5A0VA

Catalysis and 5' end sensing by ribonuclease rnase j of the metallo- beta-lactamase family
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
454
structure length
454
Chain Sequence
b'SHPHPELGRPPALPKGGLRVTPLGGLGEIGRNMTVFEYGGRLLIVDCGVLFPEEEQPGIDLILPDFTSIRDRLDDIEGIVLTHGHEDHIGGVPFLLREKPDIPLIGSKLTLALIEAKLQEHRIRPYTLEVAEGHRERVGPFDCEFVAVNHSIPDALAVAIRTPAGMVVHTGDFKMDQLPLDGRLTDLHAFARLSEEGIDLLLADSTNAEVPGFVPPERDISNVLRQVFANARKRIIVASFASHVHRIQQILDAAHEYGRRVAFVGRSMVRNMGIARDLGYLKVPPGLVVDVKTLDDLPDSEVVLVCTGSQGEPMAALSRMANRDHQIRIVNGDTVILASSLIPGNENAVYRVINGLTRWGANVVHKGNAKVHVSGHASAGELLYFYNICRPKNLMPVHGEWRHLRANAELGALTGVPHDRIVIAEDGVVVDLVEGKAKITGKVQAGYVYVDGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE J
publication title Linkage of Catalysis and 5' End Recognition in Ribonuclease Rnase J
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Hydrolase/rna
total genus 149
structure length 454
sequence length 454
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 5a0vA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5a0vA01
1ZKPA 3ZQ4A 3FCZA 1QH3A 1VJNA 3SPUA 3F9OA 5AHOA 2FU9A 2WYLA 4TYFA 4EXYA 2GCUA 2BR6A 2GFJA 3ESHA 5B3RA 4D1VA 2NXAA 3X30A 1YCHA 1M2XA 4TZEA 5AEBA 4UWOB 5KILA 5ACTA 3MD7A 2ZNBA 1DDKA 3IELA 2YNVA 4H0DA 2WHGA 4XUKA 3X2ZA 4C1EA 2Y87A 5EVBA 4DIKA 5ACVA 4EYFA 4PVTA 1DXKA 5HH5A 4AX1B 3G1PA 2P97A 5AXRA 4Z5ZA 2P18A 2QDSA 4RL0A 5DPXA 1MQOA 2BFLA 4YSLA 5HISA 4EY2A 2Q0JA 2WYMC 5ACRA 1A8TA 2WRSA 4GYQA 4NQ2A 5HIQA 4CHLA 3Q6VA 4Z67A 1WUOA 3KNSA 3ADRA 4GYUA 2YNUA 3IEKA 5LLDA 5HH6A 4AWYB 4D1UA 1JJEA 5EW0A 2I7XA 3PY5A 4RL2A 2GFKA 4TZBA 5EH9A 4F6HA 2FU8A 4Z6XA 2QJSA 1KO3A 1WUPA 3SFPA 5ACSA 5EVKA 1KR3A 2OHJA 4Z60A 3T9MA 1BVTA 2Q42A 4PVOA 2GKLA 3TP9A 1BMCA 2BFZA 5B15A 1KO2A 1A7TA 1K07A 4RM5A 2NZFA 3SRXA 2BFKA 5HH4A 2P4ZA 4GCWA 4FEKA 3I0VA 2BG8B 1ZTCA 3IE0A 2AZ4A 5HIPA 3VQZA 3SBLA 3RKJA 1Y44A 4HKYA 2BTNA 3T3NA 5EWAA 4J5FA 4FR7A 4D1WA 1VMEA 2OHHA 5EVDA 5FQCA 4UBQA 4Z7RA 3IE1A 3DHBA 2YNTB 4EYBA 4EFZA 5FQBA 1P9EA 2M5DA 5EV8A 4UWSB 5LE1A 2YCBA 2FK6A 1JJTA 1X8IA 4EXSA 4TZFA 5ACQA 1WRAA 3KL7A 3KNRA 3PG4A 4RBSA 5IQKA 2DOOA 2BG8A 2AIOA 4ZO2A 2FHXB 2R2DA 5ACUA 4HL2A 3SD9A 1X8HA 3DHCA 2Q0IA 3P2UA 5B1UA 4BP0A 2P1EA 2Y8BA 2FU7A 5LCHA 5K4KA 3DH8A 4YSKA 2ZO4A 1YCGA 2DKFA 1ZNBA 3I14A 5AXOA 2WYMA 4UWPB 1SMLA 3I11A 1WW1A 4U4LA 2YNWA 1YCFA 