GA 3AF5A 5DPXA 3X2XA 2P1EA 4C1HA 4NQ5A 4NQ4A 4RM5A 4EYBA 4KEPA 3IE1A 4TYTA 3X2ZA 4GCWA 4LE6A 2E7YA 1DDKA 5K0WA 4EYFA 1BMCA 5AHOA 2NYPA 4HL1A 4RAWA 3JXPA 1L9YA 3P2UA 4Z5ZA 2HB9A 3RKJA 4GYUA 4AX0B 5LE1A 2AZ4A 1WUOA 2M5CA 5ACTA 3I11A 1WUPA 4AWZA 3BV6A 5HIPA 2QJSA 1XTOA 4CHLA 4RBSA 3SW3A 1YCGA 3PY6A 2H6AA 4EYLA 2QDSA 5EHTA 3TP9A 2Q9UA 4UWPB 4EY2A 4NQ2A 4JO0A 2ZO4A 3ESHA 4RAMA 1WRAA 4DIKA 3QH8A 1X8HA 3FAIA 3SFPA 1Y44A 3T3NA 2P97A 3L6NA 2OHJA 3SBLA 3SD9A 5LMCA 4FEKA 5HISA 1ZNBA 2Y8BA 4XUKA 2DOOA 3ZR9A 5ACSA 2YNVB 4Z5YA 1KO3A 3KNSA 5ACWA 3DH8A 1X8GA 4YSKA 3WXCA 4BZ3A 2YNTB 1P9EA 1E5DA 5IQKA 5EVKA 3MD7A 3IDZA
chains in the Genus database with same CATH superfamily
2J46A 4F45A 1LWNA 3AF0A 2AS0A 5KI6A 1T0IA 4AJPA 1E2QA 3C14C 4PIPA 3WYFA 1VM6A 5DSXA 5KX5F 3UHJA 1Z0UA 3G2KA 1M1NB 1QTRA 2HHHB 3VYRB 2OMEA 3EODA 3JQ7B 5DM70 2W6MA 1JAIA 3QBEA 3RE1A 3L9XA 1RVV1 3PC6A 2FI1A 4MPRA 2AXQA 2V6JA 2FHSA 2BTNA 1B0ZA 4FOSA 4N6NA 2H5JA 5BOSB 2G08A 1SXQA 4K6KA 1ZUIA 3AVPA 4KUHA 3ZK7A 5HJ5A 1SPBS 4NK5A 4W4TA 4EKEA 1XUOA 1KFBB 5ILGA 3ZVRA 3FCZA 4MRRA 1EK0A 2CJFA 3OPYI 3Q5GA 4BY9E 2VJPA 1C4OA 4Y2RA 2Z2KA 3ABIA 5KCMA 3RPCA 1YB2A 2XGSA 4L75A 2ZAYA 3FTCA 2HB6A 3ZE1B 4DUGD 1HL3A 2XUFA 3GP3A 5K4KA 1FK8A 2VPTA 3G7UA 4F4FA 1FNBA 1SC1A 2ZETA 1BMDA 3IFSA 3G0IA 5SYMA 4CZ2A 1YZGA 1SZJG 4JFAA 4KRFA 4MCHA 5B4UA 4MZXA 5CCDA 3R8CA 3KT6A 5LJLA 1N57A 2C8JA 1NPTO 1PDOA 3BXZA 4I08A 1BHQ1 4CKZA 3LX4A 1Q0LA 2C03A 1RR6A 2VBCA 3BSWA 4J6FA 3D43A 3IUNA 4MS3A 4S2EA 3CA8A 4X1KA 2IHVA 5HRCA 2WTBA 2CXXA 1I4WA 4H31A 4HDNB 2XADA 3FKJA 3BJRA 1E4EB 3ENZA 4JXXA 2H1IA 4MAMA 5ACUA 4UBMA 4M0FA 3KHKA 1RRCA 1L8LA 3C3MA 1G5TA 4DJ5X 2GFKA 5IC5A 4OQQA 5DLYA 1CDDA 4D96A 1SUFA 4LYGA 1M8GA 4AQ7A 3JAMA 5K6RA 2FEKA 3ZG6A 4AQDA 1G8HA 1NOJA 3WK8A 2ATVA 3K0AA 3F6SA 1SB8A 4N39A 4EF5A 4XWAA 2BUAA 1MDBA 2N9UA 3I64A 4B7UA 4NZZA 1XPJA 2GD6A 4IHKA 1KI2A 5KVVA 4MUYA 5LA6B 1UQRA 4JHXA 4C03A 4I1YA 1E7YA 4CUZA 4JEMA 1GD1O 1RM3A 2ZYGA 4P5PA 3T9AA 1UBHS 3TINA 2GK7A 5FX2A 5KSYA 4G9BA 2UYHA 4FMBB 4UU7A 4K0KB 3DT9A 1P4RA 2EJBA 4DQDA 2R00C 4Z3DA 5DYGA 4FT2A 3DYBA 2O48X 4IMIB 1KMHA 2YH2A 4KXFB 1XM8A 3MCVA 1IEVA 5KS2A 1BMQA 1QHHB 3ZIDA 1RYEA 2VDRB 3IQWA 3M4XA 5GV8A 4UDYX 3CTPA 2GMNA 1JI3A 3Q12A 1O58A 2ECFA 3GLGA 2AQKA 5L9AA 4XYMA 5FR2A 2R1ZA 3ITDA 4Y1RA 1AGPA 1UDCA 2IITA 5MGNA 3H1PA 3X1ZA 5K1ZA 1Y8CA 2P5SA 1ACJA 4S0XA 4UNSA 4X66B 3CT4A 2PH3A 1JEQA 1FF9A 2WJ6A 3BIOA 1WHSB 2BHTA 4P54A 4BCDA 1OX4A 4PIVA 5J5AA 3WWYA 2YC4C 4H7IA 4QNNA 2VUUA 3DEFA 4J9VA 4L50A 2XD9A 4JBIA 1I4OA 3A32A 1XPOA 2FZWA 2Q3EA 3VKFA 4MW4A 4Q3BA 4BFVA 1C7IA 4YRSA 3SR4A 3EGDB 5KINB 3EPLA 2GO1A 5MN6A 4CEJA 5BURA 3OQPA 4U3JA 4GM1A 2H16A 2OAGA 2QXTA 1DAPA 5EIBC 2Q6LA 3GEEA 5JFTA 2GZMA 4RL0A 1PR0A 1OZGA 2XUOA 4NABA 4RMGA 3GRYA 3H86A 4AJ9A 4CETA 1M6HA 3ZUPA 4HGOA 5JD5A 5KTRA 1RRPA 3VPSA 1N1MA 1THTA 4UUOA 3SICE 1ECJA 6YASA 5HCUA 5HSGA 5LMNB 2JJYA 4XYBA 2WQ6A 1F1BA 3ELUA 1RYFA 1EGMB 2AN3A 3ABQB 2CK3D 4NV3A 4D8VA 3MELA 4AZ0A 4M1OA 3WLLA 3Q4GA 4MGZR 4MV3A 2AC7A 2VFAA 4V38A 5IPFA 2QRNA 1O2DA 4B6FA 4CDMA 2C4HA 3I37X 3PV0A 3L0OA 3QKUA 4FHFA 5BORA 1FMJA 4Q19A 3L1KA 3MRSA 4AD9A 3VAAA 1PEDA 3J7TA 4EQZA 4YJ2B 5KNCA 4CF5A 2XECA 3BXEA 4LV6A 4XIYA 1RACA 2H00A 4HNQA 4PYKA 5ALEA 4DBLE 4EPWA 4TV9A 4EJ2A 4YACA 1EXVA 1ZNWA 4DR6B 4R84A 2P4HX 2WHRA 5JYDA 4G65A 1KH3A 1XTIA 1L1FA 3VYSB 5TX7A 1YDEA 3PNYA 4OUDA 2CFZA 3O9VA 4Z3OA 2Q4TA 5AMXA 2HBQA 3QXHA 3G1PA 2QM8A 3CPSA 2YV2A 1GU7A 1VSTA 1JP7A 2UVDA 1MENA 5FHRA 5HQTA 2BJHA 1BG6A 1E2UA 1NASA 2A8YA 3JQAA 3JQPA 1PR1A 3T7JA 2I0FA 3FDJA 4Z9FA 4PG6A 1HORA 5EVJA 4L02A 3SY8A 5B6IA 1DJMA 3HXTA 3G8BA 1YL6A 3LSYA 1H66A 3TLGB 4A8HA 3AWDA 1OTYA 2EZTA 3GEPA 1G17A 4QRHA 2BHRA 3A2MA 3H3JA 2TRSB 5HKLA 3ZLBA 1GTSA 4OGKA 3C3DA 2NO6A 4KVZA 4F9EA 1QXSA 4PTZA 2FUKA 2QS9A 2XZTA 3HYNA 4BX8A 3KFLA 2AFHB 5F3DA 4LRQA 4D6PA 1FC0A 5I7VA 5AI6A 5IKXA 2J31A 2UAGA 4C7MA 4MKXA 1QDLB 2NU9B 1QDEA 1G5HA 1NA5A 5F76A 4CM8A 4J5HA 4NS4A 2IUSA 2P6UA 3COPA 2EJUA 2XZDA 4JLMA 3ZWYA 4JP8A 1TYEB 5CYFA 3RODA 3IKTA 2I6UA 3QWFA 4ZZ0A 2BPOA 5LYJB 5HH4A 2GJKA 2XAAA 3JYQA 3BWDD 3CEPB 4UVEA 2NOAA 3G2NA 5FPSA 4PFSA 4HDOB 4O5OA 4XRGA 4C89A 1Y8QA 3UAOA 3R3ZA 1PWYE 1Q84A 1T4DA 4O0MA 4ZOLA 2Y1CA 5LJIA 1X74A 4AD8A 1FW6A 3OHSX 1ZW1A 1SKBA 1FUYB 1SELA 2YBEA 4FJ0A 3WO1A 2Q3CA 4RYLA 1O95A 2X42A 3TW4A 2OGSA 3A05A 3GLQA 5BWMA 3X43A 3VU8A 1VRVA 1JU3A 4BPRA 1E1DA 1C1XB 2PFSA 4HDMA 1VHDA 2DQZA 3K70C 2HT6A 3BBLA 5FPTA 1U7UA 4DDUA 4N65A 5BW4A 5T3YA 2CVFA 1NF9A 4NENA 2VTEA 3TSCA 1X1RA 2JLCA 4NARA 4BRWA 3GP5A 4JGIA 5EE9A 5ADVA 4M53A 4BU1A 4A5SA 1ZTCA 4ZC1A 5DFAA 4HEA6 3H9GA 3COWA 3F3KA 4JSYA 1ZI6A 4MDHA 4C6RA 4QPDA 2HDNB 1TC1A 1KJIA 3SHQA 4B45A 3NWOA 1PYGA 4L57A 1KP2A 1ORIA 3T1VA 2YZNA 2VTKA 3A0UA 2P18A 3VR6H 3PPXA 1HE3A 2WJIA 1M8FA 5IBQA 4K9RA 4FOOA 