5A0VA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
454
structure length
454
Chain Sequence
SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
total genus 149
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0vA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0vA01
5ACWA 4F6HA 2FHXA 3T9MA 4TZEA 4EY2A 5LMCA 5A5ZA 4TZFA 4ZO3A 2BTNA 3X2YA 4CHLA 3BV6A 5AYAA 2BC2A 4RAWA 4UWSB 4LE6A 3RPCA 4C09A 4YSBA 2QDTA 3L6NA 3I15A 3PY6A 3IOFA 3R2UA 2BR6A 4KEPA 2Y87A 4UA4A 4EYBA 2BG7A 4NQ2A 3BK2A 3I11A 5DPXA 2YNWA 5EV6A 2BGAA 2I7VA 3QH8A 5EVBA 2NZEA 4YSLA 4BP0A 4NQ6A 4ZNBA 3S0ZA 4TYFA 4D02A 4B87A 5LLDA 1X8HA 4J5FA 2BG8B 1K07A 2QEDA 1MQOA 3SD9A 4EYFA 4FSBA 2AZ4A 5B15A 2NZFA 3AJ3A 3IELA 5HIQA 4Z5ZA 4RM5A 3I0VA 3IEKA 4AD9A 4EXYA 2ZNBA 2BFZB 4PVOA 4PVTA 2NYPA 3F9OA 3VQZA 2BG8A 1HLKA 4C1CA 3H3EA 5FQBA 4D1UA 5LCFA 2WYMA 2WYMC 1QH5A 2P4ZA 5EV8A 4D1TA 5ACSA 4C1FA 2H6AA 4WD6A 3T3OA 3SRXA 5A0VA 2BFZA 3T3NA 4FR7A 5KIKA 1BVTA 1A7TA 5AEBA 4BZ3A 5ACUA 4AWYB 4F6ZA 1A8TA 4AX1B 2P18A 4EYLA 1WW1A 2FU9A 2FK6A 2YNTB 2NXAA 4JO0A 2Q42A 2WRSA 2DOOA 5EVKA 4UWRB 5AHOA 5AXRA 5LM6A 3DHAA 3DHCA 5FQCA 3SPUA 5IQKA 2YNTA 4Z7RA 4NQ5A 1YCHA 2FU8A 1SMLA 1KO3A 5A87A 1M2XA 2WYLA 5HH5A 5K4NA 5K4KA 5ACRA 5EWAA 3SBLA 2M5DA 4TZBA 4D1VA 3DH8A 1JJTA 5KILA 3FAIA 1JT1A 4YSKA 5LS3A 4C1EA 1ZTCA 1KR3A 4H0DA 2A7MA 5HH6A 4D1WA 3LVZA 1JJEA 2FU6A 4TYTA 2BFKA 1KO2A 4U4LA 3I14A 2FM6A 2UYXA 4Z67A 3DHBA 1VGNA 4C1GA 3BK1A 2M5CA 1ZKPA 3IE2A 2Q0JA 1WUPA 4GCWA 4NQ4A 1QH3A 3G1PA 2DKFA 2WHGA 5AXOA 1L9YA 3ESHA 4Z5YA 5K4MA 1VJNA 2I7XA 2BMIA 4XWTA 5ACPA 3IEMA 5ACVA 2P1EA 3MD7A 2ZWRA 5B3RA 4AX0B 3X30A 4DILA 1DD6A 4P62A 1Y44A 1X8IA 4ZEJA 4XWWA 3IOGA 2E7YA 3PG4A 2YNVA 2GMNA 4TZ9A 3PY5A 2Y8AA 3RKJA 2ZZIA 3VPEA 3JXPA 4O98A 3X2XA 5LSCA 5FQAA 2BIBA 1DXKA 4RL2A 1XM8A 2OHHA 2YCBA 2BFLA 4EXSA 1X8GA 1P9EA 3RKKA 3WXCA 2GFKA 3IE0A 2AIOA 5EH9A 3AF6A 2OHJA 3I13A 3KNRA 3ZWFA 2QDSA 4DIKA 5HIPA 3P2UA 3TP9A 2XR1A 3ZR9A 4UAMA 4UWOB 1YCGA 4V0HA 2CBNA 3ZQ4A 4RBSA 2GKLA 4XUKA 2XF4A 4HKYA 4ZO2A 4GYUA 3BC2A 3FCZA 2P97A 4KEQA 5LE1A 2QINA 2OHIA 4UBQA 4C1HA 1DDKA 1E5DA 3KNSA 4GYQA 4C1DA 1ZNBA 4RL0A 2YZ3A 3AF5A 4AWZA 3ZNBA 2FU7A 5ACTA 5HISA 3ADRA 3A4YA 5K0WA 5B1UA 2Q0IA 4Z6XA 1WRAA 4J5HA 2ZO4A 2HB9A 4FEKA 1YCFA 5A0TA 5AHRA 5ACQA 3SFPA 4EFZA 1BC2A 2I7TA 4HL2A 2R2DA 1BMCA 3Q6VA 4RAMA 2YNVB 5HH4A 3SW3A 2VW8A 5ACXA 2YNUA 2Y8BA 2BG6A 4UWPB 5HIOA 5LCAA 4HL1A 2BG2A 2GFJA 5EW0A 2GCUA 5EVDA 4Z60A 1WUOA 1XTOA 2FHXB 3IDZA 3IE1A 5LCHA 5EHTA 2Q9UA 3KL7A 3X2ZA 1VMEA 2QJSA
chains in the Genus database with same CATH superfamily
3WQRA 1UZUA 2WWHA 3HACA 3H0EA 4F46A 5HHTA 4FMCF 1HM5A 3L4EA 2RHLA 3H2HA 2FZ4A 3PJDA 1L7DA 4P82A 5AKIA 3Q8XB 1E2BA 4Q3EA 3FDIA 5E1OA 2CLDX 4MCAA 5LMCA 3HJAA 5HDBB 3ZE8A 3TBFA 5B5SA 1WDTA 4WKOA 2CGEA 1PZXA 3A1VA 1CW2B 4RZSA 5JJLA 1JHQA 1WO8A 3KWJA 4HO1X 2BGWA 2Z6UA 1QZUA 2I8LA 4PGMA 1E3IA 1YZHA 1BE1A 2FSGA 4HX2A 4TTQA 4DF3A 1JG1A 1Z0KA 4QLOA 2D1RA 5IKOA 5BW8A 3ZDCA 2MT9A 4YSBA 2QM7A 4WY2A 2XIQA 4RM3A 4TQUS 2FSPA 1J22A 1W4ZA 5KYXB 2PIDA 4LVUA 5JAHA 2H92A 4RX1A 1P5RA 2VAWA 3SHFA 3PEEA 2H5IA 5HKBA 2IL1A 2IOFK 3RIMA 121PA 2RCYA 4GPEA 3ZIAD 5JS6A 2WV9A 3P0RA 2BF4A 4MPRA 3ZDFA 3EQ2A 3AETB 2HWXA 1WUTA 5HBRA 3IOCA 1Q7GA 4P83A 3FMPB 1IU9A 2LW7A 2Z2YA 3P5BA 2Q6TA 3QOYA 3QPAA 5ALHA 2IY8A 5TQ0A 5IG2A 4YIKA 1K88A 1DAPA 2C00A 4JWKA 4LWZA 5AVUA 4YDSA 1KSHA 1SVNA 3FIUA 4LFAB 1G8MA 4JLPA 4MA4A 2Y3IA 1R6VA 2WG0A 2NLOA 1QU2A 3ZVRA 1T5TA 4DL9A 3NUZA 4UD6A 3CPHA 5DM2A 1C0EA 1CJMA 2VHJA 2HXYA 1CXZA 2XV1A 3T9DA 3VMMA 1KOFA 4MOWA 4ZNBA 5EY5B 4HMPA 1CVLA 2J5BA 1ZBDA 4MV6A 3ZCQA 2G1JA 4AY5A 3D7SA 2DAPA 2FQYA 3ENVA 1EVQA 5EKSA 1A8HA 3H99A 1TD9A 2PSFA 3K7EA 3MWLA 1LNZA 3EPPA 4C2AA 2WAMA 2B5VA 2XNKA 3QRWA 4OFBA 2XVYA 3V6MA 5BXQC 1T25A 1Y8ZA 3IKLA 1D0SA 1ZJWA 2BG8B 2WKQA 3PQEA 4ND8A 2AX3A 2OHXA 4IL5A 3HXMA 3T8YA 2CUZA 4OP3A 5JPIA 1IUKA 4AJHA 1FSGA 2VCHA 3TX6A 2VRCA 1H6BA 4U7TB 2KLBA 3GDGA 4MX8A 3OPXA 1SBTA 3ISTA 5F2OA 4X00A 3K53A 1EDDA 2B8EA 2BY4A 2F3SA 4RCYA 3J7AC 4RA6A 5F64A 2WU1A 2ZQYA 3MWEB 4Z5ZA 1D0IA 3QQPA 1EFTA 3HUUA 2QUAA 4JFAA 1UPTA 2Q5LA 4AXXA 4E08A 4N6OA 2X4LA 4WUTA 1CZNA 3KTAA 4KMRA 4W9NA 2OMEA 2NMVA 1SXIA 3I64A 3WWOA 5JS8A 2EAUA 4X66B 1BWPA 5K99A 1RYDA 3ZDRA 3OECA 3SYNA 3STUA 3H7AA 3T35A 2NACA 3P4YA 4A7PA 4I6EA 1E3JA 3H2YA 2AKEA 3RRNA 3ZV4A 1QG6A 4D6YA 3V9PA 1QTNA 2VYVA 1UZLA 1VGVA 4B2LA 5FA8A 4KBGA 4E94A 5FQBA 1Z17A 3DEFA 3FETA 4GR9A 5DBFA 2XQFA 3BPSA 4WOKA 4B43A 4B48A 1QRTA 2QTNA 2D1YA 4LY0A 3AOGA 2HIHA 2NO5A 1F0KA 3OAAD 2D8AA 3WHLA 4G4JA 4D1TA 1WXGA 1OZAA 1Q0UA 1OX4A 5EFZA 1EBUA 2QRZA 1J07A 5TE9A 1HKHA 4UNIA 3T3OA 4WD6A 1N2BA 3SRXA 1CS0B 2PWPA 3NKVA 3BF8A 2BFCA 2PO5A 3STWA 5LUBA 3D64A 4OSEA 5GONB 3V00A 2JGEA 3RVNA 1EFDN 1JEQA 1FTYA 1U7HA 2L82A 5C4IA 1YVPA 1BVTA 5F2KA 1V3VA 3GPBA 3WL4A 1EUCB 4CT4B 5JFGA 2I2DA 3H75A 3VPDA 3W8NA 3URMA 2DC1A 3I6YA 5KNBD 3KZVA 2C8JA 4IMIB 4LHSA 1A8TA 4ZHQA 2NSLA 1O0SA 4UNPA 4OLBA 1DT5A 4LY9A 5ALFA 2FGKA 2VFAA 2GD1O 2MYUA 5KEIA 2XCUA 2GBFA 1MEEA 2AE2A 5KWJA 1AUOA 