2BG6A 2Y8AA 4UA4A 4NQ6A 4AD9A 2M5CA 4BZ3A 4C09A 4D02A 2ZWRA 4NQ5A 4V0HA 4C1HA 2Q9UA 3I15A 1E5DA 1DD6A 5ACPA 2NZEA 1JT1A 2E7YA 2CBNA 4HL1A 2H6AA 5K4MA 4AWZA 3BC2A 5A5ZA 5FQAA 4C1CA 4B87A 1HLKA 3LVZA 5K4NA 3S0ZA 5KIKA 3AJ3A 5LCAA 4F6ZA 2XR1A 2BG2A 4NQ4A 1VGNA 3IEMA 4TZ9A 5AHRA 2OHIA 4ZEJA 4YSBA 3BV6A 3BK2A 3VPEA 4EYLA 2YZ3A 3SW3A 2QEDA 4J5HA 2VW8A 4ZNBA 5LS3A 2A7MA 4P62A 3ZWFA 4AX0B 2FU6A 3X2XA 2BC2A 4D1TA 3RPCA 3AF6A 3DHAA 2HB9A 3A4YA 3IOFA 5ACXA 2BFZB 4DILA 4XWTA 4C1DA 5ACWA 3ZR9A 4KEQA 4WD6A 1QH5A 3IOGA 5A0TA 3L6NA 1BC2A 1XM8A 2NYPA 3FAIA 2QDTA 4RAMA 4UWRB 3R2UA 4TYTA 2BMIA 2QINA 2YNTA 3IDZA 2I7TA 2GMNA 3X2YA 2FM6A 3BK1A 3IE2A 4XWWA 5AYAA 2BIBA 4O98A 4UAMA 3PY6A 3WXCA 2BG7A 5EV6A 3QH8A 5EHTA 4KEPA 2YNVB 5HIOA 5LCFA 3I13A 1X8GA 5K0WA 5A0VA 3JXPA 3AF5A 4C1FA 1XTOA 3ZNBA 4FSBA 4C1GA 5A87A 5LM6A 4ZO3A 4RAWA 5LSCA 2XF4A 2UYXA 5LMCA 2I7VA 3RKKA 4Z5YA 3T3OA 4JO0A 1L9YA 2FHXA 3H3EA 4LE6A 2ZZIA 2BGAA
chains in the Genus database with same CATH superfamily
1BXGB 3SJCA 2WTBA 4E1VA 3P32A 2FZLA 1QF7A 1XVTA 2QTVB 3NUGA 2A0XA 3VR4H 4E5MA 5KMGB 4Y6QA 5TQ0A 4GKBA 5JAPA 4MS1B 5FI5A 3R7DA 3W4IA 2Z3WA 1E2PA 4H3KB 2GRUA 3O84A 4OBXA 1I3KA 2HIAA 1K9VF 1THMA 2PHZA 3G9UA 2E4UA 3KLMX 4MAFA 2FPOA 5ARBA 1YNSA 3RT1A 1VG0B 4JN6B 1OFHA 3HBFA 3JV7A 1OKKD 4HTAA 3TOSA 3FGPA 3CEHA 3WRXA 4LEIA 4X3CA 3UXHA 3CSDA 3MINB 4DNFA 1A96A 2YJ6A 4GMKA 1MEOA 3ESHA 2F3PA 2WAXA 1LBIA 3ZHSA 4QYIB 5HDBB 1AURA 3DYBA 2NXAA 4P38A 1LSUA 4IIGA 5EGNA 2NV0A 5CX1B 1TF5A 1RVV1 4KQFA 1Y6FA 2C54A 1F2TB 3CLTC 2QAJA 3QGMA 3U3JA 5G1PA 4YRZA 1QRTA 1CCWA 1HDEA 3HS3A 4Z54A 1V9CA 2AEMA 3A06A 4U02A 1E2FA 1KY2A 5IZCA 13PKA 2PSJA 4CCWA 1QYRA 2OV1A 2PWAA 3STUA 3KOYA 4LHVA 1FFDA 2ZJ7A 3LL7A 4XUKA 3F9RA 1H0RA 3WJ7A 1G5QA 3V7YA 1Q1EA 4M89A 4BC0A 1K5PA 4E70A 3D4BA 1BAPA 2HWXA 5EZYB 1L5YA 2EP8A 1MTOA 3DP9A 1GARA 3BSFA 2VG8A 1DLIA 4DIKA 4JYBA 1XTIA 1QIKA 1NRXA 2I2FA 3BE5A 3GD7A 3WADA 3ZU6A 3T6KA 5HH5A 1R5OA 4H60A 5EPEA 1XZLA 4AX1B 2V3VA 4XJSA 2QTGA 3PU6A 1YKGA 1J24A 1XF1A 2Y9MB 4S0ZA 4ZVLA 3QE4A 1NKTA 3UFXB 1GNQA 5JO0A 4O0MA 3MGKA 4HXFB 5DVZA 4QO8A 2A9PA 2R5WA 3JAWB 2QWXA 1QZUA 2CJWA 4P3XA 1ZC4A 2JZOA 3PIIA 1QO9A 2NOAA 4AS1A 5DPXA 4GVXA 5CCBA 5BVHA 1L5QA 2XUOA 2Q5FA 2OAP1 1JALA 2NPIA 3OAAA 2VDKB 1CT9A 2PLRA 3K9LA 1A1SA 3P9XA 1BXGA 3BL6A 5K45A 1KZHA 5L3ZA 4F6LA 5KMGA 2QTVA 2MHCA 3A6LA 4HYQA 