5F3WB 1EHCA 4QTXA 4K2AA 1EVKA 5ALLA 4GVLA 1UJ5A 2EBHX 1KY4A 4PNZA 4EARA 4RVUA 3DAYA 1FNSA 4RXMA 2MSLA 4ZODA 5DBEX 4NMHA 4DB2A 4YP1A 1J49A 3KDSE 1TO2E 3S1LA 4CL3A 2G82A 3OPMA 3IJRA 5C80A 4M1MA 4U2EA 1EESA 4ZAZA 4UXHA 4HD8A 3VPCA 4U02A 2IXAA 3IPXA 5K3FB 3UUGA 4CG2A 1A4UA 4NU5A 2GPSA 4CM1A 3NG1A 2E21A 2HSWA 3ZGXA 3EXFA 1RPNA 2HTEA 2XHEA 3VH1A 3ROEA 4AURA 4DJDC 3PKZA 3Q7RA 4V24A 5BXQC 2C1ZA 1O7JA 2M2IA 4CM5A 3EF1A 5H83A 4GHWA 4G86A 4B80A 4OU5A 4URVR 5DMXA 3CR7A 3CJQA 4NYMR 2C2BA 5EEGA 3THXA 2AQIA 1GYQA 2KBEA 3FSEA 2ZSFA 3A10A 3EMDA 3ZVNA 5HM6A 2YJ4A 1GCUA 3NJ4A 1PG0A 5AVRA 3E9YA 1T10A 2R48A 1XAHA 4C05A 5AYVA 4QU9A 1IIRA 1ZGGA 2ZBDA 1G2OA 3DHWC 1M83A 3EVCA 4QKQA 5EJ7A 1X7WA 3LRPA 2F4NA 1A0OA 5AKYA 1K7CA 2C3PA 3STWA 2XB2A 4OA8A 3IOEA 2G83A 2H5IA 4JASB 1U0RA 2VRWA 1T0BA 1Z0ZA 4I81A 4ILEA 3SZGA 4GD3Q 4JCCA 1E5XA 5K3AA 1GU1A 4JYPA 1O6GA 2IU6A 4CKXA 5DNEA 4G1MB 1TZKA 2DQKA 5KQMA 4B7CA 2VJNA 2ZRAA 3F47A 1AQIA 1PV1A 4M1WA 4R54A 2NP7A 1IB6A 3PC8A 4B7XA 1HDGO 2YXDA 4IIVA 1AA9A 2AFHE 1GADO 3BE6A 3I39X 1YB1A 3LLVA 3NIBA 4H08A 5BUCA 2K5UA 3G2MA 4YV2A 4J7AA 4QGBA 5BRJA 3KSRA 2I29A 3A4MA 3MOSA 2CVOA 1JXOA 3NVAA 4OAOA 5K6TA 3DKVA 4FDMA 4IQ0A 1XDZA 4ZEWA 4WGGA 3TPZA 5IFLA 4YCAA 3PQ6A 1OXXK 4A27A 1MMFB 1SCQA 3HN2A 1YIOA 3LKDA 4OHBA 4IIBA 3UZUA 1O6CA 1FP7A 3LC0A 5B30A 2AMVA 2FSSA 2ORIA 1M0EA 1VPVA 1L5ZA 4DYDA 4WW0A 2YOGA 2ZTVA 4XGIA 4ZARA 3RS8A 1XP8A 1Q15A 3THWA 2FUNB 1H05A 2O8VA 4WRRA 1A9YA 4B2LA 2HQ1A 2GTPA 5FFMA 2HRQA 2PZLA 2NPOA 2OV4A 2ISCA 3SHWA 2EZ4A 3TSYA 4Q05A 1NN0A 4C1HA 2DM6A 2B83A 2RONA 5LP6B 3HP7A 1DPFA 3HABA 3IIJA 3OIGA 4Q9IA 5ITZB 5JCPA 4NQ5A 2D13A 1Q3HA 4XD7D 3VO8A 5GJVC 1ZM3A 1QYDA 1TQ6A 4AB1A 3QV2A 4G2NA 1CQIA 4NAUA 1YH3A 2Q6IA 4FZJA 4CLEA 4ZHSA 4FK8A 5JYCA 2JGLA 2OD9A 3SIWA 3MRXA 2E4AA 2PEYA 1G38A 4MEAA 3ZK8A 3ICEA 2VHUA 4BNKA 1OWPA 3IAHA 3ZYZA 3FZGA 2UUAB 3JRWA 1KJQA 3FSJX 1QVAA 4P58A 4YQZA 2XJ4A 1WF3A 5ECYA 1JVSA 3SKVA 2CSXA 2VAXA 2IYSA 3FW1A 4UVHA 5G0SA 1CHDA 1ESDA 2JHFA 3LXMA 4GR9A 3HUUA 5EPUA 1ZXBA 3SZMA 4BHTA 4E46A 4R71A 4YRZA 2QTHA 2C8KA 4NKRA 1T3LA 1T36B 4PM4A 4AM8A 1GY8A 3EH1A 5CB4F 4FKBA 1LDNA 1DKQA 1CVIA 3D2AA 1L3BA 1PG5A 2XOXA 3HU3A 3LQKA 4RXTA 4BMZA 1IG0A 1Z0KA 5JCJA 4D0GA 1U80A 3M6LA 4Q00A 1S3FA 4QYMA 5AUPB 5MN5A 3RTGA 2GILA 3DOIA 4RXUA 1PGJA 1PLJA 3LXXA 1PX2A 2AZMA 2OESA 2HRBA 3FR8A 1OGIA 2IIPA 4FYIA 4K6FA 3GJQA 5HFAA 3W3ZB 4ZRDA 4AWZA 1MV5A 1YWGO 2YBDA 1H2YA 1TMKA 3F8TA 5T4BA 3S2ZA 5B4VA 5KYXB 4RZHA 2IYFA 2WRZA 1G5FA 5SZIA 1IN8A 3G2PA 3FVQA 3NW9A 2WLSA 4Z0HO 5LQAA 3ZHZA 4TXHA 1XTPA 5TEWA 2CXHA 3AJEA 4DR4B 2AFVA 2Y1FA 1FDVA 2ZREA 3ETEA 4HMQA 3IAAA 4M99A 2PIDA 4WY5A 4E31A 4O4JF 4RY0A 5A4IS 1CQPA 2GZDA 2HO5A 3K09A 4RGVA 3F46A 5FULA 2XTMA 1Z4IA 2CDAA 5BYBA 3V8RA 3ZY6A 2X9QA 2WNHA 3AI7A 1VLZA 3JWGA 1NVWQ 3WLAA 3LY8A 2AYXA 3UTDA 2EEZA 3VJKA 1ZJ5A 3IPAA 4ALNA 4BZQA 1VPLA 2MDTA 1VYUA 5G0WA 3REOA 1LPBB 4TT3D 4J7XA 3ZWXA 1VHQA 5C46F 2J5XA 4AWAA 2Z58A 4O8CA 1U8ZA 1RBZA 3HKBA 3SIRA 3ZD8A 3MS2A 3TKLA 4LYYA 2ROQA 4F92B 2RAVA 2NO5A 4QXPA 4P3PA 1QGAA 1M5UA 2BR4A 5IANA 2OCIA 2P9EA 4XGQA 4FPXA 3VSCA 1ODLA 2QTTA 4R6XA 1AY0A 2OFXA 4WZAA 4YJKA 4V1CI 2L42A 3ZHYA 1N5JA 2FWBA 3F78A 3P0EA 5ALJA 3U9SA 1N3IA 4LDZA 3AWIA 1KVQA 1OX5A 1K5DA 3PQ2A 4P3YA 1T2VA 1W88A 1LEHA 2EKPA 3HB5X 3KELA 4FNMA 1NGSA 2YJGA 4U9HS 4YHBA 3EDYA 3OCCA 3B7PA 3UJ3X 1FFHA 1Z68A 3E7PA 4I3FA 3ZU5A 3ZD6A 1VE3A 1Y6ZA 3BD6A 4LXYA 1DKOA 4Z9YA 5F2EA 4LMPA 3AI3A 4FQ8A 1FSPA 3RYIA 3NATA 2AF4C 1C7FA 2GM9A 2NVOA 3PSHA 1IE3A 1NJSA 2P0AA 2QSJA 3C45A 1PR6A 3DMYA 4Q3LA 2BFDA 3BB3A 1QRRA 1FUEA 2I71A 5EEHA 4YHHB 4BWFB 2C2ZA 1KYVA 3CRZA 3BN3A 2ZUSA 4CODB 2C95A 2PA0A 4AXBA 3K73O 1Y3BE 2PL3A 1UWLA 2R60A 3G7SA 1PVVA 2XSZD 1JQEA 3O4RA 4QDUA 5CW2A 3QBJA 2JANA 3RYHB 2ZTHA 1KSFX 3TOSA 3EXHC 4RK0A 3EOBI 4EKYA 1SK8A 1E94E 4D4IA 3GRKA 3WWCA 4UARA 4LFBB 3PA8A 5BN4B 3BXXA 3JZIA 3QY9A 1N1DA 5JWHA 4A15A 2UUOA 4IUDS 4CV2A 1IG3A 3O8RA 1DGQA 4GDMA 5T8KA 1JPJA 3S5UA 1WNTA 4JKOA 4QPJC 3NBKA 4ZK6A 2QTCA 3DXFA 5GZ3A 5HIIA 2Q42A 1HQYE 2OSBA 3LMKA 3NP9A 5EE5B 1HFJA 3DKRA 4FHEA 5ELLA 2D1RA 3WQBA 3S2FA 3D3NA 5BV2P 3R6WA 3ZV4A 3HMQA 2BDEA 3JQ9A 5JCOC 3CZPA 4UEJA 2VYVA 2JGAA 2C3OA 4RSGA 2REOA 1WB9A 1MR3F 3AFMA 4MARA 3HR8A 3KQKA 3NBYC 4F5ZA 1RWMA 2RCYA 1RMYA 3BB1A 3DEAA 3FAZA 3IS3A 4CUJA 1WP4A 5D3MB 3U7EB 2E49A 3PPWA 1EX7A 1QE3A 3OWHA 4PRYA 5HKKD 1RHUA 2OSVA 1VPEA 1JDTA 2OHOA 1CUJA 4BEWA 1RMTA 4UE2A 3K2EA 4CM4B 4DJFC 4EGCB 1AGXA 5D3QA 4NG4A 1PYOA 4EG1A 1AX9A 4IDBA 2BIBA 3H6KA 5E8RA 4N0DA 3OKFA 1UDAA 2YC2C 3LO5A 4WKBA 5AXDA 3TYXA 3U16A 1TO1E 3K0CA 3WJAA 2FGKA 5K99A 2BGWA 1PJ2A 1WMDA 2H1CA 3PL1A 3DDNA 3NJRA 1JFSA 4BATA 3M9LA 1IWOA 3RRZA 3Q7SA 4BNXA 1T2FA 3RK0A 2JFUA 4D9KA 4OQFA 3KYDB 4RWEA 3RYCA 3HDYA 4OX9Y 4GKAA 3AVVA 2YJTD 3TOCA 1RYMA 4MQEA 3U1TA 1PT9A 5KTMA 