3BIJA 2ZJZA 3ROPA 4RSRA 3G49A 2YNMC 2YWEA 4Z4GA 3R77A 4XJSA 1I2ZA 4QZVA 5DHUA 4KRGA 3EMDA 4IDNA 4UPEA 4W99A 5T3YA 2C03A 1CUYA 2R6R1 2XYHA 1MJFA 5K09A 1M54A 3LCJA 4XFKA 2ZR0A 2VTBB 3TIIA 1JLHA 3QELB 2FLWA 2CYCA 1M2JA 3S1SA 1IY9A 2IP2A 4YCBA 3JQRA 1GNRA 1ZL0A 1W76A 3LBNA 5IW8A 4BB6A 4DWVA 4EH1A 1F4VA 3LZCA 3K9GA 1YKFA 4FHGA 2ID8A 4I8XA 1HDGO 3MMZA 2ZUTA 3M6UA 4OU4A 4OIFA 2QG9A 3LT0A 4TN5A 4TRJA 1ZA2A 5DLYA 1XHEA 1X7ZA 2P3SA 4HZUA 2DLCX 3L6UA 5FOQA 2OXTA 4FYMA 4S2UA 5JJ5A 3BB3A 4RZQA 1L5NA 5I3ZA 4RSHA 2XNSA 5CB4A 4KYTA 3M9WA 1WB5A 4ZVOA 5JD3A 1IN6A 5HKLA 5K6AC 4JT8A 1D8AA 3TMKA 2YZ7A 4ZVPA 3DNPA 2OFOA 3PXCX 3ADPA 3C1TA 4NMLA 5KOHB 3CVOA 2PDAA 4LJRA 3BD6A 1TKAA 4ER0A 2EU8A 3FFTA 3M1AA 2Z8YM 3NTUA 2Q5IA 1ETUA 2JGNA 3NH6A 5H16A 3UJ9A 2WJ3A 1UPXA 4PZLA 1M6EX 2P2SA 3CO5A 1KI1A 3NFRA 3WRWA 1TPYA 4MUFA 3L1UA 5H9VA 2BHSA 4JT4A 3LVRE 3SJAA 5MGNA 2Q3DA 4CCSA 1J7JA 4GM0A 1ORRA 4MJ3A 1KO8A 1N75A 3D3JA 3Q9NA 3RIHA 3H9GA 1PP4A 2WV7A 4WDQA 2RGWA 2DECA 5EWJB 4KLZA 2JIBA 3RM3A 3GJRA 4UM7A 3KEQA 4IM7A 4OQNA 4TZ6A 3ESCA 1YACA 3QKUA 4JUIA 4BEVA 1GYPA 1R0CA 4ZKDA 1MEOA 2F3PA 1FDVA 3LUBA 3NC0C 4GUDA 1T3TA 1ZIDA 1FFXB 1HPLA 3R5XA 4L3OA 4DCNA 3AOEC 3BIOA 1SFRA 1C1XA 1NBIA 2R4UA 4IIYA 3PUYA 1UIRA 1KY4A 5JNUA 4NWIA 1QB7A 4WXMA 3QKIA 3T06B 3WAGA 4EHAA 1TJ5A 3GG2A 2FDXA 1KDZA 4FWTA 5C52B 1C3LA 2A86A 1QHHA 1WRBA 3NBUA 4K9PA 1L5RA 4NAVA 1GZ6A 2O50A 5ER6A 2WYMA 2CL5A 3BFXA 3RU3A 3ZZ0A 1UXJA 1RQRA 1V25A 1TZCA 2ILVA 4RWZA 3ZY4A 4MGIR 4CKBA 1C81A 1DX9A 3CRNA 9MHTA 2DF8A 2V45A 4LDNA 1HR0B 2C99A 4FJ1A 1W34A 4OHOA 1ZRNA 5ALIA 1CNEA 5U1PA 1EP3B 1OLUA 4L9AA 4C4AA 3CH6A 1NTRA 2VRWA 4X24A 5TMEA 3RSFA 1JQLB 2HIGA 1SKBA 1VMDA 2BFBB 5CH5A 4UXHA 1U99A 5J63A 1R5NA 1X80A 2CMGA 4MLPA 1IIRA 5K9ZA 2VSXA 5DPMA 5K4MA 1ES9A 1VYVA 1IBSA 2VRBA 1BSVA 1Y1QA 3FPHA 2PXCA 1K2VN 2WJVA 3IAEA 4IJQA 2XCSB 4EY7A 1O7JA 3FMVA 5CUQA 5IP5A 1G5HA 5TPZA 3C8UA 2W6PA 3AHCA 1RRGA 4HAIA 4TPKA 1TC1A 4UVEA 5FFNA 2OPHA 4A4DA 5K3EA 1QIJA 4PLCA 4NNJA 4FFRA 5A5DA 3NV9A 1YTLA 1YNOA 2B30A 2VHVA 2HLHA 3PDIB 2MR6A 5JS1A 4AW9A 5JADA 3CLSC 1VBFA 4FOPA 5FDFA 2XRYA 1ZITA 3O82A 3CLUC 1WV1A 2UZAA 5HUQA 3ESDA 3JARB 3LW8A 4FE7A 1UKAA 4KLRA 1NRXA 5IARA 5BUSA 2PUDA 1CUWA 2NVUA 5DNDA 4EPRA 4U7HA 5KJFA 5I6DA 2TMKA 1HNZB 1XD2A 3N05A 1FNSA 5DN9A 1XQWA 3TLMA 4DS3A 4B46A 4BO9A 4Y2GA 4XGIA 4KCGA 3RTEA 2CEAA 1ITZA 3P71T 4BO5A 1KRHA 4I36A 1M33A 1M1UA 1L8QA 3BTOA 4UNQA 5D2CA 3UO8B 3UUFA 1T36A 4Z1OA 3ZJ4A 5F1PA 4OYYA 5FOUA 4B35A 3BQMB 3GLGA 2O5EA 3GPCA 1N2OA 1QAMA 2GMWA 2PIAA 4R7GA 1X15A 3KTDA 4EX7A 1HFKA 1JTFA 3GK3A 3FG9A 1ZNXA 5BR7A 4QIHA 2PGXA 4B6FA 3L1VA 2Z2JA 5ECGC 4ENSA 2WMOB 3F8SA 3AJ8A 1LD3A 3LCUA 4EUSA 3PL1A 5KYUA 2A9QA 4G65A 3LYHA 4JUCA 4P5DA 1OH6A 3BWYA 3IPLA 2J59A 2WIGA 3ORSA 3RBVA 2G9VA 3COPA 3WL6A 3WYBA 3HJFA 1PZGA 3C6QA 3WLFA 3KDAA 2W6ID 3QLVA 2DFKB 1DRVA 5HFNA 1P3JA 1SU4A 2FW9A 2H85A 1DX4A 2Z3WA 3DMDA 5FHRA 4YWHA 4FDLA 5ICSA 4JCOA 4PYLA 3HO1A 1SMKA 3D3WB 5GP1A 2IWRA 5JO0A 3RVSA 2HD4A 2CVQA 3GEDA 2VBCA 4O63O 3WO0A 3ROQA 1Z4OA 1ZC3A 2OR3A 3PC6A 3FOEC 1SPBS 4C1BA 1Q6YA 2PX2A 2WFLA 4Z6KA 2WWVD 1C3VA 1WDKA 1NN5A 2UYOA 2VHQA 2VO1A 7REQB 1EX9A 3X1XA 4F91B 3JAMA 1RJFA 1UJ5A 1XR3A 2XOEA 1N2EA 4BP9A 1YZ3A 3CG0A 4LFCB 1H3EA 1NXOA 3P96A 4YS6A 4NBNA 4YX9A 2RMKA 1TQ4A 4GKBA 3CCBA 2O1WA 1GZ3A 2X22A 3PJFA 3PPWA 2B1GA 3A1WA 1USGA 4ZOAA 1CQZA 2QVGA 2DPGA 5ALLA 4D0LB 4ALIA 1Z2NX 4NH4A 3QVMA 4PLYA 3ZK7A 3OQNA 3PFKA 5AW9A 4QFCA 3QKRA 4L57A 1EFHA 2QJOA 4B5KA 3IPXA 4J0QA 4BAGA 5I7RA 1UZNA 2AOXA 4QQRA 1ELOA 3M3PA 1H9BA 2VC2B 1Q0SA 3DF9A 3DHNA 5FL7A 1P0IA 5C5DA 1P61B 2WIAA 3UXEA 5CA1A 4UBQA 4FB4A 3KSZO 2IXTA 1RPAA 1E5DA 4TV8A 2JLSA 2DWUA 2PANA 5IVKA 1FDIA 5IXJA 5ARDA 1B8VA 3VU0A 3IOYA 4EEXA 3GDFA 1E77A 3M5WA 4RPLA 4F4HA 2XUPA 1ZHOA 1G4AE 5DNCA 3PD0A 3O74A 3WFIA 1RHJA 2IYLD 2P2DA 1CY0A 4FT4A 2GPNA 1C9MA 2NNLD 3HCPA 3LVBA 4KE7A 4YAOA 2ZPTX 4WI1A 4ZI5A 2J7PD 1IK6A 4ZIRB 2JCSA 5AJUA 3FBTA 3A4YA 3LZDA 4W4TA 2BWJA 4XXHA 3JX9A 4LNUA 2FW0A 4O4HA 1Q14A 2J1LA 4IVPA 2OHOA 2H1WA 1CQIB 1ML4A 3EZGA 3FNFA 3OEWA 1PK7A 4HWSA 5BN5A 4LF9B 5B1UA 2VWGA 2NVWA 3RUAA 4BVBA 2WYVA 3EGDB 3VJKA 3AKEA 2OOKA 2NUAB 3U2QA 3V32A 3N2KB 3KP1A 4HFRA 3D8BA 3CR3C 4KXMA 5C7OO 1DAGA 4G4SO 1H2EA 4G5SA 3JQ7B 3RJMA 4BJ6A 2XCIA 4YRRA 4PLTA 2A67A 4J7CA 2J5XA 1ML3A 1Z56C 2ZWAA 3ROGA 2J0VA 1MB9A 2PRZA 3VNAA 1EU1A 2JIZD 4CV1A 5SZIA 3QMPA 4Y2XA 1WHTB 3CNHA 4OSOA 1T6XA 2QUIA 3X0DA 3H9EO 1XMVA 5TGZA 2RH9B 5F2EA 5KKAA 2C4MA 1PQ4A 3V7YA 1WRAA 4DLWA 4F4IA 3N2LA 3V42A 3UG7A 3DZDA 1B26A 3QFFA 5K4AA 5AXBA 3VKVA 5BVGA 4REMA 5JD4A 2FEKA 1XZIA 3H4MA 2UVDA 3LSYA 3U1TA 3PE3A 3PP8A 3SW3A 4IFTA 1YZGA 4C30A 1FX1A 1XYVA 7MHTA 1SCIA 2ZP1A 5HIOA 4QWMA 2XRFA 1Y9JA 4N82A 1VE3A 5TS3A 3LA8A 4AJIA 3BJMA 3I2GA 3DVSX 2QW1A 3NDIA 2F90A 4MVJI 1AA9A 1GR1A 1NV8A 2VZEA 3THSA 3AZPA 2GAOA 1XNJA 1P5HA 3EODA 4LOKA 5JRZA 1T10A 3TINA 1W5EA 3UPUA 2P7HA 1J23A 2G76A 3CPEA 1N1GA 4CLOB 1EIZA 4ZDJA 3LDAA 3M7IA 5IMBA 3AUXA 1JLLA 3GG9A 3LWDA 5DK4A 1NURA 5ES3A 1JXAA 2PMWB 3USCS 1FYXA 1JBEA 1XMIA 