3OSUA 3DULA 1GGJA 3P4UA 3G0HA 1J90A 3L3BA 1UBOS 4MS1A 1P3JA 2PNFA 1QP7A 4PE5B 1ZWKA 1B42A 3T1NA 1GGKA 1Z3CA 2GCGA 2ZVQX 4UVDA 4S1OA 1M6NA 1IMJA 1EQ2A 3F1KA 1DKUA 1TYDE 1XTTA 3TXYA 1ML3A 2B4AA 2XY4A 3HCDA 3H7AA 4QXMA 4DANA 2O3RA 3BRWA 2AI2A 4B43A 4NBNA 5ALYA 3RTAA 2GXSA 3B70A 3FG9A 3OC6A 3MINA 4PLWA 2IKQA 1SXIA 1MAWA 4Z0NA 5KHOC 3THXB 5SYMA 1XZPA 3K4QA 3SE7A 1KI1A 1XQ9A 2P79A 3KQWA 3UH1A 2QE7D 4QYIA 1FZQA 2B1QA 2WG2A 1SXGA 4EHJA 6AT1A 4NNOA 5HZGA 2IYSA 1NJSA 3H13A 4MB6A 3D6TB 5CX1A 3SVTA 3TGPA 2R1TB 1PV4A 2ODWA 5K0EA 4P81A 1BW9B 3KB6A 2JIQA 2VSFA 4PFSA 4DN6A 1XD2B 4OFWA 1I6LA 3PKZA 2OGSA 4JUCA 1ORIA 1NSTA 2KBEA 2PRKA 2EKLA 4BO8A 3GGCA 3PJGA 4YV2A 1CUIA 2INGX 5ESRA 2XCOA 1E7YA 1S9HA 4R98A 1E6KA 1BWQA 2C20A 4YFVA 4OO3A 3T1QA 4AKGA 2Q42A 3IP3A 1HL3A 4P32A 1E7WA 3SAJA 1V2HE 4HPJB 5BYJA 4NTZA 1UBHS 4TLAA 2JA1A 3RAGA 3SOZA 3W5JA 2PJRA 4NYIQ 2ZYWX 3UMFA 1K7FB 1M8PA 1MUUA 3B78A 4ZIRA 3R3UA 3QW2A 2GVDC 4PG6A 2J4DA 5A7HA 5CH3A 4KJXA 5KOYA 3S2GA 4O63O 4ARCA 1FY2A 3M5PA 4CG0A 2AOVA 2I4TA 3QLUC 3QW4B 3DFKA 4U2EA 3UFXA 1S8FA 1K6MA 3TTSA 1KYVA 3OQOA 1B23P 2Y99A 3JVUA 2V7UA 4JJIA 4K2AA 4RWEA 1DC7A 5ADHA 2Z6AA 1SVSA 3ZYCA 5AI4A 4KXXA 1QZXA 4HR7A 4E3WA 4WKOA 5KWEA 4DLKA 4CN9A 1C0PA 1D1SA 2E6KA 3FD8A 2HSDA 3FUXA 2XNCA 3BSWA 4ZPJA 1EFCA 4N54A 1ZUIA 3UENA 4RKYA 2VNJA 4JI0B 3RGWS 4FNOA 2BLLA 5CB4F 2O2SA 3PQCA 2B3TA 1Y80A 4NE7A 3V8NA 1FUEA 1WWKA 3O0TA 2P9EA 1MX1A 3DKIA 2Z4SA 4HS4A 1P18A 4S2UA 5KVQA 3RIGA 3ZE7A 3AJDA 4A6PA 2ZE8A 2VHEA 3LBHA 4YMVA 1EP1B 1QQTA 3SF0A 4PFQA 4YJKA 4P33A 1PIWA 3L4BC 3PGA1 4D1WA 4UHHA 3LBIA 2ORIA 2X1VA 1BVRA 1LH0A 4FBLA 5FQCA 1YQEA 2BGWA 5CMLA 1WCXA 1LC3A 3UG7A 3N53A 1EUZA 1Z4PX 3N5KA 4YIHA 3EDRA 1HKUA 3UJDA 5TARA 2DAPA 2DT5A 1EVKA 3LCVB 4U1RA 4EFZA 1Z2CA 1XXHA 3SYLA 1GTVA 3DOHA 3IBGA 2IHVA 2HMSA 1CUAA 2W2KA 4IXNA 4HMQA 5HF8A 1BW9A 3P26A 3ZZ1A 4D4KA 3GLIB 4JWTA 2IV7A 4CMKA 1GKYA 1UBCA 1V4VA 2FOIA 4BEBA 4DSZA 1SUEA 2LRHA 721PA 4KYIB 4TYPA 1YWGO 4KNWA 5IT9A 1XQ1A 2W90A 1GZ7A 3LRXA 3KR1A 4FFOA 1FXWF 3T9DA 4AJ4A 3DLIA 3MMPA 1Q84A 2J5KA 3PFKA 1HWYA 4YALA 1UBUS 3KX2A 1G41A 4BU0A 1IEWA 4ARIA 4CF7A 4C0XA 5AVJA 3PFNA 3HFJA 1NXQA 1YH3A 2DPXA 2E18A 1M5TA 3M3DA 5YASA 2I9KA 2QYTA 5JVDB 4ND6A 4D4HA 7YASA 4TYYA 2P5TB 1ISGA 4DJAA 1JXAA 3JASB 1NMEA 1TJ5A 1LVHA 3RK1A 3EMVA 3UN1A 4FYKA 4RJLA 2GEFA 4GDFA 2GEVA 4MRSA 3ZNOA 4HF7A 