3SZ3A 5BN3B 2GS9A 4IOLA 4GKBA 4JQSA 4FQ7A 1M5TA 2W2OA 3G23A 1MPTA 1UP7A 4Z67A 5IZ4A 1W5SA 1HDRA 3JVUA 4UEOA 2NU8A 1SXPA 5BSFA 5K4MA 2ZJ7A 4I2NA 5B55A 3HJCA 4AZ3B 2X0RA 3HDVA 3JYLA 3OLQA 5AJXA 3R5XA 3CKLA 1F2VA 3G1TA 2VBIA 3GUCA 3D3JA 3T5DA 1LY1A 1OSNA 3FDZB 2Y1OA 3NYRA 2PWYA 1X2BA 1QGUA 1U1IA 3EVZA 3PDHA 3QI2A 5I51A 1YQGA 2QLBA 5EZYB 3PWKA 5K2OA 3SYKA 2BKAA 1OZFA 1E9RA 2Y2VA 3KKKA 3Q6NA 1T1EA 1Q1EA 4IJVA 4JLWA 4RJ2A 4RESA 4ZHQA 3WAGA 4X62B 5KSWB 1JLHA 2GCUA 2QDTA 4J0JA 3DAFA 2FY8A 4PANA 4MV5A 2HU8A 2ZULA 2Z6VA 4TTPA 4V0HA 3W6NA 4JI8B 1PL0A 2Y0PA 4LWOA 3OF5A 4FFLA 3BWXA 3W90A 2CL0X 4R3WA 4R0MA 5JS1A 1H85A 2AQ8A 1E2IA 1ZIDA 4LYAA 3RK4A 3FROA 1BXKA 1L3IA 3Q3CA 4YRMA 4XWTA 5HOQA 3OIUA 4N0MA 1H2XA 1WV0A 2W2PA 4YLEA 4RTLA 4LXQA 4CKYA 3N2ZB 3R9IA 4DV5B 1FFYA 4EXYA 2XOKD 1TMYA 3QELA 5KAPA 4QT0A 3LT2A 3JYOA 1OA0A 3X1MA 5KWEA 4EL5A 3Q5EA 1P2FA 3H11B 1TJ3A 5IP5A 1C4XA 4FLEA 3GUUA 3TRFA 5CFNA 1A8TA 5EVDA 2WZCA 5C8YB 2VJMA 1CC1S 1M76A 4GUDA 4HQFA 4NH0A 2J9RA 3C3JA 3ESXA 1G5RA 1IBRA 4QELA 4RV5A 4LRYA 3WYBA 3DEJA 4EW2A 4LZJA 3W5UA 1IQ0A 1X80A 3BK7A 2P30A 3L0DA 3GYBA 3COSA 3EA5A 2XNDA 4GP7A 1G3QA 1ZD8A 1YE8A 2NSHA 2BTEA 3ZE7A 2ZB7A 1E5VA 3EXEB 1Z9BA 3SE0A 3V4SA 3K6SA 2CFUA 3ZXXA 4OGFA 2PZJA 1HTTA 3GAZA 4I5DA 1O5OA 3M3HA 4NEHB 2NZUG 3VOAA 3IQXA 2JDIA 3V3TA 3WYDA 4RDCA 3HWRA 3K8OE 4B3CA 2GXSA 3ZHTA 1EVLA 4PBTA 1FCJA 2YV3A 1W6RA 2BH9A 4HFNA 4KXVA 2I33A 2VJLA 3K4HA 1MB0A 1VXRA 4OHPA 1IZ8A 1E5LA 5A2GA 2H5EA 3PFBA 3NBUA 3GDHA 4Z99A 4UNQA 5UKDA 2GVDC 4TN1A 2J3IA 1KI4A 2HGZA 2NXCA 3D6JA 3HVHA 1M7BA 3K1AB 1GN8A 3JZFA 4MGEA 1A9RA 2HU7A 2X86A 2KYRA 2IZ0A 3NWBA 4YT8A 3VPEA 3OEED 5AOBA 5A06A 1E3TA 4MCIA 2O1EA 1XZIA 1U5BB 1RHRA 4G5FA 1T6NA 2ENWA 3K6KA 3CSDA 4N76A 1F7VA 2ZJ0A 3HYCA 4OJTA 2QWXA 4PZ9A 2VC2B 3GLFB 3GBSA 3MUEA 1M0WA 1NN5A 3G1UA 4D9GA 1GRCA 2DMRA 5EL0A 4GNKA 2WD7B 2XDQB 4QAQA 1WOMA 2OE2A 2VR1A 2HJSA 3GELA 3NHRA 5C2JB 1X1TA 4LZWA 3QW4B 1GRVA 5DCLA 2ZM5A 4BMDA 2A86A 1MCZA 2O1WA 2H1HA 1PT8A 3EZGA 3ZWCA 1WUTA 4D0RA 4FKMA 5EMNA 5JDCC 2B61A 4O4LB 1TF5A 2VL7A 1RRVA 2AWOA 3C6YA 4IKEA 1XMVA 4UUMA 1XK7A 3RSOA 3VQZA 2Y9PB 4PX9A 2N75A 2PX3A 4B5KA 3AEXA 4BNFA 2WD8A 1BE0A 1CPYA 1RPTA 4YUWA 3SSAA 2O8FA 3E9MA 1E6MA 1R0YA 1C3XA 2I54A 2XRYA 1QTQA 1LK7A 1K8QA 3CNOA 5CH3A 1NF3A 4Q5IA 5IAAA 4B84A 3FF1A 3C7TA 2VJKA 1C50A 4HH4A 4ZQFA 3OZWA 2W90A 3FB4A 1DX9A 1YKSA 1Z26A 1VJCA 2A0UA 3FWKA 2BGGA 3PUKA 4HNHA 4XB2A 5HE8A 4KG7A 3TD9A 1BEZA 16PKA 4W1RA 1UXKA 3HO8A 1IONA 1XRLA 3H3EA 2OGZA 2ZJBA 4GZ6A 2RHGB 5DTRA 5DT2A 2HPHA 4IHJF 4URYR 1GKYA 1O5TA 4W5HA 2XAUA 4HN2A 2WT8A 4DZZA 3EC7A 3H9EO 2AD5A 2EVWX 1IY8A 1J23A 4YIKA 5TJ9A 1WG8A 1VG8A 3NORA 1GG2A 3RDPA 1YS2X 3SJ7A 1DHTA 2JRCA 2AOTB 4NTZA 4RGQA 3U3XA 5KO2A 2OBMA 3T38A 3KR1A 2XE6A 1J2JA 1LBQA 3AL3A 2WJGA 4UAMA 1EE1A 1KZ6A 1YQWA 1Z6XA 3MGBA 2QN6A 5EKUA 4RA9A 3T4EA 2IXGA 2EOAA 3D4NA 4HGQA 1GSAA 2FETA 4KPGA 5IBRA 3WA6A 1IHXA 1ODKA 3G68A 3H2JA 4Y3UA 4A4DA 3EC2A 4ERNA 1V7PC 2IJGX 3GXOA 1JR6A 1Q7BA 4YMUA 2B8EA 1N2HA 1CJKC 2MIIA 2YJ3A 4LZOA 4OQDA 2MCFA 3VR2D 4QTYA 5IJ0B 4KR2A 2GCOB 4KQEA 1DG3A 1L8AA 2F64A 1XX6A 1P6UA 1C81A 1VE1A 5HHTA 1ZCAA 2OCBA 4B3HA 1ULTA 1YS7A 1D5WA 3KU1A 1E2GA 4J90A 4PZPA 3AQ4A 3RJZA 1IJKA 1KEPA 1Z2DA 3N7AA 3Q85A 3ESZA 5DXJA 4OXRA 1OA1A 3CPHA 1KZ7B 3DNFA 3N0XA 4C1EA 1J56A 1P9NA 1QJ4A 5GM2A 1PL7A 1CY8A 3HV2A 1N0UA 4QLAA 4UHCA 3LNTA 1SH7A 3DTVA 1X8XA 1RHQA 4F38A 3N75A 4B2YA 4JZYA 1BYUA 4PINA 1OIVA 3QWHA 1PBNA 3NTOA 2BCGY 5HZMA 3AUJB 3NVMB 1P4AA 4QECA 3C5EA 4B6PA 4ZVQA 4BP9A 4UM9B 3DE2X 2W6PA 3KSZO 2WTUA 3LHSA 5JANA 3KEQA 1UH5A 1JAHA 1E2BA 3X1YA 3HO6A 5FFNA 5EIBD 5DHTA 3EBOA 4AKGA 4HAUA 4F93B 1R37A 3CZ4A 2EW8A 2N3ZA 4NP6A 5B2EA 2H31A 1XTRA 3UN1A 5BRAA 2ZS7A 3E22B 2QR2A 3R3HA 3DL7A 4HDRA 4I66A 1DEKA 2QXUA 4K26A 4YBRA 1EVIA 4QYTA 5DF1A 5EKXA 3T15A 5D01A 4KQ1A 4KQHA 4WY8A 2UXDB 4ENRA 4W5RA 1KHTA 2A7XA 4UHJA 2YICA 4UM7A 3ZNOA 2K7FA 1NTOA 2A9PA 4FNOA 4IS3A 5EHZA 4HCJA 5AM0A 4HVCA 2R87A 3URKA 3GLFE 2IOFA 4QWWA 1QU3A 1E7SA 1R6XA 5AKEA 4FMPA 4K7JA 3FB1A 3DP9A 4PO1A 4HDSA 2DETA 1Z5NA 3NEAA 1JFVA 2FVXA 4O4IA 2V58A 3CX7A 4ARZA 3QW2A 4FLMA 4QDOA 4WK0B 2PUAA 1HMPA 3VR5D 2GKGA 2WVAA 4LSMA 1A7JA 3GMIA 4M22A 1TVKA 4XDZA 4BLUA 1T5LA 1ZC3A 4CQLB 5FO0A 2P7IA 4WBSA 3GBVA 4JI2B 3CX4A 5IT9A 5BN5B 2IYRA 2IS6A 5JPCA 5AJYA 4BQQA 5HH6A 5EP4A 1ZK3A 4ZO3A 1VE9A 1WUJS 1O89A 1N0IA 3QEKA 5C7YA 2BGAA 1EFRA 1YZFA 4CU5A 1RKXA 1RQPA 4P08A 4C4AA 1S3GA 5AK0A 3TIGA 4ARBA 5L3VA 1UEJA 2DCMA 2RG1A 3QU5A 3F3SA 3C3AA 4XQ9A 5LLDA 2ASVA 5F9HA 4B76A 3E9CA 3O0TA 2QY6A 3I12A 4FCVA 5A6VA 4KO1S 3X2XA 3A25A 1CYDA 1JFFB 1H8EA 3C41J 1O96B 2PUHA 4JUDX 4KWHA 2H1WA 5FO1A 5K8JB 3KVNA 3LXUX 1GFWA 2J09A 2XTZA 4LJ4A 1GM5A 1Y3AA 4G97A 1TUBA 2H48A 1LK5A 1FYFA 2JAHA 3LUHA 1NDHA 3UFBA 3BICA 3VR4A 4NZNA 3PDCA 3SIXA 3VVMA 