1DO8A 3KWMA 1PW5A 1SJ9A 3M5DA 1OHHA 1DAOA 2DUWA 2HNBA 3HV2A 2YV4A 3JVUA 4NFLA 2QDXA 2GJ8A 1THGA 2F9FA 1UQTA 2JL1A 4RJLA 2IYYA 3D6TB 4F3CA 1E2GA 1ZWKA 3RTBA 1U4NA 1XTKA 1N2JA 3H2IA 1W0KA 4MRMA 4X1YA 1P18A 4DLNA 3FLBA 3I23A 4WL0A 4ZYZA 2F67A 4PC1A 5GOZA 1TIPA 4KYVA 4FKBA 4QQNA 2QLBA 2IUUA 1DC5A 2BEVB 4G0YA 1L5ZA 3USZA 5CDTA 2R4QA 2WT8A 1J20A 2NUPB 2VYND 2I4IA 3MCZA 2OYCA 3OCWA 2M98A 2ZIWB 3GRUA 4DJAA 1RRPA 4UOQA 2R44A 3HU3A 3NHAA 3F2IA 4TVOA 4KI7A 1JDJA 2KBEA 5CPBA 3RUEA 1WXHA 4ZO3A 2XMSA 4GX5A 5CLQA 4MVXA 5FOVA 2O8BB 2GZ1A 2XOKD 1OAOC 5PNTA 4ZMRA 1XELA 3JQGA 2R4TA 3ONWA 3OHSX 3V7UA 2H1CA 4WGFA 2PSJA 4XWGA 1B0AA 1I1NA 1Y8CA 3FPJA 3K96A 3ER6A 4D96A 1BDJA 3CEHA 1X19A 4ZOBA 3VR3A 2M2IA 5JRJA 1P2GA 1XN1A 3KOOA 3L4BA 1MJ5A 2FVXA 4O0LA 5G4KB 1Z08A 1M9NA 4IEIA 1F3OA 4LDPA 4K81B 1ZRMA 1XT6A 1P31A 4YECA 3H0CA 5BW5A 3HUEA 3NDRA 3PFBA 1XYYA 4H7IA 2M9MA 4B81A 3TLYA 1DMRA 4UWOB 5J4KA 3JWGA 1UWLA 4FWIB 4WPGA 5JDIC 1A7KA 2V7GA 1PS0A 5KDDA 1RXWA 1TGVA 3DE4X 1WXWA 1UFQA 5CB6A 5K8TA 1NXWA 1USUA 1UADA 4WZZA 1EQUA 2PUHA 4UHHA 5ED0A 7MDHA 4MW1A 1DMSA 1WW8A 3ENZA 3IAXA 5KKNB 4XRRA 4RF4A 1I13A 1QMPA 1LRLA 3O38A 1ISHA 2ZWMA 4Q3DA 4DFDA 3OJLA 3KSAC 3DLHA 1FFGA 1WCIB 3GD5A 1ZN2A 4J1NA 2JHAA 2DYKA 4QUEA 4X93A 1QWOA 5DWDA 5ICGA 2ZIGA 1ISIA 4LJAA 1KPHA 5IZ4A 2XLCA 1A96A 5JJKA 4JENA 1KI9A 3W7AA 2C9YA 2RCNA 3NTRA 4GX1A 4RHYA 1EZ4A 2ZJ2A 1OLOA 1TZ2A 4XQ0A 1G3QA 1H23A 4DMLA 5BXYA 5IXYA 3KXIA 3KWLA 4JXKA 3L0OA 3OQJA 3ROKA 4BBZA 3FSEA 9ATCA 1KRWA 1WMDA 2VTVA 3HGQA 2JLRA 5B1YA 4EO9A 3QUSA 5KQGA 2PEYA 1JHVA 5DTJA 1XVAA 1OYYA 2AI3A 3RI3A 2VK8A 3F7OA 3M3HA 3T9AA 2WJZB 3QHAA 4Z3OA 3UJ6A 5T3UA 3S8YA 1NPDA 1NNSA 4JI3B 4KJZA 3EIEA 3MINA 3K4HA 1KDVA 4HRXA 3L18A 4WSOA 5IXSA 4MB0A 2Q3MA 2AV6A 4LJLA 1G38A 2ZNBA 2GM5A 3B60A 4QGBA 5AO9A 4Z4FA 1YRLA 1I4EB 3P4UA 3VOSA 2Y2UA 3C24A 4HMQA 4M1KA 4D8YA 2AK2A 3GOQA 3VPFA 1EMDA 1NWHA 2O23A 3EZ2A 5HG0A 2OXFA 1YQTA 1GPDG 2XMQA 2HQRA 3OEED 1XJCA 4QELA 2ZBGA 3G5LA 5CT8A 3WBKA 3TSZA 1RAAA 1LVHA 3GRYA 4FINA 4JD5A 4CTKA 3OH8A 4URUR 4DXDA 3R8XA 1LFDB 2QYOA 3AEUA 4BB9A 3T0FA 3Q6MA 1SVSA 2BRUC 2XTNA 2NADA 2Z5VA 3B7WA 3PD1A 2VTEA 1S2DA 5LKRA 2VPTA 1QIFA 2VUHB 4BMPB 3FYUC 3W5UA 4WFKA 1C7FA 3OCVA 2B94A 4P4GA 4M0UA 3NTOA 5CW2A 2FMHA 2JJ2D 3T7IA 5IAGA 1U9ZA 4AX8A 3LF1A 1A7TA 3FCEA 2C29D 1IRIA 3A6ZA 3GIWA 1KTVA 1ZP6A 3P2MA 4P3OA 4RLHA 1E2NA 3W2GA 3FPEA 1ACLA 4RH0A 2GZHA 3HB1A 4MJ7A 1P7YA 4A2QA 3FCYA 4RYDA 3SK0A 3MYRA 2GXAA 1M1NA 4M1SA 2YFYA 1E7WA 4BO0A 2WJAA 4CV2A 3FNQA 4MUNA 1MO2A 4RD4A 1F9EA 3ZJTA 4MVJF 1QHNA 4TYNA 2P0EA 3M2PA 3K1YA 4X1IB 4ENRA 4YMGA 1NUSA 3AERB 1KI3A 2LWIA 3DCIA 4KQEA 3L7YA 3OZXA 1WQ1R 2FW7A 2GCOB 1F5SA 4PZPA 5DMXA 1LW6E 4C3OB 1GV0A 1MA0A 4ZVRA 2VPYA 3C3DA 2PE5A 3E27A 3GJ4A 2EYQA 1A8PA 1K5GA 2HBZA 2B6NA 2ZRHA 1M8FA 1RTTA 3VVBA 2RAUA 3Q6IA 2HXSA 4YJ2B 3UAOA 2YWDA 3LDHA 4UKDA 2KHZA 4H35A 2ZVQX 5H9WA 4W5WA 1KMIY 3LGXA 4AU1A 1EQ2A 2VP5A 1KDRA 3JASA 3TLEA 2XWBF 4HJXA 4KQHA 2FRVA 2LGJA 1TADA 4E1AA 3BRWD 3O8BA 4M89A 3KB1A 1P62B 1LLQA 2WU0A 3TRKA 1SMLA 2JZNA 3IJPA 1NKVA 4MA5A 4Q1DA 4BEJA 3FCOA 2A92A 5FBQB 4C6RA 4ZJPA 2IF0A 2PZEA 2H5EA 4Q18A 2Q2OA 3VNRA 3MUEA 2D1QA 2ZJ6A 3TUIC 4RJTA 4YGYA 3VNUA 1YU9A 1DO2A 4MQUA 4GPD1 5FO0A 3RS8A 1VL8A 4HLDA 3UXYA 1AM4D 2LBPA 3H7IA 4MYSA 2X6QA 4AUKA 3JATB 2FSIA 3NBQA 5FWYA 3G13A 4NL4H 1OIXA 3NWBA 3R9KA 2PSHA 2C04A 3AFIA 5A4JA 4LBZA 4D3XA 1U5AA 3F5FA 5E6RB 1KQNA 1BHO1 3EFHA 2FQ1A 4UVIA 4ZOLA 2INGX 1X1RA 2ZB3A 4WK0B 4H0DA 4N3BA 1KS2A 4Y1RA 1NJ6A 3RC1A 3CZRA 4L51A 3DEYX 3UVEA 4XVHA 4OI4A 3RRXA 4QQKA 3ZI7A 3NHFA 1ZQ9A 1E2FA 3I9MA 5IABA 2FU6A 3FVTA 3DLAA 1WXFA 4M53A 5DTEA 1USWA 3N86A 1CQWA 2REQB 4RD0A 5CURA 2XNHA 4YACA 2NXWA 4TYMA 1E7YA 2VA8A 1UCFA 3D3NA 3GOHA 4O4JF 2A4MA 4UBLA 2VCEA 3ZIUA 3MMNA 4EIWA 4EJ0A 1ZC4A 3D6VA 5K8JB 2BMAA 2HPVA 4C78A 2ADMA 4I9HA 3DHVA 3FUVA 1Z28A 1ZIXA 4IV5A 2I67A 4TQ9A 1NUUA 1PYDA 1NM5A 2Q4EA 1WBJB 3HP4A 4PO3X 3ZWKA 2A9KA 4P5PA 1CWUA 5GJBA 3IE2A 1JX6A 1Z4LA 2R6HA 1GTL1 2A94A 4ROSA 5DFAA 3VZRA 1SUWA 5JD5A 1MNAA 1J24A 2HA2A 4XVCA 3HXLA 1QRAA 3HA5A 1OFGA 5GMOA 4BNFA 1WU8A 3AKZA 5DBGA 3VZPA 1QK3A 1P9WA 3S27A 1TT7A 3CNEA 1G6OA 4V0OA 2GN4A 4TTIA 3V8MA 3FCUB 3BZWA 2BBOA 3DQQA 3QF4A 4KEAA 4Y2RA 3UWKA 2CZQA 4BGVA 5JCPA 3QX3A 3EC1A 3IVAA 3OJEA 1GDDA 1EFRA 4HX9A 4P93A 2BKAA 2XDAA 4XWTA 4X91A 4DXHA 5LOVB 1LBQA 1EK5A 2X15A 1QQAA 2WIJA 2EX1A 2WPDA 2ZAIA 1MQSA 2O0KA 3M6IA 4FEGA 1X7XB 5GV7A 1MH9A 1EUQA 4NU6A 4OPMA 2WA2A 2HCJB 2BFPA 2G80A 3EGOA 2M6RA 3PUZA 2IS2A 3BOSA 2HM7A 1C1HA 4HG2A 4L3VA 1H0HA 4BRZA 1E5XA 4B7CA 3ZWPA 5FIUA 4R51A 2QPLA 1GWNA 1Q83A 1IJKA 3GZTB 5IBRA 3W06A 5I7WA 4EGQA 1U0BB 1XC7A 4R2JA 2VA9A 3BMCB 1Y3HA 5JDCC 4JN6B 1DEOA 1JMYA 1F2UA 1BWSA 1LLDA 1XVTA 2IYFA 2P9TA 3TSCA 1Y44A 1IK4A 1CULC 3MGCA 3TIVA 3EXIB 3A1NA 3TTYA 1E99A 3W90A 3Q0EA 3E7DA 2J0UB 1XZQA 1L7RA 2H52A 3LXRA 3T7DA 2C7RA 4YHHB 3GJ5A 4WXYB 2OQIA 1V6SA 5DHPA 1K66A 1VGQA 3PWTA 3RFXA 4PONA 3PK0A 1KZYC 2GQ0A 2XUFA 5A9SB 3LPNA 2FZLA 4B9AA 2Q0XA 4YDRA 3DV9A 3FTQA 4OSPA 3C5VA 3MT7A 4DCSA 2CUTA 