1FDIA 2YOFA 3C74A 3UEOA 1YONA 3TL6A 1VP9A 5FOXA 2F43A 1FP6A 1AK1A 2M1XA 3KKPA 4PGHA 5DEOA 3DHEA 3GK3A 4JX8A 2R7AA 1NVUQ 2JJQA 2QI9F 4NYMQ 3RHZA 5C3UA 3NYQA 5C5IA 4PG4A 1QIHA 3VAAA 1GUDA 4BQQA 3DT6A 2OAGA 3CKYA 2Q5HA 2VYQA 1SC9A 1WV0A 2CXHA 3E61A 4MW0A 3KC2A 4H18A 1I5OA 2I22A 2OSBA 1VPTA 5DHUA 5ER9A 3ZDQA 4C5CA 4MH0R 2ASVA 2A33A 5HWSA 1CZNA 3P2UA 4QDJA 4BWFB 2WKSA 3CRQA 1P4GA 4ZVTA 4UNSA 1E3QA 2Z9BA 1COZA 2ZCVA 3CPJB 1NNI1 1OYYA 2CNWD 3BA1A 6PFKA 3HDGA 4ZI2A 4YSKA 3T3PB 3ED1A 1RRMA 3S8YA 3G68A 4IH9A 1LFAA 3RRYA 3QHQA 2B61A 2PS3A 2XYQA 3KQQA 1X74A 2XLCA 2FW0A 1SUAA 3LY5A 3V7WA 3V4VB 3KJZA 4WBSA 1H69A 5GZ6A 3ZWQA 4XYBA 3ACBA 2RDMA 1E2IA 1Z0SA 1RHJA 2D3WA 1HZZC 4NEQA 2XZTA 1KU0A 4ZAXA 5IF3A 3UJ9A 2ZATA 4IUCS 1YI0A 3TOXA 1TLTA 5B1EA 1HPLA 2B0CA 2IHTA 3B6KA 3HCCA 1E2GA 3E58A 3IIKA 3DMRA 4M0MA 3RAEC 2NWQA 3AB3A 1PZNA 3QEKA 3ZE8A 4BZ3A 3UCEA 1R4AA 3K9BA 3BCHA 1V4BA 1WKVA 1J2YA 2P68A 1CUYA 1E3LA 2JLAA 3LT5A 4I8IA 3AVQA 3KTDA 4NV3A 4YPFA 2GM5A 4KO1S 3S2EA 1CUEA 4A8TA 4OOEA 3WK9A 3ERCA 1WVGA 3MOGA 3WLKX 1PJTA 2ZEJA 3TRDA 2LE0A 1NOJA 5JOQA 1A5BB 2IOFK 5JVDA 3HO6A 3H8SA 1A7UA 1SOVA 3HKDA 1SVLA 3O4GA 1OFUA 3PT5A 5FHQA 4I2NA 4C4TA 4JI3B 5JC1A 3LA6A 3M1IA 1Q17A 1AHIA 2YIDA 1WOMA 2GJSA 5EP2A 1PJRA 3RS5A 1YFLA 1QG6A 3OE7D 3E3LA 9MHTA 4C1CA 3OZBA 4F06A 3MC1A 2I6TA 2QNIA 1BJKA 4ZOEA 4B32A 3A32A 4HB2A 2V7GA 4DLYA 2OV4A 3DDZX 3IEIA 1R37A 2PZGA 1F2UA 3A10A 3WB2A 4EPYA 1E2KA 5D85A 5G1OA 2XGOA 3ISJA 4Q7EA 5IARA 3CJTA 2NUAB 3LHKA 5DGHA 4K5QA 5GOTA 1D1TA 4WY5A 2Z2IA 4ND4A 3T35A 1FNBA 1W85B 3TQSA 4J0CA 4JR2A 4IIXA 4EUHA 1SKQA 3ST7A 3NZEA 3ZG6A 3TW0A 1E3DA 2AJCA 3A2KA 3KVNA 3DMTC 2WWRA 2AG0A 2PS9A 2WMYA 2FN4A 3JQFC 4RF5A 4ASUD 1X1SA 5DDIP 4TPKA 5LZ4A 2WG0A 2ZKIA 5BWNA 5KJEA 1XCMA 3QIAA 4ECAA 3B5JA 4IY1A 4AN1A 4NYJR 3VPDA 3KP1A 2VCYA 2ICAA 1SBCA 3FBGA 3CJQA 5J2TF 3AM5A 4N6OA 1J8YF 4A82A 1MC5A 2QRKA 3E3MA 5IVKA 5FULA 4O4LB 3OJ0A 4QAQA 4FKBA 4RDHA 4C30A 3HDQA 1O4WA 1T5HX 3W05A 4QUGA 4IHQA 1E9BA 1FFEA 1XPUA 5JNUA 3PXUA 5H3HA 4X1IB 2NSLA 3U09A 3PKJA 2D5BA 3UAXA 3VX4A 3IKTA 1T15A 4KH1A 4EF6A 2CV1A 2C4VA 3MJHA 3H0EA 5H3LA 5LA6B 2FMHA 4H15A 2KM1A 4CM4B 2A7XA 3RRJA 2YJ5A 2J5QA 1MAAA 1GLGA 2QROA 4UM9B 1UWKA 1S3GA 1XHFA 2AG8A 4OM7A 4RVUA 3KXKA 1MFZA 1RAHA 4MUHA 4H59A 5E3JA 1S2LA 621PA 1E3MA 2VPXA 4D2IA 2A2ZA 4XB2A 3B3JA 3GRRA 2PXCA 5A06A 3Q7TA 4QICA 3AF6A 