1T9GS 3CO5A 4RM5A 1J07A 3FFTA 3R0VA 4IVQA 2FE4A 4XASA 4CKCA 3DTYA 3EIOA 3WKEA 1CFZA 3DXYA 3NI2A 3BHJA 4P0PB 3DHEA 2VPYA 3Q0EA 3I23A 3CLVA 1V25A 2RJNA 4KXMA 3SEAA 4ZT4A 4GXTA 3S1SA 5CCXA 3GGDA 2OXFA 2ZSIA 1XHEA 1PZHA 2R1TB 4YQEA 4TQ9A 2O2CA 3OURA 4MLZA 1VIAA 1H1LB 2A0WA 2VDNB 3K1TA 4I1OA 2N1BA 3GCXA 4PO3X 5AQ1A 1N5IA 3C85A 2IHJA 4FFMA 2GZHA 1UOQA 3HUEA 5I45A 3PZBA 5LDHA 2KM1A 1E2DA 1OC4A 3K9QO 3RCBA 1NVAA 4NS1A 1IHYA 1DMSA 2NUPB 3FUVA 4QQRA 1O8BA 1IK6A 5GJWC 1L9YA 3DVAB 4IBOA 4C07A 2QL6A 4R7ZA 2RHBA 3QM1A 5AKKA 3AEZA 1GKIA 1PK9A 1HYBA 4F71A 1XOIA 3UAWA 4OHWA 4BQNA 3RKJA 2OXCA 2FF5A 4X24A 4KXNA 4A2QA 1PZEA 4I3HA 1NLUA 4K6MA 2BWJA 1ZJYA 1H6DA 3K16A 5DX1A 1KK1A 5G53C 4CKWB 5CA1B 5M29A 2JD0A 2PPLA 1GG8A 1YCDA 2W58A 3DDOA 2PLWA 3KWJA 3ZE0B 3H7IA 1RQRA 2QT0A 2FDCA 1A8UA 2JIZA 1ONOA 1UF9A 2QD2A 3WGHA 1UZUA 3C87A 4DB4A 1MOQA 3KXKA 3DKPA 2Q9UA 5BMOA 3I2YX 4BMNA 3OTGA 4E11A 1Z5GA 2QMHA 2NN3C 1JQAA 1UT6A 2W11A 1PEYA 3KTOA 2Q4EA 3U7JA 3UATA 1EVZA 3AVOA 3BJZA 3W78A 3BXHA 1NW4A 2J48A 3IO3A 2R0QC 2QN3A 3IHKA 1TTPB 4PLGA 5AVKA 2RBEA 3IXLA 3REQB 3GQBB 1ZU4A 2R7MA 5DX8A 2QTAA 3RVLA 3DW1X 3GXBA 1OFTA 4R1MA 2H51A 4IDOA 3E27A 3OZEA 4MJ3A 4BFXA 2IPOA 1JLLB 3HYTA 1Q11A 1RWPA 4KN8A 3EE6A 5ALFA 3I01M 2FA9A 2XW6A 1ACLA 3CVYA 3MCTA 4I3GA 4GOOD 1E9DA 4M83A 1BMFD 1QMGA 4QJIA 4R8KA 4D8WA 3MHTA 5C8VA 2DQYA 5ICMA 3AM1A 3V7WA 1SBTA 4KCGA 1I1NA 1Z4NA 2PCJA 1HTBA 4XUKA 3PNSA 2DOOA 2CNNA 1PJBA 1VSBA 1A3CA 1DWQA 3OQIA 4L6IA 2JHAA 1M1ZA 2WR8A 4RENA 3T7IA 5IK2D 4DBZA 1M6WA 4WDQA 3LUPA 4GMXA 1MRZA 3AP3A 3HCWA 4GOLD 1F06A 1SQSA 3AR9A 1FY2A 4L07A 4L5AA 4Q7MB 2NTNA 3STYA 2G67A 3MILA 2QLTA 4DARA 3H3FA 2E1PA 5JAHA 2Y2UA 1Q0PA 2EARA 3F97A 3KPUA 3V1YA 5KKCA 3LZCA 4RVOA 3O73A 4CLOA 3GLHB 2ISQA 1G60A 4HH1A 1V5EA 3OJCA 3RU7A 4AULA 3LM8A 5CVVA 3MT8A 1JAXA 1I4EB 3SDSA 1T3GA 2KI5A 1Q7EA 1IB0A 3ZTYA 1MAWA 2EFCB 3FSGD 4GX0A 3BXGA 3HLTA 1FDTA 2M6KA 5K01A 1ZGZA 1J0BA 1Z5OA 2CC2A 4KK4A 2I9KA 3WRVA 4I5GA 4Z60A 5K4GA 3TQRA 3DF9A 3G17A 2VDQB 4B44A 2IHNA 1P3JA 4NNOA 3TRKA 1V8FA 2CGEA 2CW5A 2XE7A 3HGTA 1I10A 1QR6A 3DTNA 4K9OA 5DW3A 1ILWA 4NH4A 4BE4A 2NTVA 2HJWA 4S1VA 1O95C 4EYOA 3EIQA 3BK2A 2BEJA 4PXSA 3G8AA 3R3SA 3E3NA 3TAUA 3FYUA 3VH3A 4L85A 4DSUA 1GNLA 2Q5QA 1N2GA 2QEQA 4UE3S 1MA0A 2JFHA 3SM9A 4NY1A 2Z1NA 1IJEA 3ZEAA 4BIIA 2FEWB 3BL8A 1T8PA 4DMCA 2BFWA 3QU4A 4ZO4A 4GXRA 1L0BA 1UXGA 2BMDA 2FWIA 4BGDA 1KGDA 5HIOA 1KFKB 2NXJA 3ACBA 1ADYA 3LTNC 1M1NA 2EX1A 1J25A 1M54A 4IMJB 1NR7A 1XROA 3RVJA 3JQ7A 5A4AA 3D0OA 3JD1A 1ORDA 4O5AA 5L51A 1VXOA 1SQ5A 3CF6R 3PNPA 1H6CA 1T29A 5BOSA 1I9GA 2H06A 4R4JA 4UC0A 2R4TA 3OZCA 2H6EA 2INGX 4GRAA 2OTCA 3ZJYA 4GLFA 3R0XA 3ZS8A 4EHJA 3KDAA 4KB5A 5DN9A 2BM1A 3PFFA 4P0QB 4KREA 1Y8AA 2UUCB 1V3UA 3NDIA 3D59A 2EDAA 5D51S 1XE3A 5KTNA 1Y7PA 2NO0A 2P35A 2PJUA 5MFPA 4UWRB 4BVBA 3O4FA 4QEKA 2J6HA 5F7XA 2FQYA 4GLBA 4IY1A 1PR2A 4O4HB 3WYGA 1Y6GA 4Z4FA 2V97A 3CB4A 5KYTA 1N2OA 3B13B 3PYXA 3DV2A 4D4KA 2DJIA 4GX1A 1T4MA 2HIHA 3GU3A 4J03A 4JVLA 3S68A 1TRKA 1Q16A 1OI3A 4NOJA 1P31A 4HDNA 2XKKA 3HSYA 3ZCSA 1X3LA 2FG7C 1E4EA 2JRLA 2XUPA 3MQ4A 1GA4A 3LUJA 2CDRA 2JI4A 3NDJA 5HA5A 3FTFA 1R3UA 2FN3A 5C7LO 1YNSA 3NTXA 2WU3A 2NTYC 1KORA 4MVJP 4UU8A 3RUEA 4DJJA 2G0AA 4BQEA 1SKUA 1FXUA 3UCEA 1SOUA 3GAAA 5JISA 1U3VA 1DO0A 1PS0A 1Y1TA 5AIAA 1CJVC 1U7PA 1E5TA 2HCFA 5U9CA 4KXLA 1YFJA 2D5LA 2VOJA 1DE0A 3B53X 1KR3A 1CLUA 2Z2YA 2Y9MB 1G66A 2VYNA 3P2KA 3PHCA 3IIMA 3K96A 3PBKA 5HR5A 5LA6A 3PDWA 3HM9A 2JS7A 5AUQA 3LYUA 1P4SA 3QX7A 2I67A 3EULA 1YJXA 1KI9A 3S4YA 5IT4A 5JVDF 3BCSA 4ITUA 4IOKA 4LXUA 2P2SA 4V0NA 4RTMA 2WA2A 3PC8C 3Q3VA 3KYJB 2RC5A 3DEIA 4Z86A 5FHQA 1BEEA 3ZWPA 4YYEA 2XYHA 4ZJYA 4JUIA 3G8YA 5JJIA 2QR5A 2ZYWX 1NRWA 1QHHA 4E1BA 4EY4A 2HWKA 1JQJC 3GLHE 4HX5A 4TS4A 2DLDA 1YL5A 2FPOA 4HLQB 2XV1A 4EFKA 1RXEA 2YVUA 3P0RA 4LVOA 5B6PA 1HNZB 4ZEOA 4JB0A 3CVVA 1LGYA 1R0WA 1QO0A 2GPYA 2ZB4A 3DUFB 3HACA 3K72B 4F86A 4DA7A 1BE1A 5BNWA 2NZJA 2J5QA 5D87A 1N34B 3O1IC 4OGLA 4LGYA 1Q44A 2IZ1A 4AECA 1XEAA 3JAKB 1JHQA 4Q4JB 4ARVA 3I5XA 1WHSA 2IX9A 1MUUA 4XYGA 1LUAA 1T13A 3A11A 4NBLA 3VH2A 2X40A 4C0WA 1R4ZA 5T6MA 4WLUA 1AF7A 2BGNA 2JFBA 4HAWA 4ZEVA 4M21A 3L8HA 2ATEA 2C83A 5B3AA 2QMUA 1W2HA 2XA9A 4G9EA 1ZCBA 2QLLA 2EU8A 1AD2A 1OU4A 1VLLA 3I3OA 3LCCA 2QTMA 3B1VA 1E32A 1I51A 1KDZA 4YUZA 1QC5B 2RH9B 3TFQA 2GN2A 1PZMA 4JC4A 4INAA 4KJZA 4EJ6A 4I9HA 5DBHX 3V97A 4E21A 1DLIA 1QIFA 3B6ZA 4MDFA 2C7VA 3MYYA 3NALA 1Z0JA 3W9SA 5CT5A 3VISA 1FFGA 2WABA 1R8SA 1ZRNA 4BVKA 4DADA 2CE2X 3GV0A 3CZMA 1W76A 2X0IA 4MV8A 5F7JA 3WDSA 1GZ7A 2VP4A 4BO6A 3X2EA 1JVBA 2AMYA 4MIYA 3TUJC 4BMYA 1EUDB 1DS6A 1ULAA 5DM2A 3DMHA 1OXUA 1KVSA 2X1LA 4RJIA 3WLMA 3CUVA 1U0SY 4LKOA 4WOJA 2H2GA 4B74A 1ZJJA 5BWNA 1XTBA 1V9SA 4YJ2A 1XZAA 3K35A 3SEFA 1Y9DA 3F6BX 1GIAA 3ZCXA 1U1FA 3O2QB 2IEZA 3GPBA 3Q1KA 