5ARCA 4C7OB 2ZYAA 4C01A 3U7IA 5F3DA 3NAQA 4AULA 4E5KA 4DR2B 1AT1A 1SBZA 2JGDB 4GXNA 1XKLA 1WM1A 2VBIA 4IV0A 3VPEA 2J32A 5JG7A 3U44A 3ZWMA 2O2SA 5LYJA 3KXKA 1GZ5A 2MSNA 1SUPA 2BIBA 1U80A 3DQPA 1DTSA 1X38A 4AQYB 4EY6A 4HS4A 1XRNA 1CJCA 1PR4A 4PR0A 5FNVB 4BGDA 4XQGA 4Y6RA 2V59A 1L1FA 2ADOA 2ZSIA 3TE6A 4BBJA 5DNEA 1E7RA 1VE9A 5JMTA 4I4TB 4YRBA 4E88A 4OX9B 4UTRA 1C7ZA 1KEPA 5CA0F 2Q6OA 1QLHA 1ZN7A 3IESA 4FCTA 1B8NA 5ERYA 3WGQA 1SQ5A 2C83A 1CE8B 3FGNA 5A3JA 3OD1A 4UDOA 3M1IA 2R25B 3DVRX 4H3VA 3UCXA 5HP4A 2OCGA 1KFEB 5ANRB 3W3AD 2BOVA 2ZB8A 3HVIA 4MCHA 5CB8A 4ZODA 4FKZA 1ZJ4A 2HA5A 3B1ZA 2JVIA 4QUGA 5DHAA 1IWBB 2BIFA 2YZ2A 1P6QA 4GPAA 4N5MA 4DWOA 5K0EA 1VJ1A 2AXEA 2O2CA 3K20A 4MRVA 2PA3A 4IDBA 3IPYA 1U98A 3ZZTA 1BXRA 3IKMB 3ZJVA 1ZNQO 1UBCA 4XZ3A 1ADJA 3MRTA 2OGSA 4NVRA 1R0LA 1NQOA 3WDLA 1RWWA 1NHGA 3C3KA 3N2EA 1TZBA 1VSQA 3OOJA 4JBWA 4B6OA 4Q66C 3NTQA 1Q44A 3GLSA 1RXIA 5EQTA 1L7VC 3ZD6A 1OFIA 1Y9DA 5CXSA 2IPMA 2HR1A 4WK6A 5LDGA 1JMKC 3RU7A 5J4LA 4FILA 3PTLA 1Y4SA 3MWDA 4QARA 2XTAA 2FZWA 3RHTA 2PBRA 1NDQA 1US8A 2OBYA 2BTQB 3Q15C 2HSJA 3IXQA 5JC8A 2L69A 2AK3A 5IJAA 4ZQCB 1ZESA 3MAGA 2OO5A 1B1CA 3EQ8A 3P9RA 2PBLA 4FYIA 4R9VA 3RVRA 1FB5A 2BGMA 2FPGA 3EXHA 3LY8A 1HNWB 2YH2A 2Z8YA 2J9YB 4LE0A 1C30A 3QEMB 3TLXA 1P44A 1OXVA 1QZ3A 2ZSJA 2AXNA 3HADA 3PVCA 3VR4A 1GHTA 1OWOA 3LCMA 1KSJA 3DOEA 1L3CA 5CK5A 3KUCA 5TPWB 3RVLA 4HUQA 5FL3A 3LX6A 4ITRC 3LSTA 2AQKA 4E13A 4EATA 3OIWA 3R0QA 3FTFA 5I7EA 4QX6A 5JI3E 1KHTA 1MENA 1JG6A 2DHEA 4J4TA 3A3PA 3GEEA 3P8ZA 4A6DA 4P7BA 4CEJB 3NBXX 4XWOA 2L0XA 4TMTA 3TVTA 2ZOSA 2X0DA 3CNLA 4JOQA 4EMUA 3WJ7A 4F7WA 3LHKA 3PUKA 2PQMA 2KMLA 3MD0A 4R81A 3AHJA 4AY6A 2ZEJA 2V7BA 2JI9A 2ZQ5A 1RABA 2YYZA 3INRA 5ACQA 4D79A 3OFVA 1U4SA 4NE2A 5FBLB 3ZXYA 5K0JA 2IOFA 4RZ2A 1JIUA 3D4IA 3QG5A 4RK5A 3IERA 2HSDA 1KZ6A 2XTZA 2GETA 3CX7A 4L27A 4P3YA 5E2BA 3ZNQA 2VF5X 4EW1A 3W1VA 4E5YA 4J0EA 5CM2Z 5HKKA 1DRWA 5EWLB 2IPXA 1GNTA 2OBMA 2J6IA 4ESVA 3JR7A 4MR7A 4RM2A 1NW3A 2R8BA 5HH4A 5G0WA 1HYQA 1EZZA 3EF3A 3T1QA 1BGWA 2ABWA 1IVYA 2YWCA 4E5MA 3ZKWA 2G9RA 2C2ZA 1QC5A 2HRZA 4OGFA 1EA5A 2O7NA 3IMGA 3IMCA 2Y0DA 1C8KA 4UXIA 4FW9A 1RVDA 1YAJA 3HDGA 1ZI9A 2XKJE 1N5MA 1X13A 2BBSA 2QMYA 4C0AC 1ANKA 4F5DA 3DKKA 1BH6A 3K9CA 3B70A 1JAXA 2YV3A 1XRJA 2JD2A 3WK4A 1EP9A 1UDXA 3IBSA 2Y8EA 4MQFA 1GP2A 4OXKA 3T7TA 1YJQA 2GH1A 1NMEA 4CKEA 3FX2A 1Y6QA 1BFUA 1LPOA 3SBOA 2JKZA 2ZBVA 1QLJA 3PXXA 3SNHA 2QTCA 4UTNA 4KQ9A 4MWCA 3IOBA 4JBIA 5TJHA 5A3QA 3K71B 3IDZA 2PAAA 2G7ZA 3FOCA 3L93A 3L02A 3UT5A 4ARBA 5KYYB 5D3ZA 2N42A 1YDMA 1YR7A 3FTPA 1LS1A 2G08A 4GEKA 3H1PA 4ZK2A 2WTUA 3DFIA 4YROA 1D4OA 3AJDA 1RLUA 2Q4TA 3I52A 2PLAA 2AI2A 3M6FA 1V5FA 2VHTA 4KO1S 1PNQA 1SIOA 3GGCA 3PGLA 2QR5A 1NXTA 2OEPA 2P5UA 4C04A 3HVUA 10MHA 4EI9A 2IH4A 1UC9A 4KG7A 2XXAB 1TQHA 3NANA 4RY2A 2ZIEA 1JQEA 1M2EA 4BCCA 2VT6A 3QBEA 2XB4A 4R1LA 2W98A 4JEUA 4WZBE 2HWKA 3QNWA 3KEMA 4EP1A 4F3KA 2CJYA 1Z33A 2Z2IA 4JLBA 1F2DA 1BA3A 2W90A 1G8SA 1XEWY 4OBBA 1ARZA 4DMGA 1XF1A 3AW8A 4XPZA 4O4LF 4R9NA 3TLGB 2GPWA 1RWQA 4AG6A 2B82A 1R0YA 1Q3KA 2BEWA 4DLXA 5BWOA 4FOSA 4NBKA 4M87A 3Q8KA 3BSWA 2A9JA 2HA4A 3UV7A 1VSTA 5AUQA 4XUGB 3B48A 2MINB 3L8ZA 1B93A 2CDRA 1QGED 2QB5A 2TYSB 4Q12A 2BEUA 4J0KA 3KPWA 4KHZA 4N6NA 4RKYA 5KQMA 2P2NA 2QDTA 4FYYA 2BDTA 3LWBA 2A5GA 4OLAA 3OJCA 2YMMA 5CT6A 4DCTA 3DKIA 4XGNA 4D6PA 1CZHA 1FA9A 2BR6A 4XEHA 1NVFA 1ZMRA 3FZGA 3OLWA 4AN1A 4JJKA 5F7ZA 4GD3Q 2Y87A 2OBBA 2A4KA 4CMIB 5IPFA 1KEEB 2IDZA 1TRHA 3QVUA 1M0EA 4KR6A 3EULA 4J76A 4K6CA 2PR7A 4LC1A 1KYXA 3QXJA 4L8VA 3B3FA 1STOA 3GJ3A 5GINE 4Q9IA 1RRVA 4F71A 2XE8A 4JLDA 2OC9A 1XD9A 2KSQA 1YZUA 1AZLA 1NMZA 1NY6A 1YSCA 3GLHE 3HCFA 4OH7A 3UW1A 2BUCA 4M0MA 5ALSA 2BGAA 1OD6A 5KYXA 1QQ6A 5IT0A 1RJWA 3ZUGA 5HKAA 1N2SA 3OIGA 4FMCB 4WY8A 1T13A 3G7UA 3V2UA 2JGIA 1NOJA 2VF7A 3HNRA 4RL6A 4CDGA 1UBHS 3Q5GA 4I2VA 1TZMA 4P2BA 4REQB 4ZT6A 4UM9D 3VTFA 1SD1A 4TYFA 1JS1X 1EDBA 2NPOA 3UH0A 1RI3A 4TWBA 4LF5B 4LECA 2A9OA 1EWTA 1NJ8A 3CT4A 3T94A 1POXA 2X58A 3LT4A 4NBSA 3VBCA 1S5PA 1LCIA 1LF0A 3FDFA 1I7DA 5BNTA 3KKZA 1LS6A 3ICOA 4I6JA 3R5FA 2YHSA 2XE6A 3SWWA 1V6CA 5IVHA 1RWKA 3MIZA 1U1CA 3QBVA 1ICIA 1ZIYA 2W7TA 5LJLA 5A4KA 4BIIA 2OCYC 4GC9A 3E23A 5JD6A 2PL3A 5EEHA 1CF2O 4MIOA 1T3GA 4R16A 3D8HA 3TD2A 1EM8B 3R9IA 1SG9A 3LVQE 1PFWA 4JI0B 2ZUWA 2Y67A 4L5JA 3HRKA 5F21A 1G8HA 1XSEA 2XWSA 3CF4G 3KOZA 3LPAA 2OFFA 1NQUA 3L7MA 1P2DA 3LBYA 4C6SA 3SD7A 5DHTA 4D5GA 4ETMA 1R7RA 1E7QA 4IJMA 4W9NC 4ARSA 3JD3A 5IKMA 3BRCA 1JR3E 3HCDA 3IP5A 3KR9A 4GDFA 4OP2A 3ZJYA 3HZRA 1ABBA 2BG8A 4BWGA 2QL5A 3MTAA 1TI7A 1PR9A 4RTLA 5EL0A 1BU5A 1TE2A 4I19A 1MJGM 1KJQA 1NRWA 1QU3A 3E9CA 3NORA 3BA6A 5KYNA 1G20E 3S44A 3WB0A 1R1DA 3IA2A 5ER9A 3CCCA 3O4VA 1I51A 2OXRA 1Q21A 1D09A 2JAOA 2QRVB 3MWEA 2VF4X 4H27A 4M8LA 4OB6A 1XLTC 1BOOA 1R10A 3HJNA 5ECYA 1F48A 3V34A 2MYTA 4KGDA 5DYTA 2FAXA 1WXIA 5BYKA 4DBLE 2FK8A 2VKQA 1Z35A 4PLZA 4MQ6A 2AVNA 3W2FA 5JYDA 3PPVA 1P17A 4B85A 2XPCA 3LPDA 1ACMA 1G291 4LUCA 3RAJA 4NULA 4F0JA 1XQYA 3G1WA 1NVVQ 4MO9A 2LIVA 2HK9A 3K8QA 2FWPA 3QBTA 1TMGE 