3QEAZ 4RLFA 5C1BA 2VNHA 1VPLA 3AH8A 4HRXA 1Q11A 1FMLA 4WNAB 3T0IA 1DRKA 4QE3A 4X91A 1WTAA 2OQ2A 1RWKA 4AMZA 2PMBA 4DRZA 5I3ZA 1ZSNA 3ER6A 4HEJA 4DC9A 3LE8A 3KE9A 2F3SA 4AYXA 2ZIAA 1YQQA 4ER3A 3H6GA 1KEVA 2Q1UA 4IS3A 4CE6A 1MDBA 3ZKAA 2FDRA 2Q3BA 5BSTA 5AOVA 4WD6A 1YQXA 3UC9A 4CT5A 1EI9A 2WTNA 1CUBA 2PX2A 1WW2A 1HNWB 4YJ2A 1DDGA 3WFIA 4F71A 3TDMA 1ZHFA 3OKPA 3DZIA 4Y6SA 4BGUA 3QKSB 4LHXA 4MKGA 2OOKA 1NVGA 2AR7A 3R3VA 1KH3A 1W85A 2B6NA 5E8JA 1Y8ZA 3H5IA 2L18A 4JA2A 3VVLA 3R2UA 2QJRA 1LQ2A 2PA0A 3EQ8A 1YGPA 2ZWMA 1E3IA 3MLBA 5K0CA 1PTKA 4TYTA 3CNOA 2DOKA 3JTMA 2X5OA 1OZFA 3DDUA 5E6RA 3R6LA 3I2IA 2BM0A 1LDEA 3KEFA 2KX7A 3P9KA 1KKLA 5KQLA 1XSEA 2F00A 2I71A 1NJ8A 2IPMA 2DR2A 3WLNA 3TDKA 2I7TA 4FNAA 1N2OA 1V3QE 3LYLA 1TLFA 1QIJA 2MR6A 2WHYA 5CA1B 1I32A 3EARA 3IE2A 2JHAA 2IELA 4QYWA 4G9EA 3PSAA 1O54A 2OLEA 2Z2ZA 1GRCA 2FKNA 1OHHA 2HWKA 4QBFA 3ZGVA 3DJYA 4Y8VA 5HEKA 4ZEWA 5HJEA 3ZDZB 3HRHA 3K71B 1FOEB 3UQYS 5GONF 2PXHA 4X1IA 1AVTA 1XZQA 4BVEA 2UYYA 5HIPA 4DA0A 1JTEA 3EVFA 2O1SA 1I14A 1Y7PA 3IMKA 4F2GA 2F3RA 3KXPA 3O9ZA 4IPTA 4QD3A 1GSOA 4IOKA 4HD8A 4YMTA 5K0WA 2QMZA 1SZCA 5FTKA 2CL0X 1QPGA 3JCZA 1RM0A 4C1GA 1FLDA 2W43A 4DLSA 3JWIA 2PTHA 4BQSA 2O8NA 2OMEA 1VG1A 2ZBDA 1MJFA 1O89A 1YHZA 2F59A 3N7TA 1FDOA 1KFJB 1X7YB 4HWOA 1PWXA 1S8OA 3FOWA 4Q24A 5DSZA 5JBQA 1DBIA 1QJCA 3DOFA 4L6IA 3BEOA 2XLBA 5F2OA 2A35A 5E2BA 3V4RA 4C3ZA 3LT4A 4FMCF 3QELB 1Y42X 3BXXA 3T3OA 1KHTA 4NOKA 4DLZA 1MD9A 4TYNA 2XWBF 3DOEA 3K2BA 4G5RA 5B3KA 1F7UA 3MIIA 1XJCA 4KB5A 4HH3C 3MRVA 4Q3KA 1PUJA 4Q7LA 1JR3E 1B4DA 1JLHA 3LP5A 4R3NA 5LB4A 4YT4A 3QEBZ 4ZYYA 3QVSA 5LL6P 3K9HA 4TV8F 5IUNC 1RFLA 1XLUA 3TI7A 3QKSA 4FXPA 4NR0A 2XD4A 5EP4A 1JU3A 2PRZA 1Z4OA 3I53A 5B7PA 3DZJA 1CU1A 3U7QB 5IJXA 3BORA 1E3TA 2UZ0A 1XEFA 4D8UA 3N0TA 5GIOE 2PCLA 3P9SA 3A14A 4XSGA 2AOUA 1WULS 2AFHB 3N8IA 1BIFA 4QDUA 1KJ9A 3GUZA 2I7CA 3S2ZA 5BURA 3HCPA 1KOGA 3F6CA 1DQSA 4A0SA 1U2TA 2HBRA 1IIBA 2DZDA 1AUPA 5DZSA 3WISA 4H1VA 3RV3A 1AKYA 1B1AA 1N6OA 3L40A 4P22A 1TUEA 3ANTA 4DJEC 3HBJA 1J22A 2PMWB 2P3LA 4HWTA 1G6OA 1L7RA 2WWWA 3RNOA 4F9GA 4FFPA 2PYDA 4J1QA 2QW8A 5F51A 5ER6A 2SNIE 2J85A 2V7QD 1RI5A 4G26A 4WGFA 4TWAA 1LPMA 2WWFA 1GADO 2ZETA 2AXPA 1MNAA 4F1KA 2AYXA 1IM2A 5EIWA 2IUUA 2YASA 3GVHA 5HCUA 4LYGA 4QOGA 3PUYA 3KWMA 4C1EA 4FCWA 3R0QA 3ETJA 2J3KA 4J16A 4RK7A 3WP0A 3LSTA 2DLNA 3PDHA 3OESA 