4R2JA 1JHMA 1EB9A 4RLFA 2MOKA 1EZ4A 1PFVA 1RRMA 2X0DA 5CB4A 4U7DA 2BJWA 3DWFA 3DBRB 2F3TA 1YS4A 2AOUB 1JDZA 2C58A 2PL5A 2XKJE 8LDHA 3R8XA 2ZIZA 3RTAA 4DN6A 2F8LA 1B3RA 4W7HA 4LZAA 1UKVY 1LSSA 1ZVMA 2OR3A 4EY5A 2PUBA 3C6QA 1H8HA 4LZPA 1PFUA 5CYGA 2B92A 3KWMA 3W4JA 3ZY5A 3CZRA 4TKVB 4DDTA 4GQAA 1X7XB 4DWJA 3I8OA 3SQDA 1ZGHA 4YRTA 4AY2A 1UBGA 3I6IA 4G0UA 4A03A 1FX0B 1NV8A 2P1RA 3KD3A 4FE3A 5SY4A 3TLGA 2B1JA 5L4LA 1W7AA 1SUIA 5EV8A 3K09C 2CL5A 1USVA 1QH9A 3S2YA 5C8XA 2G5GX 5LNK6 3CRVA 2HOQA 1V26A 2XWJI 2MWMA 2Y3IA 2FM6A 1AXGA 1GCAA 2AFHA 4GR4A 2M1ZA 5JMOA 2A1TR 3GVIA 3WK6A 2FW9A 4EHAA 1M2XA 2H2FA 2XODA 1LTQA 4G1BA 2NU9A 2C7OA 4B40A 1JIXA 1SIUA 5E6UB 2QINA 1YQXA 5EWMB 2BBWA 5D3KA 4UXIA 1ZOIA 4FT4A 5LYJA 3OCZA 4RADA 5ITWA 4HKYA 3PUXA 3WRXC 1NHGA 2OQ2A 3FPSA 4JOQA 2BMAA 2CDNA 3VVBA 3T7TA 1E3JA 4ZAYA 1YHNA 4BBJA 4DCMA 3GR6A 3DBVO 3RUFA 3ANNA 4AJLA 1U1CA 1KPHA 4DV6B 4QVIA 4X85A 2QMYA 4PC6A 3P9QA 1Z2CA 3WGZA 1B8VA 4YUXA 4X00A 3KAKA 1RQGA 1QB7A 4IPTA 3R24A 4WEOA 3HI6A 5HQ3B 2JJ2D 4WKPA 1RXCA 2AF3C 4UMEA 2I4NA 2JD2A 4FYWA 4BC0A 2J45A 5CT8A 1C1XA 5AICA 1QZXA 1F8UA 2RI0A 9MHTA 1O0BA 1UC4B 2W93A 2OFWA 2YY6A 1PFGA 1ZN7A 1ZIXA 2FOXA 3V8PA 2EL7A 1Y3HA 3PUJA 2NM0A 2W4IA 4JLAA 4XEHA 2LIVA 5DYYA 2DLNA 2QA5A 2B5VA 1KWGA 5FUWA 4JVOA 1HQCA 3OF3A 1EUZA 2YWHA 1DAGA 5DM0A 3ZDCA 2FPWA 5IM5A 4YASA 2MSWA 3ICPA 3VPFA 4BQRA 1TECE 3JS5A 5C51B 2I78A 1TCUA 4QNMA 1TYZA 3MWKA 4RQTA 3EX7C 4Q02A 2GR9A 4PPFA 5JROA 1TF2A 2Z30A 5CJ2A 1N8KA 1KS2A 4JB8A 5DB4A 4FGJA 4ZTBA 5J5VA 1UJCA 3WYAA 4NBTA 5KZMB 3VR6A 3P2EA 2VJYA 5BQPA 1USWA 5IULC 4OO3A 3GRZA 3G6KA 3VU3A 1RTKA 2K7ZA 3OKPA 4KHZA 3GEBA 5FEUA 3LGSA 5A3VA 1P74A 1WB4A 4K8RB 2AL7A 1ISIA 3COVA 4IDCA 4XTCS 3SS9X 1TCBA 4D2IA 3C97A 3OQ1A 3KKMA 4D5EA 2RE8A 5K3FA 2P91A 4XGRA 1YHYA 2QTGA 3DAGA 3ECAA 4Q24A 3W77A 2PBFA 4YLYA 3CEAA 4CCWA 2VP2A 1M6VB 1MC5A 1NAIA 3G2QA 4GNRA 1YCHA 1N7IA 1VYVA 4BUJA 1H2RS 4CHTA 3ZD9A 4PYJA 1XQWA 4PS0A 1SY7A 2P1DA 3Q0TA 3QXJA 4NFSA 4BRUA 4D4GA 3MMPA 5I9NA 3ASZA 4D97A 2XMDA 4X84A 1IOLA 4DEYA 5K3CA 1DADA 3GJ8A 2Z9BA 2O20A 2J9YB 3KXLA 4S1NA 1VLVA 2GASA 2Y1KA 3O03A 2JF0A 1Z18A 4M8LA 3HJRA 1PT7A 3ROXA 4C0AC 4ZN6A 1VJGA 2AC4A 1NUQA 1DAFA 1DINA 1HA3A 2BEVB 2C9YA 3EWAA 2J7PA 1LPNA 3K0CC 3NR2A 4KUGA 4M0LA 1MF7A 1JEDA 2C4VA 2H4WA 4TSFD 4DMRA 1DXQA 1E2NA 4BASA 3ZWMA 2ZDGA 4B1FA 4QE3A 2I4TA 1M2WA 4K9DA 2V96A 2XMPA 1E60A 3KR2A 1L6RA 4HLDA 4ZVVA 5TS3A 1TM3E 5CCBA 2QDXA 4JLOA 1ZDMA 2X8LA 2QE7D 2QUAA 5FXMA 3QEMB 4PRZA 1BNCA 4AF7A 1NXWA 3KZVA 4XFDA 2OOKA 3EQ6A 3EVAA 1VP3A 4AKHA 4MPPA 1Z0SA 4P33A 1PNVA 3RIHA 3ZIAD 4IV5A 5LYYA 3B78A 3ZTWA 4OXQA 4LGCA 1R9MA 3NAQA 4RZSA 4BKRA 2P1EA 3CIOA 2D54A 1EJ6A 3CMMA 2WTMA 2JGFA 4CCAA 2UU9B 1UKCA 1YU9A 1GPKA 3PFHA 1E69A 1PQWA 4U2DA 3R5JA 1D6JA 1N25A 1FSZA 4UXJA 2ODEA 5FLKA 2G76A 3ONDA 2V7GA 5LBTA 1J0DA 2ZUFA 2O50A 4EG3A 1E1CB 4XCVA 4HQRA 4DA6A 1RCTE 5JAUA 4G25A 4DAEA 4XAQA 3I01A 3EZXA 4P3XA 2WF9A 4FCTA 3D4IA 3LCMA 3WHIA 5JO0A 3WYEA 1SUPA 3ROKA 3SE7A 3CSSA 1RWXA 4KO2S 2V5VA 3MTAA 4MYTA 3A1SA 5EHQA 5J4HA 1Z63A 2R8EA 1EM8B 5LP6A 2G1PA 2PMFA 5EOVA 4L4XA 1NJ5A 1A4RA 5ITZA 3FBWA 4KMOA 1DUIA 2P3OA 4JJFA 1UQTA 3B3QA 4OXKA 3WRWA 1CE8B 1F51E 1UPBA 3KJXA 4PGAA 1OW3B 2JVIA 1S2LA 1QZUA 4D98A 4UKDA 3P0FA 1PGNA 1CFJA 3IKVA 4IR7A 1HFKA 3C70A 1ZW6A 2IWHA 5BR7A 3KV3O 3OLYA 2VOEA 5DNWA 5LE1A 3QG5A 3PCRB 4B32A 3NPAA 1G291 4IZIA 4MIKA 2CLHB 4E7PA 5ACTA 5AM4A 2Z43A 5JZBA 5B7QA 2OV2A 3JR3A 3ORHA 4R3NA 4UCXA 2QJSA 1ADFA 4C4XA 4B3IA 3J81A 1WHTB 3L2OB 4KQKA 2R4QA 1U2DA 4DLTA 1SU7A 1SKAA 2AG0A 1WPQA 2WPDA 1VL0A 5J63A 4AF6A 4KNYA 4E1AA 3KSAC 1T36A 4IIUA 3U4QB 2NT4A 1T3TA 1CUHA 5IM4F 1P7PA 1CR1A 4UWPB 2ADOA 5AOAA 2IOYA 5JSZB 4JQCA 2ZSJA 3WLOA 1W5FA 2WUDA 1LTKA 1VB5A 2FWNA 2KW5A 1JA1A 3KPYA 5H70A 5LUBA 5FWDA 1F4VA 1VKZA 2FFAA 3L07A 4ZYTA 3RHTA 1F4LA 1SUSA 5CB6A 1PR3A 3DZIA 1JIJA 1DC3A 1P75A 1CVRA 1GGKA 5KYXA 1S4QA 2FQQA 2I8CA 2G70A 2LCIA 2Z3VA 3CPJB 1E2HA 3PP8A 5ERGB 3TSWA 2Z6UA 3I2JA 2P97A 1EXWA 4DVJA 3IRVA 4HGZA 5F5XA 1M6NA 1QAQA 1ISHA 3SBLA 5M7EA 4TKUB 5E6RB 4Q9JA 3DM5A 3ORQA 5E4JA 1GUFA 1PAUA 2PAFA 2YL2A 5EWLB 3AJRA 1IUOA 4MPJA 5JS2A 4FCCA 5KVQA 3TGLA 2HLPA 5EKTA 2MU1A 4HWSA 3AY6A 4R41A 3ISTA 5HTKA 3OE7A 1SBNE 3OCUA 3ANSA 4EBFA 2PY6A 4LY9A 1RDFA 2IZ6A 5LOVF 2DFPA 2DWPA 2YDXA 3I0ZA 4LWZA 2A5YB 2VAMA 4PSDA 4G41A 1E9CA 2B8NA 3GW8A 3VKUA 1MQAA 3L8YA 3AL0C 3KE8A 4NXNB 3ITKA 3BA1A 3RFXA 3KVRA 4H35A 4ND2A 4RF3A 2OUKA 3DJYA 3RWOA 3PHIA 4MR8B 3WAJA 1JWLA 4IXNA 1FYXA 2P68A 3HRIA 1MO6A 1UOOA 2ECKA 2UKDA 5FYQA 4ZCLA 4Z49A 1TUIA 3O7WA 2I6SA 5JSUA 2EFHB 1P5FA 3O91A 5I4BA 3K0EA 4BZ3A 1KI8A 2GJAA 5JI3E 2ZYVX 2YXPX 3IBSA 1P2BA 2E3JA 1W73A 1G8KA 1W6UA 1QVRA 3FKQA 1P19A 3T4XA 1IN7A 2XCSB 2PUGA 4YAWA 2Q0SA 2DH5A 3AHEA 3SZUA 1OTHA 2Z1DA 5JYBA 3R1IA 1SWVA 1T9CA 1WSWA 2WK1A 