4BQEA 4P58A 4KPUB 1O5OA 3ZGNA 1GLNA 4RBNA 3H9BA 4WBNF 3JVEA 1AKNA 2LDXA 5DOVA 5ITVA 2FMUA 4GXRA 4LVOA 3IJEB 1TM3E 1KNQA 3F3YA 3UHOA 5CFPA 4UDXX 3W8DA 4NBWA 5K45A 2C7PA 1SCDA 1AZTA 3KFXA 3EFOB 4MVJP 1ZJYA 3ZQ6A 8ABPA 1CS0A 1L8LA 3HJGA 1WW2A 4F4CA 2FR8A 1QYXA 1UJCA 2G83A 2QZZA 2YJ4A 3QVWA 5GONA 3OBIA 4A3SA 1AKEA 1K6IA 3IPCA 4RACA 4DDHA 2I62A 1J8FA 3IFSA 1DHTA 1BHQ1 3EGVA 3PJGA 3D7LA 5TQVA 2Z57A 1RQGA 2V7WA 4LXYA 2PGJA 4OJNA 2XQIA 3SLKA 2WTMA 1PR5A 3N8DA 3IR6A 3IP7A 4X94A 3RJ5A 1N5RA 4G1FA 3TECE 4XIYA 2DBQA 4B4UA 2BPOA 4P3XA 4DOMA 3SPUA 1F6DA 2EATA 3DTNA 3ZWCA 1PBTA 1FMCA 2XZOA 3HMKA 1QR6A 1D5WA 3FSGD 3RVMA 3V4ZA 4G5GA 2DSNA 4GSKA 3S5JA 1M2XA 5HH5A 2MJLA 1VFNA 4UOZA 4LYAA 4F6RB 5C53B 1AV7A 4ER7A 1C8VB 4LRTB 2VTBA 3IBYA 1J5PA 3CF6R 3H97A 1VJCA 4R1NA 5KSPA 1B1AA 2F00A 3QELA 4P5EA 5CNKA 1ZKMA 2GN8A 4FBGA 4V0MA 3OX1A 4C7MA 4G5HA 1D2EA 1L7PA 1ABFA 4P7KA 4S12A 1YONA 3HZZA 4FXPA 3FFXA 3A4IA 3LGSA 3TH5A 4Y98A 5FUBA 3TLJA 4HR7A 3RG2A 5KILA 4PWZA 1P0PA 1W581 1IY8A 2YWGA 1TM7E 2VOEA 3ES9A 4O08A 3AB8A 5AM1A 4EY4A 1W0CA 1CRWG 3R0IA 1UBFA 2JNWA 4WKPA 1H2BA 1GQRA 1TM1E 1I9CA 4QU8A 1W36C 3DLCA 3H5WA 1M5RA 4NJMB 2EZTA 1LX6A 1RLIA 2B7BA 2Q8QA 3SS9X 4DSZA 4L8GA 5L6MB 3RADC 3WL5A 1WZIA 1KJ8A 1UBOS 2NTVA 3JRWA 2VSFA 4Z99A 1ZU5A 5ERXA 2JFGA 4DR3B 1NDUA 3LC7O 1KVSA 1CDOA 1CZKA 1XXHB 3ISVA 2FZ5A 4CU5A 2NIPA 2F8MA 4D4KA 1OI2A 1WCWA 4LTNA 2CCJA 2OBLA 2UZ1B 3IODA 2FM6A 5HMMA 2YHEA 3LIIA 2DLDA 2ZJBA 4NQZA 4PVDA 4WH0A 5EWJA 4XUCA 5L7WA 1RWXA 1G8PA 2DHDA 2GRJA 3DD1A 2Q0JA 1JJVA 1G8KA 3RUIA 5FFMA 2PZGA 5D86A 2PSEA 3MFQA 1XZGA 3L84A 3LKZA 2PXXA 3M1LA 4C0KA 1UC5B 3F67A 4K6MA 3RC9A 5JRDS 1J21A 1K08A 2QD2A 3OPQA 4IQ0A 3DMYA 5AXOA 1ZJZA 3WNDA 5FHQA 1JHRA 4V38A 2HLDA 5EN4A 1X7HA 5DSXA 5DI3B 3CRZA 3FDZB 2GAAA 3RGGA 3AR7A 3RV4A 4W6QA 1FP7A 4AMYA 3J81k 2PUBA 4ZARA 1GPNA 1ZXXA 2BISA 2CBXA 2XBMA 2J3EA 1MO5A 1ZOPA 4N18A 1QHXA 5K3BA 4U1RA 5TJ9A 1C7JA 1K4MA 4LRXA 2VSQA 1E4YA 1MC8A 3U4GA 3IMFA 2V6MA 4DLPA 4MI3A 4QTTB 2B3TA 2OQRA 3Q7RA 1GLVA 5E7IA 1CQPA 4ZV7A 3HY4A 2XD9A 1EBBA 1U0RA 2BFBA 3QFTA 3SQNA 3GZ4A 4MWGA 3DAYA 1CR6A 3Q12A 4DILA 1O6BA 4U3JB 4YUXA 1LBEA 4UCXA 4F3NA 5ES4B 1UJBA 3TQOA 1YDWA 4YUZA 1NUTA 2HMYB 5KNLA 1HKUA 2HIMA 3ET4A 4UUOA 2VJMA 1UKYA 5DYIA 5AW4A 3LPCA 2PKXA 2AUTA 2ZJFA 4KPEC 2JDID 4MSUA 1UP6A 2RGAA 2C7GA 4DQDA 1G66A 1GUYA 1IAQA 2E4AA 3C14C 2GMNA 1UXIA 1ZIPA 4XLTA 4PC3A 4WEQA 2OTCA 2Y8AA 2JKVA 5CPFA 1PQPA 3PEYA 3JARA 2NUTB 4BRSA 4DM4A 2ZYRA 1GA4A 2OFWA 1DBPA 3E18A 3K4PA 1KJZA 3RSQA 5FWXB 4O98A 2WPNA 5LSCA 1EDZA 3O6VA 5JJBA 3H0KA 3I2KA 3CEJA 5FQAA 3I9V1 1RLTA 2V6BA 3E2MA 4P31A 4YRTA 1XM8A 1YXMA 2IIVA 3TPZA 3N8IA 1V9SA 4IIFA 4MV1A 1FU4A 2O4CA 3WK6A 3OVMA 3MTGA 3QLVC 3AWDA 3VXKA 4YT2A 3ZEAA 1L7BA 2W2LD 2YFHA 5H80A 2XUJA 2FOLA 5K0CA 2VPPA 1CJSA 2COEA 3MIIA 4BNDB 3LL7A 2OM2A 1GEEA 3LT1A 1X7WB 3ND8A 3NAMA 1RIFA 5TF4A 5KI6A 2BGRA 4B7AA 1LXCA 2G07A 3DT8A 1HT0A 3FMFA 1TF2A 1YBVA 1VJTA 2DHCA 3IQEA 1Z6AA 1N0WA 3QG1A 4P0QB 1IJEA 3L77A 4YAGA 3D6JA 2J0QA 2D5LA 1UXKA 1Z2AA 2RDMA 4IH9A 3W0LB 4HRVA 4C07A 1PHPA 1A2QA 3UXMA 1YS7A 1COWA 3QF7A 3BXFA 3VZBA 5K8LA 3I5MA 4KACA 3FNRA 1TAQA 4CZ2A 1E3WB 2WP8J 4RA9A 3FE2A 3O2NA 2NQTA 3RODA 3DO6A 5D3KA 1GZVA 1QIEA 4UVGA 1NVDA 2G1AA 2WSLA 4RWEA 2AQ8A 3HJUA 5B64A 1CIJA 2NXNA 2GKLA 1NL3A 4XUKA 1DUIA 2J5QA 2AIRA 1Z38A 3IPRA 4WNYA 3P2EA 3D3WA 1H2WA 4FE4A 1LEHA 2ZRDA 5J5VA 5KNCD 2G9ZA 3TKYA 3TNJA 1WIWA 2FLVA 3R9XB 1RQ2A 3FNIA 3OLVA 1OC2A 4GBJA 2GO7A 4QPJC 2V7EA 3GLUA 5AW3A 3GLIA 2JLZA 4KW7A 4PAQA 1H1DA 2FMTA 2PJRA 1P72A 4RY9A 4E2FA 4KEQA 4Y18A 2QX9A 1Z6PA 3IKVA 4XSVA 3PDCA 3STXA 3VA7A 1BMQA 3HH8A 3E0XA 4RTNA 3K9FC 4J2OA 1L4FA 1NW5A 1ZMBA 2RG1A 3K94A 3L7BA 5B12A 3PYXA 1IBCA 3HL0A 1SHJA 1XF9A 5KWEA 2QYHA 4GBGA 2ST1A 2XCOA 5CR9A 1IXKA 4FHEA 5JV5A 4QYTA 5LXTF 2CXTA 3A4VA 2GTPA 4LSZA 2R65A 4B83A 4WJLA 1NVVR 2XBLA 3WYNA 1B8PA 3C6ZA 4BVHA 4YPOA 2OYRA 1M2GA 4IHJF 4AWZA 3DEJA 3EZ6A 4UMVA 7ADHA 3ZNBA 5ACTA 1P29A 2V7TA 4RV9A 1ODIA 1WCV1 1Q1AA 3DZFA 4P3KA 3OX2A 4JQZA 5DWQA 3OZWA 1V8ZA 5DM0A 2LDBA 2ZUBA 2Q0IA 2UUCB 1CZRA 1KJ9A 2GEJA 1W6RA 3JTEA 4ZOEA 3B2NA 2JD1A 3KYCB 3K6SB 4TQGA 4OQ4A 4JITA 4AMBA 1T8PA 5EPUA 5EKUA 1NVKA 2ODEA 5KTTA 4CXMA 2I22A 3ASZA 1WLYA 4RELA 2RGNA 1NMQA 1GCOA 4QAQA 2R9VA 3FJ1A 1ZH4A 1FUKA 3WMWA 2B7LA 1MX3A 2OB2A 5EOVA 2Z5FA 1E5LA 4D9NA 4ZIRA 5B2FA 2WWWA 1DLIA 3JPYA 4RSGA 5BQFA 1WEHA 4GGPA 3MGBA 3EDQA 4GGMX 1WZCA 1UXHA 3GVIA 4Q7KA 3CRW1 4CUKA 4BEWA 3EASA 2NVOA 3OEHA 4F5YA 2VWQA 4LYYA 4KKXB 3EBOA 4QNRA 3LS2A 2RGXA 2D4HA 3P26A 3RHZA 4QGSA 5BNZA 1RADA 3BWCA 3FYDA 4PQRA 4Y6QA 4PR3A 3EGDA 5KTNA 1WOYA 2Q2WA 5JE8A 1KDTA 1TEHA 2NUAA 4CM4B 2XYQA 3H1EA 1A9OA 3N2KA 2X41A 1D6MA 4FBMA 2Q5FA 1Z8DA 4JLNA 4EABA 1VCNA 3VDMA 4KVGA 2AMVA 3MT0A 4X63A 5ESDA 2DKNA 3GAZA 4KN6A 4TYWA 1CNMA 1WHTA 3G5MA 2EX0A 3UHPA 1JNYA 3A1TA 3K9NA 1YD7A 2D00A 3EW9A 4L5AA 1Y98A 3LIPA 3T3EA 3GDWA 3GXBA 1I5EA 4JUBA 4ND1A 3LF2A 2PZ8A 1O95A 2DCUA 2OC4A 3S1AB 2WUEA 2CKMA 3GJ7A 2E5FA 4MV7A 3SOPA 4YA6A 2EDAA 3X2ZA 2AFIB 3O03A 3A1CA 1QAQA 1AHNA 