4XUEA 3QUQA 2QTTA 5E2IA 1DEAA 2DQSA 4EYFA 1RAFA 2C8KA 5GZ1A 3PB3A 4LJAA 2WM3A 4Y0VA 3ZWNA 1CIJA 1RJDA 2F1KA 3GEGA 3KYJB 1WUJS 2TRSB 4WXYB 1TUBA 4QBGB 3EC1A 1AT1A 4HADA 3ZN2A 2UDPA 1KQPA 3SGLA 4ZREA 1N2SA 1U28C 3GA7A 4AG6A 1TQ8A 1S2IA 5EZYF 3AM4A 3QELA 3EXEA 4IDBA 1YL6A 1X38A 3ENNA 4MO2A 1NXWA 3SX0A 4NCBA 1NBWB 1KJZA 2VNKA 1DCFA 2JEZA 2VJKA 2WVHA 1YR1A 2C57A 4YQZA 4DMFA 3B1KA 2H7VA 4LJ4A 1CRWG 4N47A 3RAFC 4PSCA 1FJHA 1VJDA 1YUNA 4C08A 4QEDA 4HAOA 5ACRA 1F0KA 3O8RA 1D9XA 3BH0A 3H2GA 1ACLA 4HVAA 5FL7A 1GTSA 4TN5A 5F7XA 2WJ6A 4FCCA 1CFJA 1US8B 3VI4B 4OQXA 2PZAA 5I7AA 1KZ6A 4CLRB 3GDHA 2OQRA 2R8ZA 4BLWA 2PKXA 3U7QA 3VV3A 3O47A 1Z39A 3PEUA 4CM8A 3M5CA 1D2NA 4OQEA 1UAGA 1VCOA 4BMVA 3ELUA 4LXTA 4CODB 3T7AA 2CSXA 4FFVA 2R8RA 3R09A 1NLFA 4LBZA 1XTVA 3TECE 2PL3A 2C4MA 1ESNA 4GR5A 3EVTA 4CQLB 1ANKA 3T7IA 2FSGA 4MJ3A 4KC0A 4KWHA 1EU1A 1TTHA 3DAGA 4KE7A 4F6HA 2AX3A 4ISBA 2BF7A 2FU8A 3HXLA 3R5SA 1LBEA 5GVRA 4ALNA 3W8DA 1KO3A 1LBHA 4QTZA 3WIUA 3CB2A 3E3NA 4IXTA 1UQTA 2RI1A 1MU0A 1EPUA 1YMVA 4HQRA 1TMOA 1XRJA 3D0RA 4OMCA 5BQ3A 1EE2A 4U3JB 1TZKA 1QIGA 3KKKA 5I9BA 5L7YA 5TR9A 1VBKA 2GK6A 1OWMA 1DFGA 1ZH6A 1CFZA 3ZZUA 1Q1BA 4X94A 3T7RA 4UUPA 5IHXA 221PA 2BUCA 3DFFA 3OD5A 4YXWD 5K8IA 3Q9UA 2BISA 3UJBA 3KXLA 1N1MA 1OGJA 2ZM6B 2O19A 3QTLA 2AOWA 2EL7A 4R2KA 1ZGHA 2W0MA 4TSFD 3M8KA 1Y6JA 2G83A 2XKBA 1RTTA 1XZGA 1V39A 3M6MD 2YXEA 2Z8XA 4ER5A 6REQB 1NMYA 2D74A 1NM5C 1K1EA 1MORA 1LLQA 3OCWA 1Y4UA 4RHEA 4AQYB 4WERA 5IP5A 4ARZB 3DZKA 1MT0A 4JJGA 4OVKA 3U1VA 2ZZKA 1F8YA 4YHHB 2K2QB 1GM5A 1MOZA 1NA5A 2X3FA 4RX1A 4DDTA 2RAVA 1ZTCA 4RZQA 2P2GA 1OIVA 5DHQA 4GI1A 4G56A 2ZR9A 4D9FA 5ESXA 2H1SA 1R64A 1YZQA 4GP6A 4MVJG 1NLZA 4RCYA 3X2EA 4IVRA 4AK9A 2GLXA 3L0BA 3GGPA 2EZTA 4RY8A 3CLUC 5H81A 1DU4A 1US8A 4JXKA 4MGYR 2JGDA 3FROA 2WZCA 4WD3A 4A6DA 4F1JA 4PLHA 1NI3A 4UHBA 2XJ4A 3KSAC 4S1WA 1JHPA 1TGVA 1I8TA 1SVMA 3WL8A 1GAXA 4PLVA 5BN3B 4F9TA 1E9VA 3TPZA 5FFMA 3WGLA 1QYWA 2KQUA 2O1XA 1RBZA 1Q14A 2EZ4A 2PYIA 3B1ZA 1PW7A 1OV4A 3QNMA 5F5LA 1OB2A 2QX4A 1WSBA 3G2JA 2P5UA 3K9CA 1H65A 4CQLA 1RPAA 3OQMA 2G06A 2YZGA 5TEVA 1FZTA 2DKNA 3WLPA 3Q0EA 4A5OA 1N2CB 2O2CA 1JIJA 2OV2A 2GWHA 2XCQA 2ZWPA 3HBLA 3VPAA 3WNDA 2BLNA 1HO3A 4NP6A 4RSMA 1KAOA 3MTJA 2NXJA 4XX1A 1GJRA 3T3DA 2QQGA 2J33A 4RO0A 3U7JA 1AA6A 1YC2A 1LLCA 2P8SA 3A1NA 3KNZA 2IOHA 4G25A 4HQKA 4JASB 3D9QX 3EAQA 