1JYSA 1S0UA 3JRNA 4XPIB 4EMTA 4FEEA 5DHRA 2IY9A 3EPKA 6GPBA 1YA4A 4KP7A 4DIFA 3B6IA 4N1AA 2E5FA 3VSAA 4LOAA 1E5QA 4NBUA 5LWQA 1JH9A 3WKDA 3ECCA 4QSMA 1B8UA 1ZUNB 4WXYB 5DTMA 4UA4A 3W4IA 2O52A 1U7XA 5B4TA 4LI0A 2E5LB 1VP9A 1AQUA 4W7SA 2WYMA 1X14A 2CXSA 4A9AA 1STOA 3RYHA 2YWRA 5DCUA 1XHLA 4RPKA 2VP9A 4J0HA 4Z6XA 4NNJA 2GDJA 2J67A 4K05A 1RQ7A 2JH9A 4EO4A 4G8CA 3K2IA 3OJLA 2W4QA 4RK6A 5BN4A 3OBIA 2C0QA 4DL9A 5ITVA 5BNFA 4ZCMA 1VJ5A 2PVPA 4NURA 3L5KA 3LVQE 5HBGA 3A1DA 4C4TA 2IYLD 4DQUA 5HYVA 3HNRA 4PSCA 5IKEA 2W2KB 4F11A 3QUQA 4TQGA 2CZGA 3SLGA 4B4VA 2XF2A 3S2SA 5CJPA 1X87A 2Z8ZA 2O8CB 4HYTA 5DM4A 1BX3A 3BXFA 4RE6A 2P1ZA 4FVTA 3VR3D 1JIKA 1FSFA 1GNRA 4UTXA 2Z5FA 1K97A 4M1ZA 1PE0A 4HGRA 1FVXA 2CFCA 4IVRA 3WJ2A 5LDGA 5C1OA 2WAAA 3FCCA 4B4OA 2Y1XA 2UZAA 2ZRJA 2VHCA 5FOQA 3PQ5A 4ZI7F 4PONA 5D3MA 4MVJH 1OFHA 2AA3A 4QGSA 4U7WA 5HM8A 4EHLA 3TRIA 3ACCA 3E05A 4CIWA 2BCEA 3BBPA 2GEBA 1TAQA 2R1VB 2X77A 4LS3A 3QPDA 2FOLA 5CT4A 1KF0A 2VRNA 1WXQA 3AKEA 2R96A 4L51A 3ILHA 1T9ZA 2KB0A 4UTNA 4ND6A 3FMOB 2R68A 5CXSA 2GN8A 4EYQA 3BSFA 3QYJA 5GMOA 1DFIA 4P98A 3BMXA 4XLZA 3PXBA 3HCDA 5LCHA 4LFAB 2H5LA 1U2SA 4HLCA 4GKVA 3WQQA 3E8XA 5ED0A 1K6JA 3GYGA 3IV9A 3JD3A 1MX5A 3KYDA 4RZ3A 3ORFA 5DN6D 3LW7A 1U0EA 4WNCA 1PT5A 2QF7A 3GHYA 2PRJA 1B15A 2YXBA 1DJQA 4YAEA 1RC0A 3GEMA 3DD1A 4HRYA 2WW8A 1NY5A 1IUPA 2B0JA 1GAQA 3QPBA 5BN3A 6ADHA 3HDHA 1GTG1 3I62A 4UTRA 3U7QB 1YOVB 2GAOA 2J3QA 2R8XA 1M34B 4LDJA 5CLJA 2HREA 3ZW9A 1FRZA 2H4FA 3GZTB 4M9SA 2PMDA 5HFNA 1XLTA 1E1RD 3FH0A 4AZ3A 4DILA 1LJ8A 1FYVA 3G88A 3GH1A 4A2WA 5JNLA 5KTPA 1F7UA 2XNSA 1G7RA 3KTFA 4XQ0A 3FOEC 3A9RA 3NU1A 4UJ5A 2OV6A 2A6PA 4JSRA 4LC0A 3O4VA 3QWIA 5EZYA 2CYAA 3SFZA 3UFXB 4IG4A 3QFTA 1K8RA 2QVLA 2ZQYA 1YZNA 2DHEA 4QOSA 3TMAA 1OLOA 1CB7A 2HA0A 2O0MA 3JD4A 1P7CA 1ORWA 5COBA 1F4PA 4PYNA 1XFAA 1ZRSA 3ILVA 3TGWA 1RWKA 4GRIA 2Y76A 4OSOA 3ZJVA 4EPYA 1D2RA 5A9TA 3SYRA 2C5HA 3T41A 3VKWA 2HF2A 4DNXA 1LCIA 1MAHA 1SHTX 2CNLA 3B9BA 3DFUA 3M1YA 3PJGA 2VT7A 3PQ4A 4WX2B 4XJXA 4BVLA 4MVJG 1FJGB 3I1YA 3ZJUA 4QL3A 3F9RA 1EX6A 1JHYA 1KDTA 5IUNC 4WLFA 4XI9A 2IYXA 4X90A 1A98A 5TQ2B 3L7IA 4HYYA 2HHLA 3TMKA 5JNWA 1DP4A 2WEKA 1SR8A 2REXB 1JSZA 3X30A 1FFAA 4P82A 3VKGA 1TW2A 4W99A 1WVIA 3H11A 2GXQA 4OP2A 5EHIA 5JJBA 5KSZA 4TZ0A 5A3RA 5C8YA 1ZUD1 1PJ3A 3DZJA 4RD6A 1ZGJA 1VRCA 4EUFA 4OMFG 1L1QA 4K0RA 1N8NA 3A6LA 8OHMA 1I6LA 4YPOA 2NAFA 1HT1E 4CQNA 2QAGB 4D44A 2Z0MA 4YMVA 5LR6A 3WGTA 4MV0A 3E2PA 3VFDA 3EXEA 4OHXA 2VSNA 1FNDA 3E1GA 3GLKA 2PSJA 4UW9A 4AAYA 4CNQA 1OBVA 3RU3A 3S44A 1X8IA 1FMFA 4ZVKA 1YUNA 4AN0A 4O33A 3VH4A 3IT1A 1RYNA 4DGQA 1GP2A 1GPMA 3NYWA 1J6UA 3GT0A 3U4HA 3ZWAA 4DKXA 3CVUA 3IHLA 2D5IA 1H4SA 4A8JB 1WMSA 3FGZA 4HAZA 1JXMA 2XT9A 3Q7PA 1FFDA 1XSEA 5AI4A 2GEVA 5EMMA 1V47A 2DFNA 2Q2VA 5IVIA 4CN8A 1OPRA 1OX6A 4ZJPA 1IK4A 1YK0A 4D0NA 1VPWA 4RTRA 1Z62A 3AJ8A 1R5NA 2VHQA 3EW9A 4JHLA 1UDWA 4UREA 2LVBA 3T7CA 3K1AA 1K5HA 4TVBA 3WLKX 2XXJA 3IXQA 3LFHA 3X0DA 4U7HA 1KKUA 2P2YA 1E9VA 1J2EA 2QN8A 1U5BA 4A91A 3UK1A 4CIVA 2HQRA 4GWKA 4JD5A 4AJJA 3LNCA 3SJUA 4QU5A 3TPFA 5JADA 5E4TA 3PENA 2KX7A 3HEMA 5FIUA 5AXCA 3DCJA 4EGFA 2I7DA 3GLFA 3ILXA 3VOBA 4FYJA 2XY4A 3OOSA 4RM2A 2WD7A 2XDQA 4FOLA 4JJKA 4PO8A 4TV9F 3K2BA 1EIWA 1MB2A 3UC9A 2O3SA 5LD2B 2GBIA 3OTHA 2DPHA 2ZT6A 3E5MA 4ODIA 3SX0A 3IR6A 4IJ5A 1DC6A 3FOBA 3CW8X 4OHZA 3PEVA 3NNDA 4C88A 1RLOA 5KNDD 3BCHA 1JJTA 3ETCA 2AI3A 4KITB 5IXJA 1ZNYA 2R5WA 1DARA 1SVUA 3DMGA 4IEIA 1P2SA 3GX1A 1PQYA 4O4LA 4M0UA 3IH5A 3HB0A 3OEWA 3PDJA 3H1FA 3JV7A 1YD7A 4X92A 4Q7LA 1T34A 1KTVA 3IQZA 4K2HA 1GZ6A 1HO3A 4L9SA 4A92A 4MKIA 4O2AF 4E2YA 1L4YA 2CB9A 2QX4A 1I5OA 4TLBA 5C1DA 5IRCD 1K7SN 3J80A 3NJ8A 1M34E 3FE2A 1FMLA 3KKZA 4NESA 5I7OA 1OT5A 4AT1A 1VJDA 3ZHCA 1ZSVA 2CJWB 3A1NA 4D4MA 4E4RA 4B8ZA 4EUSA 3C8HA 5IDXA 2OXTA 1NP3A 2SKEA 1DELA 1P7VA 1BGXT 3E9RA 2BYTA 3R09A 2XYRA 1HURA 4Q7KA 1LC0A 4LQDA 4EQ6A 4C21A 2WIDA 1G4HA 1XP5A 3V4ZA 2V74B 1UEXC 4HP8A 2R8BA 3E5HA 1ZK0A 5DEIA 2D00A 2VUIB 2VHYA 1EWRA 2Q62A 2JFXA 1G21B 3BX1A 4V0ME 5G02A 3BJMA 3KJZA 3CYFA 3WSWA 3KQNA 3IP8A 1H0KA 3TLXA 5LQNA 2IYQA 1D9ZA 1ZIYA 5FI5A 2QNBA 4GIBA 1I3KA 1OH8A 1MG0A 4TZ6A 4PY2A 2AOTA 4ZOLF 3BC2A 3I14A 2NZYA 3HBJA 4WERA 4Q4CA 5M04A 2BGLA 2QD5A 4M60A 3SZRA 3ADRA 3EB9A 2VA9A 5LZ9A 1Z47A 1Z12A 4L16A 4N3AA 1E2EA 3I05A 3RVSA 3ZOKA 1IY2A 1QTIA 2HWUA 5E4YA 2HBZA 3RFFA 5IJ0A 4B7ZA 3QOWA 4JOSA 2GCOA 5FNVB 2EC5A 4L72A 2JGRA 2D06A 3WGIA 1ZD3A 4HGYA 4V02A 3NHPA 1EVQA 1FLAA 3A27A 3PPVA 2IDZA 3PE4A 4FFPA 4YAJA 1RABA 4LDRA 5C7OO 2YHIB 3VJMA 5KQLA 2ZT5A 1XMXA 5JEEA 4MITA 1CEXA 2BG7A 5E0KB 4YJ3B 5EUCA 2VTDA 3IUSA 5FCDA 4O2BB 5FTJA 3T9FA 3UB2A 3ICOA 2GM4A 5U4XA 4LC9A 3KLOA 1C0EA 4A8PA 1RXWA 4KFCA 3HJFA 3ULKA 4DLAA 1QF6A 5KKAA 1XQXA 3FYUC 3BRWD 1P4HA 2AFRA 3OJEA 4D80A 2J4CA 3DO5A 4L5JA 5P8WA 1AIPA 