4HGRA 1R6AA 3H2JA 4CR8A 1G2PA 3ZYZA 1DE0A 4B6QA 2Q21A 3OPNA 2IXFA 1N7GA 1GPMA 5FTNA 3STYA 1WF3A 5EGSA 4YXWD 2N0SA 1HQDA 3I8XA 1T5OA 3BXOA 2P69A 2YZNA 3EC7A 1SXJC 1XTJA 1BXGB 1Z22A 4RJKA 4GM4A 2YIDA 4FONA 4A15A 2BFDB 3E03A 4N1AA 3RLIA 4CLOA 2QSJA 3GRVA 4KTTE 1E98A 4MWEA 1O96B 4RNDB 5AICA 5ICMA 2ORYA 2BSAA 3IH5A 3BGSA 4EY2A 4I8DA 3HB0A 3H05A 3GJYA 1LBIA 3T12A 3WE7A 4TZFA 3TXXA 3B1JA 2X9VA 3VI3B 4CLDA 2WD8A 2C2XA 1K06A 2Y1OA 4OBXA 1BO6A 2WRZA 2O3QA 4L95C 4P0TA 1KIMA 2BSQA 2GEDA 3PV0A 3K4QA 1NW8A 4EA6A 3BMNB 2BMWA 4C7KA 1M1YE 1BS1A 2D7JA 3N9IA 1P5ZB 2AXQA 2H4ZA 3FROA 3PUVA 1FLVA 1FTSA 1I36A 1CUXA 3NIFB 2VHUA 1IPFA 1G8FA 4PGGA 2BEVA 4KFUA 3WOHA 3FHCB 1Y1SA 4AP9A 1EWRA 1XX6A 1HMYA 2NW6A 2QROA 2NUPA 3I12A 2RG7A 3G2NA 5DRTA 4HKTA 1D2CA 1XRSB 5G1PA 1AC5A 3RFUA 2H7CA 3GUUA 1HNNA 5DN6D 2NO6A 3WHIA 1XNQB 4JJAA 1YR2A 2IVZA 2DFTA 4WXEA 3TR6A 5IAOA 1CIPA 1GU1A 2VJCA 4AX4A 1H85A 1NX6A 3AU8A 2O8BA 3HO8A 4F86A 1I3KA 5BV1A 1W73A 1GGEA 5LB4A 4KQ2A 4PBSA 1IVNA 1Z2EA 1FVXA 1JLRA 1NZFA 5A7HA 3SICE 4OI0A 2GCPA 1WUJS 4RFVA 1NC1A 5DPXA 1FX0A 2H63A 4CQLB 3FOBA 2WIDA 2POCA 3PR2B 4FR5A 3JWJA 5ALOA 4KRFA 2P9FA 4HQ0A 3I6QA 4LXIA 4X5OA 1E6MA 5G4KA 3PPIA 4R69A 2XT6A 2I7VA 2ZT7A 4RQBA 5CVUA 1WXDA 2ANBA 1N3LA 2PUWA 2W9XA 3SM3A 4BFYA 3ZVKA 4MZDA 2D1TA 2GF2A 1M2NA 4HQFA 1XJWA 3PX7A 5ETJA 1YE5A 1OCEA 4YPFA 2PWYA 2OSBA 3IUNA 1DQNA 3LYLA 2WEKA 3R41A 2H7XA 1MFZA 4UEKA 1APBA 1GPYA 1T0UA 2EF1A 4RSMA 3EZFA 4ZVNA 1CBUA 2C9MA 2V4ZA 1Q1GA 2I76A 3FW1A 3VYRB 4CFSA 2RD2A 1QTRA 2FHPA 1V1MA 3GEMA 3UMRA 5JHHB 1E3SA 1LLUA 1T9DA 2IPNA 3HYNA 4TT3D 3BJZA 1TCAA 1A69A 3OUUA 1HDIA 1OPRA 4CL2A 2H9AA 4AROA 1JU3A 1WCIA 2EZ9A 3QPUA 3TTUA 1Q20A 3DTVD 1QV9A 1SC1A 4YLEA 2ODAA 2R1TB 3DB2A 3HYLA 3GRAA 3MB8A 4WCFC 1JGTA 1X74A 1S6YA 4ZXPA 3QM1A 16PKA 1DO0A 2QDKA 1CQJB 4LRUA 1P1JA 1QYRA 2GAJA 2PWAA 4PS1A 1HTWA 3WB1A 5E7QA 3CLVA 5D7BA 1GG5A 3NCHA 4JSYA 1QH9A 4Q1BA 2Z9BA 3UHFA 3BXEA 3FR8A 3RUFA 3YASA 5IBCA 3ER8A 1KAOA 2Q1YA 4E11A 3AM3A 4TTPA 4QBHA 2X19A 1DBWA 2XVZA 1DUSA 3GUVA 3L40A 4TM7A 3U3OA 2H9IA 1THZA 1FFBA 1M2OA 4RHUA 3ACCA 3SC2B 1JTEA 3U26A 5EXEA 2JLCA 3B52X 1GNPA 1CT9A 3WWYA 1XVLA 3QSGA 3N07A 3DYVA 4B8YA 4AYWA 4BVAA 4DDMA 4MWOA 3AEXA 1H0SA 4LJYA 3H3EA 2DULA 4MLZA 2W6OA 6LDHA 9LDTA 3A6JA 5F5XA 1UQUA 4IGEA 4M22A 2P4ZA 1BYIA 2FPWA 5TVKA 4GVPA 3GUZA 4PS0A 1M3SA 1J70A 2HCTA 1ZD4A 4IIGA 4BO7A 5TLSA 2GBIA 2HYDA 3VTKA 1OX5A 5A0VA 3JYLA 1X9IA 1R8XA 5AI6A 4C1DA 4X3PA 2DEUA 4W5NA 4MAAA 4FLFA 3UHJA 2GEVA 4A8PA 5AI4A 3DR3A 5JVDB 4Q9KA 4ZYTA 4BZ3A 2G8NA 4CPDA 1JZSA 2HREA 1L4HA 3KZNA 3RUPA 3RQIA 4FP9A 4C2TA 4OQLA 1QXSA 1JR2A 2R7KA 4FNAA 1E9SA 4YMSA 1YA8A 1ZJ5A 5FPTA 2FX2A 2V7QA 2CXXA 5B2ZA 4EGAA 3IVMA 5KNDA 3FSRA 4OMUA 2ZB2A 4CFZA 2PZFA 4IUBS 3I5AA 2YNTB 4BLOA 5GM2A 4KXYA 3UT0A 4FZJA 4FSXA 5BVHB 1DLJA 1Z6ZA 1QOQB 3RYCB 1B3RA 5ISMA 2CLKB 3UQZA 4DV0B 4BL5A 2VUIB 4G4GA 3VPAA 5M04A 1C7QA 4OMCA 5AJWA 3NQ41 4NXMB 3PEUA 3NP7A 4Y2TA 3DZ8A 2N46A 4AFNA 3N2NA 5BNFA 3RWBA 1H8ED 4J0GA 4XGRA 1LGYA 2PJZA 2WDZA 1C0KA 3U7JA 4UWRB 4R2WA 2AUMA 3PF9A 1I2AA 4J1SA 1PEYA 3I45A 4B44A 2YVKA 1HT1E 2WJPA 3FB1A 4YB8A 1ATIA 1C7IA 4F21A 1DAFA 1V48A 2PFGA 3DFUA 3N53A 5JSHA 5IQKA 1Y6RA 2I2BA 3C85A 2XYVA 4DJFC 1WUYA 4RHXA 1JKJB 4NIMA 4PZ0A 4X1IA 4BMCA 2IH5A 2V0CA 3OZRA 3AERA 3PHHA 4G63A 2ZRAA 1IBRA 3O8RA 1E20A 2GCOA 2WZDA 2LV8A 2A88A 4IDFA 1QZTA 2FEXA 1DEXA 1GKLA 1R2QA 2PBFA 3HWWA 2WP0A 4GBMA 2JGAA 3QITA 2NN3C 1Z0JA 2E89A 5KSYA 2HJSA 3ACBA 3M5CA 5B7QA 1OKKD 1UK8A 4YRCA 4PHGA 2W6JD 1E6KA 2JLAA 5EKDA 5T6MA 1XI2A 3ETNA 3FDJA 3PU6A 4A0SA 4B0PA 1JEEA 4KQWA 4DQUA 3O7MA 4ZAVA 5FORA 3FFWA 5C8DA 3D6FA 1U63A 3CEMA 3D3QA 3O47A 4OU5A 4JL6A 1U2GA 2PEZA 3ROXA 2PH5A 2WQZA 5C4MA 4HNAB 4YAWA 4KPYA 3AFNA 3HDJA 4OI1A 1G7RA 4M0DA 3W3ZB 4BP1A 1DRJA 1KNXA 2AC4A 2D0IA 1XZDA 3ILSA 1N2CA 3JQ6A 4CMEC 3D2AA 3LL4A 1IOWA 5HCNA 4EOGA 1HT3A 1OAKA 1ZCAA 4I2NA 3DE7X 4BV2A 3OQOA 4L5YA 3W5VA 5C1PA 1PGNA 3DGFC 2PGLA 5BQOA 3A58B 3O8NA 1VJGA 2FMKA 1U9IA 4Y2UA 1AHHA 2VP4A 1EHIA 5LDHA 2G0AA 1WUHS 3I9V6 3B2EA 3K92A 1P39A 5LSAA 3JATA 5EXDA 2ZIVB 4P4UA 5JSZB 1C4KA 2GK3A 4P1ZA 4AIRA 4L8LA 1JE0A 1P7CA 3NOXA 5KINB 1ISPA 2CVZA 3U9LA 3AI2A 2HHCA 1W5AA 3BHJA 3S40A 2WHXA 2E82A 2B2CA 2QX8A 1N4AA 4LKOA 4CF5A 3ABOB 3OURA 2V97A 3ZE7A 3H5IA 4KV7A 3IR5A 1OTXA 2O2XA 2ZT8A 4FTWA 1YJAA 3HCAA 4QRDA 4E15A 4RPCA 4WIAA 3BWDD 1URPA 5FLKA 1KO4A 2YJTD 5LZ9A 3Q2OA 4RIIA 3HBLA 5BYJA 5FOXA 2VPWA 1TQ2A 2QX4A 3LHDA 1UBEA 5ALYA 3AZOA 1TO1E 4OKSA 1DNPA 1TA0A 1R15A 2HU2A 2REQA 1GFWA 1MFPA 1SIBE 1Y7LA 1WW3A 3AY6A 3BIXA 3MERA 1RWMA 1UF9A 2XGOA 2C8KA 1ULBA 4UZEA 5E2AA 4D0RA 4L15A 3NVDA 1JAHA 2C3UA 3H4IA 1W8IA 4FYVA 3D7NA 4HAWA 5KREA 1B00A 2H9YA 1GQQA 2A1IA 3DKVA 3F6PA 4GPTA 4Q39A 1PHRA 1RBYA 3JYOA 3UANA 4EL0A 4MKIA 4RTRA 4MWSA 1RRKA 1KAGA 2VI5A 1G8JA 5B7PA 3LTNC 1ADYA 2IPAB 1JPNA 2ZRIA 2IW1A 2VK4A 3B9RA 4IDGA 5DHSA 1JEJA 1ZJ6A 2VK2A 3S29A 3NVAA 1O94D 1F8XA 4WFQA 1KMNA 4Y6LA 2EZ4A 4YK7A 3OWOA 4FYWA 2P1EA 221PA 5LZ2A 1SBNE 4UBNA 3KQSA 3GFTA 4MUMA 3WIUA 1PGPA 1OYVA 4MPTA 2R8EA 