1UP6A 4NULA 2ZIZA 4TXMA 3BWDD 5JALA 2IZ5A 1G2QA 1W49A 2BZ1A 1H3NA 2CCKA 3CN7A 3KBBA 1DEOA 4I5IA 5LZ7A 5KYTA 2AHOA 3AHDA 1KQOA 4J4BA 4ND7A 2HZBA 4UBOA 4NJMB 3DZGA 3E5RA 1Z2PX 2QGFA 2PT5A 2XF2A 3RYFB 1FFXA 2FSVC 2R8BA 4RQAA 1ZI9A 5BW6B 4GEGA 2IQ5A 3SE0A 5LQMA 4OTZA 2W42A 1SZPA 4ZVVA 3EPKA 2H1CA 4N3CA 1Z37A 4D26A 2BR3A 4HZGA 5FWYB 3AKCA 2DTXA 2O9JA 3DAYA 4ARZA 4M1TA 3RVKA 4KN9S 4LGVA 4YQYA 3U3ZA 4DJTA 5JVDF 4LXUA 2D5AA 3T1HB 4ZO7A 2BW0A 3GXOA 4I46A 4ANFA 1KDRA 3L0SA 2BL4A 1S3FA 2E9SA 5JTTA 5P21A 1QTIA 1BCRA 1HOXA 4MW2A 5DBOA 5TX7A 5HJ5A 4TRRA 1GNTA 1Y63A 3SDBA 4MV5A 4CV3A 2C5FA 2FQWA 3PQ6A 1E5LA 4EVSA 2OLJA 1R0KA 2JGNA 3QU5A 2OXFA 4LJRA 5EKSA 1RKXA 2WJAA 3KUDA 5BN3A 5LQUA 3DHNA 2CLLB 4DSUA 1Z5PA 2C9ZA 3DV2A 5K20A 1EDBA 2C2ZA 2FOXA 3K0BA 3LF2A 3UT5B 2I6SA 3F6EX 4Y2TA 3SPUA 3ABIA 4ER6A 1OXSC 2LBPA 5FOVA 3KQPA 4M9XA 4WKNA 4MQ4A 3K1JA 2GTPA 2NQ2C 3T0FA 4B0OA 2N75A 3IP6A 1MZVA 2XTZA 1JNXX 3DKRA 4XOIA 4PPQA 3GBSA 1MJNA 3N05A 1OPRA 4S24A 1H5QA 2QD4A 2EHDA 2MTBA 3KPJA 1ISHA 4KIUA 4C0JA 2VHZA 4M8IA 1GUBA 3IEUA 1M5UA 5HKBA 1O6GA 1X9GA 5BOVA 2GH1A 3O8QB 2N47A 5LWHA 3CRNA 1R6DA 4F5DA 5IJ9B 3AYZB 4G89A 2CLHB 1BGVA 1X1EA 2QZSA 4HNQA 3RYTC 3ZCPA 1E92A 1Y7HA 1YBAA 4NJMA 3TEFA 4EECA 2FN8A 2W2LA 2P6UA 4DZTA 1P0MA 1B1CA 1YC5A 3RHSA 1F2DA 1FP7A 1AA9A 3HJUA 3QMVA 5T4EA 5TT1A 3RYFA 1JPNA 2X3UA 1PR6A 3OZXA 1QCCA 2H31A 3G5MA 4EI7A 4LDRA 5DT2A 2C4NA 1S2OA 5JV5A 3H42B 2P67A 4HQ0A 1JEJA 1QFZA 4PLTA 4FHZA 3TIXB 2CXPA 2IEZA 2QT9A 4X64B 2C95A 1IY0A 3EWIA 3U9SA 2NTVA 3CPHA 4NQZA 4C22A 2OORC 3OQ1A 2AI3A 4G81A 1QKKA 2BFBB 2FQQA 2HBQA 3J7TA 1Z25A 1QH1A 3BDIA 2XUZA 4G67A 1USIA 1WCIB 4LN1A 4PAMA 4POOA 1MN6A 2DQ4A 4ED9A 3QX3A 3L05A 4RL6A 3ROTA 4UM5A 2D7CA 4RWZA 1OZ0A 4M86A 4P1ZA 3WIOA 1UUFA 1UK6A 1T1GA 3DWFA 5B7QA 3GLHE 3QLUA 5LVAA 1JU9A 3IBCA 3OFKA 4CN8A 4OKIA 5JFTA 1Z0DA 2RC5A 2TMYA 2MINB 2BTOA 4FGUA 2H2GA 2W2VA 2DR0A 3KQUA 3HACA 3FDXA 1SOMA 2CNNA 4FWBA 3FPBA 1T3HA 2O3JA 4G1EB 4I9FA 1CRPA 2F1JA 3TYXA 5HUHA 3BH6A 4TV9B 5BRJA 1F4PA 4RTSA 1FP4A 1GLVA 2R6ZA 4LF6B 4TYMA 4EW2A 3ZIAA 1XJQA 4RV5A 1L6RA 3R74A 2IC5A 2ZYGA 3FHCB 1SFRA 3O8DA 1GAQA 1XNGA 4LXGA 1XZIA 3O4FA 1L7MA 1AUQA 1V43A 4PY2A 3RVPA 3S2YA 1PG2A 3C87A 2DQKA 2HU8A 1XCOA 1R8XA 2PPLA 4AO6A 1SD5A 1YT5A 3CV3A 3RFTA 3S2UA 4C0SA 1RZVA 2PL5A 3KOMA 4IOMA 3PT9A 2XEXA 3D8HA 3HO8A 1VKJA 3MS2A 4GNKA 2AF4C 4ZT7A 