1XAGA 1DU4A 2GN9A 3F96A 1SVMA 1ZKPA 1W25A 2HHJA 4XYEA 4JSTA 3DMTA 4BLTA 1NI5A 5J2TB 5IG2A 4EUHA 3EEYA 4TTIA 5WRFA 1DWOA 3D6HA 2OBNA 3GIWA 3MHPA 4X41A 4Y6QA 3PQEA 1TJ4A 4F3NA 1XZPA 3AFGA 3NTRA 1A5AB 3ES9A 2N0SA 5L7TA 4YRJA 5LNK1 2QLNA 1KWKA 4CXMA 2M6LA 1CETA 1ECLA 3DL2A 3OA0A 1ZBQA 4LX8A 3UJ8A 1K7EB 1OFUX 2ZSEA 3IEPA 4DCVA 3E22A 1Z15A 4RJTA 1SVIA 1E7QA 2W6NA 5HCNA 3BORA 3VI3B 4DBLC 4YMGA 1C2YA 4LMAA 2YNUA 1UPAA 3IE2A 4ARSA 3RC7A 4G0MA 4G5YA 1Y7LA 3S5JA 3VU0A 2A9QA 5C5DA 3ZI7A 5KCZA 3GA7A 3I9KA 4DXDA 4EHBA 1AQNA 4C4OA 1OJLA 3MJ4A 4DLRA 2OGUA 1Q7CA 3IDOA 3GRVA 4PLZA 4MWCA 3RC1A 4L73A 1VLQA 4OHVA 2FQXA 4TTVA 4TPKA 3TVTA 3HRHA 3NUZA 2BZ1A 5TEVA 2VBGA 3WOVA 5JR3A 4CLHA 4DWWA 4E32A 3E2MA 3DD5A 1JH8A 3EW7A 3FPEA 1JQBA 3GJ6A 2BBSA 2C9OA 4FDUA 4CQLA 4HH3C 4FB4A 4XVCA 3M82A 4EHFA 8ABPA 3NT2A 1M9NA 1CF2O 2HMYB 5BN5A 2XIJA 1KC3A 3CNNA 1CVLA 2CN1A 2JD1A 3BDAA 4BP3A 5L45A 5KC9A 5SYAA 1K75A 2RAFA 1EG7A 3FYTA 1ECFA 3NHLA 2Q5FA 3QUAA 3ZKWB 1P1RA 2GK6A 3ZQ6A 4PV7A 5B3LA 1VSQA 3K9FC 1KH1A 4YVFA 5BUSA 3PUWA 4RIFA 4YAGA 4DIBA 2ZYSA 1LVHA 2ZSHA 4WJKB 1C3VA 4X60A 2IV3A 1SOWA 2R6CA 1QTNA 1NF2A 1IXYA 5A3JA 1NXTA 3QIVA 3FPLA 3A26A 3FUXA 4CM9D 4KLRA 3VNRA 3UKJA 2B4RO 4HEJA 4KAXA 2E18A 3OZUA 2GWHA 3IR5A 1JFFA 1P73A 2ZYAA 1O96A 2VQ6A 3PNOA 3KWLA 4RKYA 5EY5B 3SC3A 5ALZA 2G25A 4D8UA 4RMIA 1CRWG 1H2AS 4QUEA 3W6UA 1KSHA 4H1UA 3VNUA 1AZSC 4MINA 4Y9DA 4POOA 1KIFA 1EKXA 1KAMA 4PO9A 4R51A 1WKCA 5IYZB 2UYOA 1G21E 3EJ6A 3BMCB 4QM6A 1Y1PA 3P4XA 4LJKA 5A05A 3VJLA 4NPCA 4COKA 2XUKA 2QX9A 4INZA 4QG7A 4B3XA 3HJGA 5C1IA 2QRHA 2NO4A 3D54D 3NEYA 3AUUA 4YRBA 3U26A 3I11A 4HWGA 3LHKA 5K3OA 2ARKA 2R1TA 2QRGA 1CRZA 4Z9BA 3AP2A 3BV6A 3EEBA 5EP2A 1VB3A 1H1LA 1XF9A 4A23A 5A5VA 5I7WA 4CHLA 1DXYA 3QVVA 1P17A 4GO1A 1WY7A 2Y68A 4V0OA 1O87A 1IHPA 4TTAA 2WIBA 3ADCA 1ICEA 3CU5A 2J5BA 3CE9A 2F62A 1AKWA 4KQWA 2NUPA 1SCJA 4RL4A 2J3JA 3JRXA 4H77A 3G2IA 3RASA 3A6DA 1OHHA 3OFSA 3PXDA 3DVAA 4XQCA 4ZU6X 3TTUA 3ISJA 4MYSA 5CB0A 5IARA 3RRBA 2VDJA 2R8RA 3LUCA 2QM3A 1PJ4A 3TRJA 2TYSB 4H4CA 2CV1A 2VQ3A 3CLRC 4A6PA 1GU0A 4BKOA 4CKWA 2Q5CA 4XIIA 5IXSA 1CG6A 2EW1A 2X22A 2ZIXB 1V8BA 2H65A 3OY2A 4I14A 3ZCRA 2ZZNA 4ZCRA 4W5WA 4IGIA 5FPQA 4D3FA 5AXAA 2A9VA 2IEBA 4F9FA 3UYKA 2IE8A 1NZFA 4PYLA 2W6IA 4U0KA 5C4IA 2Q50A 5IBPA 1W581 5CX1B 4WJLA 5A23A 2VK4A 1ND5A 1YIAA 3PTZA 3TQFA 4CGYA 3O0DA 4KDFA 4WJZA 2C4TA 3HN7A 1XTVA 1EDZA 2AIRA 1VI2A 1KMNA 1TAHA 1PR5A 1XEXB 5FJIA 2HLNA 3FFBA 3GQBA 3OZVA 3REQA 4AO7A 1AXRA 4B6RA 4D56A 1O5IA 1T8TA 4N8SA 1T2AA 2WKRA 5F5NA 3C3PA 3W2GA 3BUSA 1JLLA 2BISA 1P44A 4WPGA 5IH3A 2FP4B 3FPHA 3LC1O 5THKA 3B8EA 3S70A 2XUQA 3GNSA 3WJ1A 3FOAA 4XM0A 1MFPA 1TGYA 1DBSA 3P7MA 2H85A 4R8VA 5JNVA 4RZ2A 2XVXA 3I9OA 3AF1A 1AKEA 3FPCA 4QNRA 4QT4A 3NX4A 5BO5A 5JZSA 2YVAA 1WQ1R 1E0DA 3L8DA 3TQCA 2YFQA 2JLBA 1X94A 4LRUA 3IEUA 1LLUA 3MD7A 1XLVA 3K8ZA 3K9WA 4KDCA 3NVDA 2IYZA 2YNVA 5D86A 3S8EA 2QQ5A 3UV6A 1S2NA 1SC3A 1OBFO 2X2EA 2ZU6A 3JWPA 2FSVA 3H2SA 3KHUA 1NT2A 3QKSB 1GSHA 1G8PA 2BGKA 2FMKA 3IA7A 1DBVO 4FM9A 8MHTA 2F3SA 1V2GA 1KRXA 4BUCA 4UD2A 2YV5A 1JZQA 1HDEA 1KOFA 2RGBA 2VPPA 2XA2A 1I7QB 5I7AA 2X8WA 3GLHA 2VN8A 3U56A 4U7JA 1TZMA 3DEHA 4PCAA 1WR8A 1QH5A 4R1TA 1SHUX 2ZWRA 4TM7A 1ZD9A 4O1IA 3OM8A 5EIEA 1U9IA 3M83A 4LQLA 5ARCA 2XQIA 4R01A 1H5UA 3DPSA 4RZXA 3RVOA 4F2HA 5JTTA 4AY3A 2C5EA 1DCKA 3PITA 4KLZA 5BN1A 2D59A 4WESB 5FRDA 2TMKA 3ANYB 5IVKA 3P96A 4JUFA 2E9SA 1D5CA 3SYLA 3F8SA 1KYXA 1GAEO 2Z8YM 4XCQA 4QULA 5K0EA 4AJOA 2Y1LA 3M1IA 1EBFA 3CH7A 3FZNA 1K08A 2FRVA 2YNMA 4TROA 4Q93A 4BBZA 1R10A 4FSHA 1OXTA 1GGJA 4L4ZA 3CF4G 5CB8A 2ZWIA 4GWGA 4ZI5A 4BAUA 4GOMD 2ZJFA 4RMNA 2Q9AA 3BFKA 5ARDA 5KREA 1ABBA 4KNVA 3NOXA 1J5XA 4KAAA 1FMCA 4QBTA 5HW0A 4BLRA 1DOHA 2OBLA 5CURA 4C06A 1U8UA 3M6UA 5IAKA 1Y5NA 4A0FA 4QUIA 4DS3A 5FWXB 3PGLA 4N48A 1SJ9A 1QZTA 1P18A 1FFCA 2AJ8A 2YQ4A 4UBIA 4JKYA 4HPXB 4U4LA 3OZGA 5AOVA 3H9JA 1JSLA 1NF8A 5TNXA 2QTFA 3TOVA 4EECA 2PZBA 2WPNA 1HQKA 1W2WB 4J8PA 4O63O 3EUWA 3AUKA 1U3TA 3EVGA 3PR1A 3QP9A 4OSEA 1Q91A 5FUYA 1CERA 4QXMA 5KX5B 3FF4A 4D1VA 1FFSA 1OXBB 3FR7A 3KZ1E 1E79A 1U6JA 2PH1A 3K9NA 5IU6A 1OJ7A 1P91A 1JKIA 1ZMOA 2Q3MA 4L4RA 1EAYA 3H5AA 2NO9A 1RLTA 2V7QA 1DQYA 3BHIA 1LS1A 3WNQA 1VZ2A 1KIMA 2NQ8A 1PFWA 1SFRA 2QR3A 3GO4A 4RKRA 4UM5A 1HLKA 1D1QA 3MLAA 4O4HA 2JDID 3CW2A 2PMWB 5AHXA 5BR4A 4GPBA 5K4HA 1RAHA 4IJWA 2G9ZA 3L1HA 1DCFA 1L5YA 1J5EB 2I3BA 1WE2A 2CNWA 3F7TA 5DO9A 4B6OA 4Q4HB 5GQSA 4F2WA 1CUEA 2FKNA 2GOYA 4E5SA 2P9ZA 3AZQA 1RZRA 1VKJA 3DPUA 4D4HA 1ONSA 4O0LA 4K1XA 3K7EA 2AQHA 4UBLA 3IDFA 1TQDA 4NR0A 3IMGA 2ENUA 3PQ7A 3P0JA 4RIEA 4BNIA 4FDLA 1Q5PA 4FR2A 1MB4A 4H60A 3NS7A 1BN6A 3QPAA 3ZE6A 3F9OA 1WL8A 2CD7A 1QV9A 2NO1A 4J1NA 3JW8A 2TMGA 3A0RB 5BV7A 4MGHA 2A9JA 4E5NA 3F49S 1SB9A 1VCIA 4U2GA 1FQOA 3TZ6A 3V6LA 2XE8A 2XITA 4L3VA 1DIRA 