3SGLA 4EY3A 3ZWNA 1B16A 4MICA 1JDBC 1AS0A 5EXPA 4NCIA 2ZKLA 5FUXA 3H1GA 5EE5B 3SBEA 1ECFA 3TF5A 2VF2A 1IULA 1YBAA 4F2DA 1H5NA 5K2MA 4Z5YA 2D5BA 3TVDA 4CQNA 1EFPB 1JQ3A 4PPYA 3KSUA 1KEKA 3ESXA 5LOVA 3PR1A 4CTOA 3CVVA 1W5TA 4QOEA 3TPFA 3TQSA 2B8WA 3MMSA 1UJ4A 4D3ZA 2C1ZA 4H3SA 5E9AA 4RXTA 1X7XA 4MMYB 1PK9A 1ENPA 1BQ4A 1LRKA 2C4VA 2EHDA 1UAAA 3FWZA 1N6HA 3EMKA 1KP3A 1MJGA 2IHJA 3DF7A 1OA0A 2ZZKA 4OL0A 3RTCA 3P32A 2R5FA 3KAPA 4HSGA 4YQEA 4BAUA 4C0XA 4BX9A 4DVJA 5DK6A 1CV2A 3D4BA 5K8VA 5BOVA 4EI7A 4LDZA 4P80A 3K70C 2WF7A 2NO0A 4JIMA 5E95A 1IATA 1E9EA 3BMCA 4O25A 3FFBA 4M76B 4TMWA 1BCRB 2WWIA 5CK4A 2IBTA 4XCXA 2I6UA 1A04A 1DARA 1YS4A 4PZAA 3WRXA 2YCBA 1QH0A 2WM9B 3AHIA 1KHHA 3EXIA 1NBHA 1R3UA 3AJRA 4UAVA 3GEPA 3QNMA 4FUTA 3KXDA 4K2AA 4BWYA 4XD7D 2J0UA 3PQCA 2GCUA 1XLWA 3UGQA 3V46A 1L1QA 4W63A 2PT5A 2YVLA 1UH5A 1UODA 1PUXA 1W9HA 1I3LA 2GI4A 3E7FA 2MSCB 3OP1A 4K9QA 2QL9A 5JAOA 5CTAA 4QC2A 5A9SA 3F73A 1A5AB 3GFFA 4EI8A 5FBWB 2IYXA 2AIOA 1E2QA 5ALMA 2W37A 4E32A 5EH9A 3IUEA 1YO6A 1SWVA 1TX4B 3G88A 3O1IC 4YJFB 5DGIA 4Z1MA 3AEYA 4C7OA 1Z4MA 2IY7A 5E4TA 2JGDA 4LZZA 3WGGA 3B36A 3ACDA 2V55B 5CCDA 2DPMA 2V5AA 4CTJA 4TLEA 5HMLA 3DMHA 4TVKA 1BW9B 1NVTA 4JJFA 4DIOA 7ABPA 5IK2A 4W1PA 2R7LA 2UAGA 3I8OA 5HEKA 3KYBA 1A88A 3G5UA 1NQWA 3M33A 3DV0A 2X1VA 4HTAA 4MKZA 4G0PA 1IQ0A 4RVUA 2P9CA 3SDBA 3T9CA 1S2OA 3AKYA 3OX3A 4ZZ1A 4I4TA 4QFBA 5DGTA 5T8KA 3INTA 1MC1A 4CYMA 4F4UA 3U4QA 1OWMA 3ZQ4A 5JI2E 4OYRA 1ZD8A 2CV0A 5C3UA 3WLHA 5JALA 1NUQA 4WTOA 1M10A 3BDIA 2J6CA 1CE8A 2W2KB 2QJTA 1SM4A 2VT3A 2P9ZA 1ODJA 4HT3B 4RULA 3HDTA 4N9WA 2EHJA 3ETGA 3H4TA 1ZGAA 2BKVA 3RVOA 3IQWA 4PPNA 4ARVA 4BNVA 2ZDGA 4CNBA 2ZPUA 4TTTS 5HJ5A 1OX6A 3ZE2B 2W11A 1C4OA 4M3NA 5C8ZA 2I9PA 2J9FA 2JCGA 2R47A 1Z47A 3H04A 2CDBA 1HETA 3LFHA 1AKVA 1E1CB 2D13A 3VJRA 4AWXA 1P0QA 4S2EA 4Z9XA 4Q4CA 1J8QA 4JHXA 2ZRFA 4M1OA 5D51S 2WKRA 1KDYA 1LFAA 1CFZA 4EMSA 2PCJA 4Y2YA 2WM8A 1T29A 1F06A 3W5BA 1DKUA 1VHLA 3E2IA 1GZUA 4OOFA 4TYPA 5E6UB 1KVRA 4DLUA 4JX8A 1GL6A 4E5PA 1BVRA 4QEKA 4NONA 3R6WA 2B1RA 2IYEA 2PX5A 2ZBDA 3LDUA 4BWVA 4E2YA 2PSSA 3OF2A 5FBRB 3CVUA 4DLBA 3G5TA 4TTSA 3DC7A 4IVRA 4K6HA 4JBLA 2ECFA 1UOQA 3HN7A 4YRGA 2P6OA 2BTQA 3DDWA 1DCFA 4S1PA 2R8PA 3L7JA 1G3RA 2IJGX 2J48A 1E92A 1NUAA 3NHSA 4JS0A 5JXHA 5KYKA 1F2TA 4ENQA 3L7IA 2CZCA 5FAKA 4P86A 3W6UA 4F9GA 1JFTA 1XVIA 2WJHA 2WFZA 4H3KB 3U7RA 1OUMA 1O6CA 1M8PA 2JPDA 3QEMA 1YMQA 1EG7A 2GBLA 3L05A 4QDXA 4QRHA 5LP6B 2CVHA 3M6AA 1O9BA 5SYMA 2X13A 5TPWA 2I65A 4Y9DA 1RFLA 3UFBA 3VGPA 3WDMA 4WN3A 3NDJA 3F3KA 2WT9A 2AR9A 3ZK8A 1VL1A 3E35A 3OCUA 3F6CA 3UK7A 3PXEA 1L8OA 4F96A 4FEAA 1RBMA 3IP8A 5C51B 2GYWA 5CTJA 5JROA 1P2VA 5FUMA 5AJYA 5H0IA 2PMBA 2R8YA 4KOAA 2W0SA 3B12A 3OO1A 1E96A 4JKOA 3OF5A 5AW1A 4QYIB 4M8NE 1I80A 2PLNA 3B1WA 4LW8A 3VBEA 4QJ3A 3UBTA 1NP6A 3GFPA 3ZDXB 1B41A 2FWAA 2D0PB 3ZIAA 1KOLA 3T3IA 4K9MA 3ZOKA 4UM9B 3DJYA 4AN4A 4K9DA 2XJ4A 3Q7QA 2CF6A 1NVWQ 2IUEA 5IDXA 3AVTA 1D4ZA 3R5JA 2Q0HA 2FF7A 4GW3A 4OY3A 4QGFA 1ESNA 1QNLA 1HI9A 3L6CA 3OG9A 2BC9A 4MVJE 1NNI1 5LWHA 3IOEA 4EKGA 3WLLA 3VR4H 4QBIA 4C4PA 4WESB 4MQEB 4W1RA 5EWLA 1WUOA 5JXJA 1C41A 4RTPA 3W8RA 1XTVA 4D8WA 2A35A 4UE3S 4HDSB 4F4DA 2P4UA 5AVQA 1ONOA 1E66A 2F8LA 4OGLA 5B1SA 4BKMA 3NX4A 3H2SA 4B4WA 5HZMA 1IBKB 5BP7A 1BA2A 1CVRA 1JE1A 2G0NA 3B9PA 3QVKA 5DDIP 5DT9A 1H9CA 4TZ0A 1QOPB 1U4OA 1XEFA 2QDSA 2P68A 2WYIA 3PIDA 1WAMA 3BGDA 5IDQA 4IUDS 4QQFA 4XARA 3JQCA 2HLNA 5EQJB 3DLBA 5EUCA 2QJSA 4K6FA 1FJHA 1JPJA 2ZTUA 3QWBA 4XW2A 4ZQEA 4B6EA 3FF1A 3V80A 1PL6A 1G21E 4E33A 1NVAA 3AFGA 4AZTA 5ACWA 4AI6A 3U31A 2J3MA 5TMBA 5GIOE 4X0EA 2F1HA 2GN9A 1NZJA 5KYYA 1DI0A 2FA9A 3OM9A 5JY1A 4GZ5A 1P9NA 1SCJA 4FU0A 2EZUA 3SQMA 5A5ZA 1AB5A 1KY5A 5BO5A 1DTWB 4QKQA 1EJ6A 5G4LA 3GPDG 2C77A 3AR3A 3ANXA 3DHWC 1IM2A 5EJ2A 4MW7A 4CG2A 2LNDA 4TROA 2XGSA 5EIFA 3T3GA 4G0XA 1CUGA 1DAHA 4LE6A 1PI3A 2W4IA 5FPHA 1GZDA 3CLSD 2H4WA 2WTEA 3C3WA 3C6KA 1HYGA 3CLUD 3KUXA 3EEOA 2QE6A 3PY6A 1XNHA 1P2SA 1WXXA 1JEYB 3IOFA 3TOXA 4JB2A 2I3BA 4PO8A 4KQXA 1Q74A 1QNFA 1PT6A 3BCUA 5LQSA 4KAFA 2RJNA 4EPTA 1ZNYA 2QIOA 1FYEA 3E9EA 3BE5A 3I2YX 3C1OA 3GVCA 4MVJM 2HQBA 1AQUA 1BTOA 1PFYA 3TLGA 1LDMA 1YQGA 2P5SA 3OAAA 3AM1A 1CYEA 4N3AA 3AESB 2FGJA 2ORIA 4FFBB 5EFOA 3DE0X 2PKQP 4G89A 3BK2A 4RK6A 1EWYA 3QPVA 3TJRA 2MINA 3ORHA 1E3MA 4LWPA 1LJUA 3LH5A 3OZSA 2SCUB 5DB4A 4FOOA 5C80A 2IU6A 3H6HA 4P84A 2JA2A 2JZOA 4I1SA 1CY1A 1DG3A 3D59A 4PLHA 4R8SA 4RE5A 1B42A 1KZ9A 5LQCA 4KYIB 1OGJA 3O92A 3ZU5A 5KNBA 3D3KA 4O4LB 5CLGA 4Q7MB 2ES4A 3CS3A 2ERCA 3DV2A 1O8BA 1LNQA 1PJCA 4NCHA 4C4OA 1I2BA 1BJTA 3E4CA 5AVKA 1R0BA 4YRDA 3OE4A 5C31A 1DOAA 2V4MA 2ZYGA 1XKTA 2LCFA 1OGYA 1EHYA 4C88A 1IAVA 3MRSA 4IOMA 4ZT2A 2J31A 3VUEA 2B2NA 3H6KA 4O4IB 5AM2A 3UTCA 3IUYA 1A2OA 5TEWA 4CR6A 1T4MA 3KQNA 4AMZA 4CIVA 2QGFA 1GPWB 4CBVA 3TPCA 3SQOA 2J6HA 2DCMA 4EWLA 1ECPA 2HX1A 4E09A 1LSOA 3NO4A 3DEIA 3B6ZA 4ED9A 3TO5A 3SXUB 4A92A 3GT0A 5LLSA 4IHKA 4R8KA 2ON6A 4REQA 1OLSB 2PZBA 5AKKA 1M34E 1RNLA 1TGYA 1Z6GA 3TN7A 3KQTA 3ZLTA 3HXKA 5D3QA 3GEGA 5COAA 1IY0A 4R1TA 4BIMA 3HMQA 1NKSA 1WHSB 1AGYA 4MYHA 2GB4A 5HK8A 3UK2A 5LMZA 2N3ZA 1K5PA 3HGTA 4KLNA 3O4FA 3UJPA 3MS2A 1H2YA 3I09A 3KBBA 4TKLA 5FJJA 3GLHB 4EG1A 3U9TA 4P8RA 1ZEMA 3PFHA 5K0BA 3F9OA 1SVLA 3G6WA 4UJ5A 4TL6A 1EK0A 4NDAA 1U5BB 5DM4A 2XXBA 4LSGA 4D99A 1PJ8A 1SQGA 2HV8A 1CUZA 2R1ZA 4C1CA 3EBPA 1O97D 1ECJA 4DJEC 3NTVA 4U2KA 4C4RA 4LGMA 3MQ4A 4ND5A 4KN9S 2H29A 1QRRA 2ZJOA 3DEAA 1K8YB 1SCKA 4N7BA 3UM9A 1NE7A 2OORA 3INGA 3M34A 2HRBA 4QG3A 2I4MA 5K7SA 3Q9UA 4YMIA 1YC5A 4NU0A 2Z6QA 1RAGA 4K40A 3HU5A 4B2IA 4CM7A 5CXQA 4PC6A 2VZ0A 3K1TA 3NYIA 3QMWA 3DTTA 5CT5A 1R0WA 3RLFA 4G0VA 2PUTA 3PCRB 2YN4A 1U04A 4AICA 2QHXA 1FDSA 3VFDA 4RTQA 5ACUA 2F64A 2UKDA 4IG4A 4WZAA 2Y27A 3D2BA 4HN9A 4BKOA 3QMVA 3PQ7A 4DUGD 3PS9A 2BE7A 3AHFA 4GFDA 4BVJA 1RBQA 3KVVA 3BVPA 2ZU0C 2C5GA 1I4DD 4KXXA 1G3IA 1S3SA 2QRVA 2ZBEA 1D07A 1QGZA 1J1ZA 3GBSA 1WA5A 3G9TA 2ECKA 1PVVA 4IS3A 2ZRBA 1I24A 1Y89A 2FR8C 1JHYA 1A2KC 1L5FA 1Z8FA 1A5BB 3K35A 5HK9A 3WX0A 3EHEA 2FPSA 3AU9A 2PUAA 1KBOA 4K86A 4NK4A 5CG2A 3SIPA 5B4VA 3U4MA 5B55A 3ZDBA 5IM5A 3T1VA 2LZ0A 2N47A 1YDGA 4C22A 5CEEA 2Q42A 4I5IA 1MNQA 3OCJA 2XZPA 3GD7A 4KPUA 3V7WA 4QO7A 3C6YA 1XTBA 1KOJA 5YASA 1G20B 3NRBA 1V43A 4RAQA 3VDRA 3DHCA 5BV7A 3GLTA 4LWOA 2IYVA 1KK1A 1WG8A 4H1HA 1FQJA 1NY5A 1W0JD 3RSHA 2Z2ZA 3EFOA 4LIPD 3H8JA 2IYQA 4A8HA 5BWMA 1O08A 2ZAOA 3QP9A 4LOIA 3T0IA 3WICA 2JK1A 3CTPA 2HPAA 4S1VA 3ZS8A 3KT0A 1QYVA 2I3DA 5U4QA 1X87A 2XQVA 4KQCA 2A1TR 5HJ7A 2PPLA 3IX7A 4G86A 4KZKA 4WBNB 3CLTC 3FOWA 5LQJA 3DAPA 3MJDA 1IZ7A 3ABRB 3NGMA 3BC1A 3WMFA 4F11A 3RD5A 3EVAA 5ITZB 5LP1A 2DR0A 2R6JA 4Z4IA 4Q01A 1JJTA 5K3DA 4CKZA 3A9TA 1RHKA 2P8JA 4M36A 5EE1A 3GROA 2PS1A 2Z56A 4KXVA 4WA7A 4RO0A 3L0PA 1H2AS 1M6HA 4F6RA 2CJPA 2HHLA 3VDQA 3GJ0A 3L8MA 4F9EA 4AYTA 4R2LA 1Q84A 2R8XA 2R66A 4Q4AB 4F04A 3BIFA 5K3FB 4L9SA 1OQAA 3BFPA 4RMJA 2V7VA 4R2HA 1PL0A 1E69A 2NPIA 1SKAA 4UQLA 2KJQA 1FTQA 2D2VA 4RK4A 4ZO7A 3REQB 3LA6A 1CUHA 1MR3F 5B6PA 1KJIA 4BGIA 1YRBA 1CFJA 4BFWA 4XM1A 3F2VA 4I4CA 1P45A 3PD7A 4LG1A 1SBYA 2ZETA 4UE2A 3Q5DA 1P1FA 3TQFA 2JIDA 3WFJA 3QE3A 2WA1A 2OV2A 1GKUB 1XV5A 1L4LA 2HDOA 3BK1A 4MCIA 4ML3A 2IZZA 4URWR 2QY9A 3I28A 4Y1EA 1DAEA 3E2PA 3PDHA 3JQQA 1YFKA 1Y7PA 3WLNA 3PGXA 2W6NA 3WWPA 1MRZA 1Q7RA 1C4WA 1Z9BA 1QCCA 4MV9A 4X1KB 3VH2A 4MS1B 1WB9A 1VJ0A 4MXDA 5BT9A 3A05A 3ZY5A 2GRAA 3ME5A 3M82A 4NCKA 4ZDWA 4JLWA 5JCZA 5SY6A 3ESHA 3BWMA 4TSRA 3PXBA 3R23A 4MLCA 1VJNA 3HVRA 3RQSA 3NBYC 2G7MC 5DHQA 2BAGA 4DKJA 3TGPA 1ZLXA 4R5MA 3Q85A 5F78A 2V5VA 4HH0A 3OTQA 2XGGA 5TQ2B 4IF6A 5BORA 2Y71A 3E5NA 3FGPA 1V8PA 3D4NA 2I2AA 3F96A 4HYYA 3G0IA 2J9GA 5EERA 5KJEA 1BQEA 1ODFA 2OV6A 3LY7A 1LWOA 4RHFA 1HYBA 2I6SA 3CUYA 3VPBA 2VDKB 3K5HA 3K5PA 5J23A 3JU3A 4M9QA 5SYAA 3C3EA 3OA2A 2I1QA 4RKEA 3CR7A 5D6OA 3N59A 4KMSA 1JIIA 3ORFA 4GYYA 3ZR4B 2HB6A 2OGUA 1N5DA 1JQ5A 3EEQA 3B7GA 2IS6A 1ONPA 2OSVA 3I58A 3LDGA 3P9YA 5DI3A 4RPHA 3FDZA 4NTZA 1IBLB 4MHTA 4UBJA 4X7MA 2B37A 2HT1A 1SQFA 3AJAA 4X90A 2FN7A 1FMFA 3GO4A 4BP8A 5BOSB 5EJIA 4BECA 2E7YA 1KEUA 1KI6B 1ZUIA 2FR1A 3H5OA 3PG4A 3OPMA 3LT2A 3DMTA 3B13B 3FNEA 4DCPA 3C39A 2YWBA 1WCYA 4IRXA 1B0ZA 1XRQA 2AF4C 5DBHX 4DBLC 4PG7A 1W8DA 2YTZA 3HFGA 2ODQA 3DL2A 1UOPA 1U0FA 2PMFA 3MWJA 4MKRA 3COSA 1FRNA 4B71A 3IHTA 5IX8A 4RMNA 1YQQA 1GTG1 2WIKA 3GA5A 3P45A 4LCBA 4U3JA 1ESMA 4FKMA 3C3JA 4I1VA 1K7SN 2AFVA 1TECE 3NEPX 4R7TA 1SIWA 5BR4A 3IRVA 1Z15A 1PFUA 2FMXA 1NLFA 1Q2XA 3T3HA 2J7PA 5LYYA 1NG1A 2BELA 3CN9A 1QGDA 1H66A 1L7EA 1YJCA 4C08A 3PFIA 4NPCA 4PBRA 2FOIA 2HADA 3IEUA 4QTXA 3C3AA 5AI8A 4C4YA 5JWOA 5B6IA 4ROTA 5I5GA 4OYHA 4BMSA 1KP2A 2QD1A 2XH8A 5ENDA 3WXCA 1H6CA 1H3FA 3A6GA 3MGKA 1ZD5A 2NUTA 5EJ8A 3JWPA 1MVLA 3HXPA 2FX3A 1ADCA 5EXSA 5FWXA 3T5PA 3ZWFA 3HR7A 4AMUA 3NMUF 1KL7A 2JFNA 2CWDA 4FSDA 3RSSA 5JZMA 3DFZA 2JIZA 4ENWA 2VP3A 3H5RA 2PH3A 4L74A 1RDFA 4WQMA 5H68A 3ERCA 4L4XA 5FI1B 4D3YA 2B1IA 2F3TA 2H16A 2AMYA 4ITUA 3R5HA 1K2WA 2VDUE 3C3YA 4URFA 4EBBA 3WIOA 2XUKA 4FLEA 5BWNA 2A5DA 5C3MA 1MF7A 4BNDA 3N5CA 1X7WA 2GEKA 4XLLA 4IIJB 5DXAA 5FCDA 3PWZA 3O2JA 2OESA 2XF4A 4A0QA 4HQLA 1PSZA 2RKWA 4M0FA 2BFNA 3A9CA 3TLBA 3G8AA 4AURA 4ARAA 3P2JA 5BV2P 5KU7A 4AS1A 2HJ9A 2FH5B 1JECA 3DCNA 5HCIA 2JLVA 1CZUA 1GQ2A 2EEPA 3E61A 2IYRA 1BIFA 1N5LA 2YFKA 1QFZA 5L95A 2XOXA 2C9OA 2ZSHA 3CZAA 2JGJA 4IQGA 2PM8A 2WMYA 1E3WA 2IX3A 3F98A 2P41A 4M9SA 3O4RA 4FDTA 2C3YA 1VE7A 1D0VA 5TNXA 2PNJA 4TRRA 1E2MA 4FW8A 5IKPA 4JIGA 4OFXA 3D81A 4AKTA 2UUOA 3DDSA 4P98A 3C6BA 3IVCA 4E3ZA 3HVHA 4AN0A 1BN6A 5T4HA 3TZKA 3L4JA 3S6JA 2H4HA 1DQRA 2JC3A 2R6FA 3MCVA 4PIVA 5C34B 4Q05A 3R9XA 2EJCA 3NZEA 4UULA 4LJ4A 4C5CA 4D4GA 4E2WA 3GAFA 1A4XA 2O8CB 4RAOA 1V26A 2RGDA 4M9ZA 5HQTA 2ECPA 2C9BA 1GZ7A 3RRJA 1W94A 5K0WA 1U0JA 1FPMA 1IZZA 4AF8A 2WZBA 3R7BA 3QXXA 5JEEA 5HRAA 3PNVA 1HFJA 2BFAA 1WZEA 2YWRA 1II9A 1QX4A 2VYNA 1YAHA 1ZIOA 3H19A 4FEKA 1EAYA 1UEXC 1RKQA 3D8NA 4M1ZA 2QUZA 2ZJ1A 3G2JA 2IYOA 3T99A 1T5DX 3RVKA 1VSUA 2VPZA 4ADSG 3ZPXA 3WTBA 4EKIA 4HS9A 1ISGA 4M1TA 4OL9A 4JC8A 2QY6A 1YRYE 2O05A 3CW9A 4R0MA 2XOKA 1B74A 4WECA 5TB5A 1C1DA 3AFOA 1AQYA <