4KFSA 2M6SA 1W1WA 2O6HA 4RAQA 1L7NA 1F60A 3I83A 3HVUA 3KEGA 2GF0A 4XOUA 4HKTA 3T9CA 3AIIA 1XJWA 1I4TD 1T9KA 1YASA 2P9FA 3G59A 4ZHQF 1P5HA 2JLRA 1QH8B 4M8IA 4RIIA 5D00A 4EW1A 2FFBA 1JG4A 3VUFA 4BQSA 1VIYA 3HUDA 4WNIA 3RVDA 1YI8A 3SM3A 2IPAB 4MR7B 3W79A 4DR5B 1GZUA 2SKCA 5JMTA 2E4XA 2GA9A 2I3GA 1LPOA 2OBXA 3Q2OA 4PRLA 4Q15A 3UHPA 3ZV6A 1R3DA 1U5CA 3A6ZA 2M9MA 3LWNA 1Y48E 2PV0A 3BDIA 2Z9CA 3DUFA 4YP0A 5G1NA 1ENOA 4HX9A 1KY2A 4YEDA 4MVJM 4M86A 4CR6A 4P38A 1EWTA 2VZ8A 3R5HA 4Q4JA 3TVYA 2AK3A 5C1PA 2CHUA 3ROGA 1DV2A 5E0OA 1O9BA 4QBFA 4QFBA 1J1IA 3DMDA 1CY6A 1EU1A 1UP4A 3KFXA 4A6DA 4YT2A 3R2UA 3FWYA 3HNPA 5LP6C 4ALLA 1I33A 4HBGA 2QB5A 2JAWA 4DKJA 5KYGA 1B43A 2DSTA 4RJJA 1A2BA 3N2IA 1QC5A 3RG2A 2PK3A 3FMGA 3JWJA 4RY8A 3W7BA 2ZXUA 4IXTA 4HS4A 3OWXA 3ST7A 5JCXA 1TPYA 2IYEA 1JNXX 2KE5A 2OP1A 3GCDA 3O8OB 5AKLA 2I2BA 1N0HA 3QHPA 2DBRA 4MQ4A 4N3NA 5LXTF 5BNIA 2IY7A 4FR7A 4UTPA 4BJHB 3L7AA 4C2AA 4TRNA 1ILEA 2H2AA 3HB7A 4MW7A 1EUDA 1O94A 1WB6A 3C15C 3GA0A 3VOSA 3CLUC 1U2DC 1A9ZA 2N46A 1OXVA 1VCOA 1PUXA 1XRSB 2DKFA 2FH5B 2WHXA 3AJAA 3B70A 2P65A 3BE8A 4KO4S 4U2BA 3DW3X 4D0SA 5HZKA 3GLIB 4R40A 1SKYB 4AP6A 2DTXA 2ZIAA 3QLVA 4OLHA 2BFAA 1G8FA 2IXDA 3DLPX 4QQNA 1R6TA 1V9LA 4WTOA 1LBEA 2EZ8A 3WSTA 1M2GA 3DV0B 3RJ5A 5EJ5A 1LDGA 1E3QA 1NX6A 3DBRA 3QMMA 2AOUA 4TWAA 2F8TA 2EKZA 1YRAA 1SCIA 2OB1A 2PZKA 2CXNA 4O2LA 2R8YA 1ZRMA 2HFKA 3QYFA 2YZGA 4MYHA 4X6XA 4R7GA 1P5JA 4NV1A 4TKVA 2HSZA 1RJFA 1X7XA 5JRDS 4Y2TA 4IF6A 4A26A 4PFJA 4RQAA 4QDJA 5DYIA 1Z0DA 4BMVA 3Q5DA 5BWOA 3GG9A 5AHWA 3W7AA 2XCQA 1E3MA 3B52X 1UBLS 5DKFA 3T1YB 1K07A 4TYQA 2BRUC 2ZRPA 3W8FA 1D03A 1QSGA 3BKXA 3M81A 3LK7A 4DDKA 1ML3A 4OKSA 5JE8A 1P0FA 2XA1A 4CI9A 1HBJA 1NYTA 2BSAA 3HA3A 2FOIA 3IX7A 3OFNA 4PQFA 1VYHA 3LZ6A 1MW8X 2ZM6B 4YJHB 4MI3A 5CDUA 2D2EA 2YVQA 1V5FA 1TRHA 1Z82A 4M9XA 5EWMA 3D8UA 2C4KA 4I8DA 2HDHA 5JS7A 2WE7A 2FMUA 3ANTA 3KU4A 3P32A 3SSMA 1WX1A 3TJRA 4WBNB 1U7DA 3A6EA 3VHXB 2ZFUA 1NULA 2XYQA 2G40A 1HOXA 4CTNA 4PIMA 5K9ZA 3DZHA 5IMBA 3RC8A 3IAUA 1VQ1A 2A7QA 4ZICA 4EY2A 3BWBA 1ZA1A 3OU6A 1IH8A 5DEOA 2JVJA 1S01A 2LXNA 2OVFA 4C5BA 4JGBA 1K2VN 1NKTA 3VTFA 4NYMQ 1N2ZA 1P2GA 1WA5A 3KE9A 2VPIA 5HQ3A 1WSAA 4PAGA 3KVYA 3CPEA 1DC5A 3JQ6A 3T3IA 1GZVA 4B33A 1YS1X 1JB1A 1P7YA 2VEDA 3PC4A 4HN9A 3ZHBA 2LV8A 1N8TA 5AM5A 2QVZX 1LS6A 1U8XX 1ZWKA 2I1VB 3MUFA 4B17A 2VYCA 4H7HA 4XVRA 2N42A 1PJTA 1XVVA 3PLAE 4TL6A 1WDMA 2VHZA 4BS9A 5JNUA 2P0EA 5FI3A 1NX9A 3N7TA 1JIUA 5DNCA 3Q6VA 4MGKR 3WDKA 2V7TA 4FYYA 4ENPA 1BCRB 2WM3A 3GDGA 1GHTA 2UZ4A 5GGYA 4QEDA 4IICA 3KLMX 2NX2A 3Q8MA 3C4JA 2WYMC 2JGNA 4H4EA 5AW0A 1TW3A 4FHDA 4UOQA 3RUCA 4BGUA 2GO7A 5EG5A 1EVEA 5HK9A 5DH9A 5CCEA 1ODFA 2Q8NA 3B5IA 2JFGA 4H2DA 2OCPA 3RD5A 3ZDRA 4H17A 4MH0R 2I91A 2RGUA 2IYWA 5JBNA 4BV3A 5E3IA 1F3LA 1CJCA 3UBMA 1NSFA 1TIPA 1FS4A 3BWEA 4YROA 5L6MB 2J3KA 1TUGA 1V8DA 1M5RA 3W8RA 3MBOA 4M0DA 5AI0A 5DNAA 2R8PA 5E1OA 2LWIA 2Q5EA 4MK4A 4EPRA 1YIDA 3U61B 3SBEA 4NBVA 2VCHA 3Q11A 4LX0A 4TMKA 2WYVA 4DY6A 5J40A 4EFDA 2G5TA 3WNZA 4BX3A 1V3VA 4YNBA 2ECPA 4HWKA 3ZYCA 1OLUB 1K7YA 3U2QA 1G64A 3BEDA 1CX9B 1L4NA 3HYLA 2ZJ2A 4FFRA 1M6VA 3FG9A 3HCAA 4BNTA 2ZR0A 2DFKB 3GT3A 4INJA 2RKOA 1GCGA 2R3SA 3RTBA 2B37A 3GLIE 2I7XA 2EBWA 3AIMA 4R1UA 3LT5A 4RLSA 1EWQA 1AK2A 1SKYE 1ZCFA 1EBBA 2YX1A 3DDSA 5KTYA 4UBQA 1M7GA 3VPDA 3DC2A 1YR7A 3UV7A 1BOOA 2JI9A 2JIDA 3RKUA 5GONB 4A82A 4BO5A 1KPGA 1DTEA 2A4MA 1LNZA 3SF0A 4Z4CA 3ZBQA 2R8OA 1F48A 4HQ0A 3QIAA 3PRHA 2HL6A 2VXOA 5EYPA 2BEVA 3AUXA 1ZQ9A 5K3EA 3RF6A 2IK8A 4QA9A 3OE4A 3OEHA 3TI7A 1U7ZA 2HWXA 4B43A 5MF6A 2P9QA 3PU6A 2IIBA 1UAYA 2XUZA 1AMOA 3L6EA 1ESZA 1XELA 2OAQ1 2C00A 3VDMA 3GEHA 2WWYA 4O1MA 1OBOA 2G6TA 2PZ8A 3NPMA 3UWSA 4EYBA 4IDFA 3VI4B 3UMMA 4ER3A 3NIDB 5BY2A 1HRKA 1KOJA 1X8KA 2W2VA 3QEMA 4XJVA 2QMOA 4GSLA 2VP6A 1JJBA 5ER6A 1PZGA 4ZXPA 1KSGA 1D2HA 1TB4A 4F3RA 5B5SA 2P3SA 1O54A 4Q9KA 2C2WA 3VO2A 4DLYA 1I94B 4J2TA 3CX8A 2E82A 3HY4A 3KDPA 4JR1A 2NXEA 1PVDA 2BHLA 4WASA 1K92A 1ADGA 1IAVA 2ZTMA 1H3NA 3QEOA 1XLTC 2WIGA 3AOEC 3MUNA 1U9CA 4ASUA 3RRFA 3I5MA 3ISVA 3UXYA 1JECA 2ATXA 3JXPA 4RO0A 1NXVA 4O8ZA 4V2IA 2CLSA 3Q10A 4LV8B 5CRIA 3ZZ1A 4BNZA 1NLYA 2ZJ5A 3AHHA 4RDHA 4JBHA 3GT7A 2P0YA 2PHZA 4K3UA 2IHBA 4W1SA 3RLFA 3KBBA 5CM8B 5M5BA 4RHTA 1E1CA 2N1MA 3I09A 1IBLB 3GL9A 2GRJA 3CB2A 4A0RA 4U6SA 5CNIA 1Q17A 5K3SA 3U19A 3N2KB 2F7SA 4DMGA 2JBHA 3FWPA 4MQBA 3L0PA 1J0CA 2QZPA 4PSUA 1OLSB 1EB8A 1EM8A 3LLSA 4C6TA 5ALQA 2WICA 2H2DA 1SOAA 3TP9A 4BECA 1H23A 3C74A 3Q9SA 3QITA 1CE8A 4HZGA 4QOGA 4WINA 3T35A 5ESDA 4J29A 1UL1X 4LHSA 1LDYA 1Y33E 3OAAD 4LJYA 1XCMA 3F2VA 1K0UA 1YMUA 3T4UA 3L7NA 2QJOA 3HZRA 2IC5A 4RD0A 2QI9C 2GF9A 1JAZA 3KUCA 5EKDA 4Y6GB 2GAFA 2LRHA 3V00A 1JG6A 1KJJA 2JZCA 3P94A 2ZRGA 5IDQA 4XX1A 2GYYA 5IXYA 2RJOA 2P2CA 1K66A 3BM5A 4LYDA 3GDWA 2O3RA 1C30B 1WHTA 4IFBA <