3U0BA 5KTOA 2PV7A 3FVWA 3O8QA 3ORFA 3L4BA 1U3UA 5IJ9A 4O4LF 4RUKA 2Y1FA 4GMXA 4I50A 3WFZA 3C3YA 4XGKA 4AYTA 1Z75A 3RCBA 3U0VA 4L15A 5HKKD 5TMPA 3BTVA 4ZAFA 1E2LA 1TFRA 3PENA 3ZY6A 3I83A 1SCDA 3C3BA 2PRIA 1CUVA 1ICIA 3QRWA 1VB3A 3E7WA 4MR9A 1CEXA 5T3YA 5LA6F 3RVBA 1KOFA 3MTDA 4COKA 4LQCA 4RIFA 2FE4A 5AI6A 3IP1A 2ORYA 2PUJA 4ZEMA 5JJCA 4EG3A 4G4SO 4IIDA 3NBYC 3TUJC 3LC7O 4KEQA 4AJNA 1KMHA 2CDNA 4UD6A 4YRPA 3JAKB 5AK0A 4AJLA 1A95A 3FFAA 1WCIA 4C2BA 3U60B 1ZA1A 4EA9A 5DNUA 1TVMA 4ML3A 1AGPA 5KSZA 1TKBA 2P90A 4B3DA 2G9ZA 3ZW8A 1ZUHA 4BP3A 3AJAA 1Z5VA 2I87A 3X2SA 1OX6A 1CULC 2PKQP 4WADA 3AHEA 1KJYA 1JLMA 2BMDA 1YXMA 3MD9A 2HWYA 4R9VA 4X1YA 4C6SA 2V3CC 1P7VA 3H5OA 1UJBA 4FUTA 3H3JA 1JQKA 5K3CA 1U3WA 2ODTX 1L7XA 3H16A 1KSFX 1JVBA 1HK7A 1YBMA 3BYZA 1II8A 3O4RA 3DD5A 3D7SA 2D4HA 4TV9A 3WJ1A 3IDZA 3NEPX 3D59A 2HDOA 3Q7RA 4NVRA 4XM0A 5AVXA 1RT9A 3RJ5A 2JLZA 1E7MA 1OH8A 2CLFB 3IQGX 3OCVA 3NATA 5ERGB 1OJLA 2TECE 2C2MA 4ENUA 2Z56A 3I3SR 4P36A 1TCAA 4GFDA 4INZA 5DCWA 1TYAE 4QEKA 1QB7A 2P6MA 4EGQA 1DXOA 1Y3DE 2BGTA 4R5MA 2VBCA 3IAXA 4JVOA 4B7XA 4PYJA 1WQ1R 4DIBA 5IDWA 5IH7A 1AZSC 1C3XA 1QHSA 1PL6A 5EV6A 3GGDA 5CA1F 2BGRA 4FLMA 3BICA 3R40A 4FTWA 3JYQA 3SMVA 1I5EA 1MGOA 1XCBA 1REQB 4N5DA 3S5JA 7REQA 4RKQA 3M2TA 2JAOA 4Y3UA 1GYPA 5I7SA 2J5RA 4N03A 5GGXA 1G6Q1 2CL7X 2FZ4A 3AHIA 4L8VA 5EFOA 1E5TA 2FW9A 3ZV7A 2FQXA 2W6JD 3RHFA 1NZJA 1COWD 1DC6A 1H93A 1HZZA 1NJFA 3HY6A 3E8MA 2A5FA 3QYFA 1BDHA 1A8QA 4RAWA 4LTMA 3DKVA 3PHLA 4H1UA 4S04A 1ZVKA 1KA9H 4W63A 3FCEA 3OCXA 1T3GA 3C8HA 2BHTA 4XWKA 2BJWA 1KJIA 5IABA 2VT6A 3D0OA 5JNTA 2I29A 2R6AA 2REXB 3M4NA 4G0PA 4JITA 1PYOA 1VECA 3DTYA 4MQLA 5E4JA 1G60A 4UTZA 3NPMA 2CNKA 4RADA 3ICEA 4LYYA 2TMKA 1E99A 2Z30A 4R6WA 3E3OA 1GGNA 1Q7EA 1UBEA 3JAKA 3R3WA 4BYMA 3TLCA 3D2AA 4WN9A 1AXGA 5ENZA 4BVHA 2ZT5A 1B8PA 1U0LA 5C0OE 4HAYA 4D79A 2I4OA 2NO4A 1KNXA 5AUOB 1N1DA 2N1MA 4YDSA 3FCZA 2X6TA 2Z6QA 3FOZA 4NNJA 5KNDD 1NR1A 1KDTA 3LDAA 4FE7A 1JZSA 2BC9A 4FCVA 2ZUWA 2Q5QA 2V7VA 3AU8A 4TTAA 5AW9A 2GCPA 3F5MA 3FLMA 4D6PA 3F9OA 4Q9DA 3KKEA 1FF9A 2MT9A 3GVPA 2Y0EA 3C3AA 3N1UA 8ATCA 1HDYA 4C2UA 4CMEC 2YV1A 4LXYA 1P19A 1E89A 1XCPA 3QPUA 4CQMB 1CE8A 2W6QA 5CJPA 4E09A 4A26A 2IFTA 1UEXC 3HYCA 4RFLA 1N7IA 4IZOA 5HK8A 1L1EA 4W5QA 3AU9A 4OI1A 4IH1A 4LY6A 2IYNA 3CF0A 1L2TA 4JT4A 5D5HA 3W5HA 4BVLA 4UUMA 1KVTA 1HYHA 3B7GA 1KZ7B 2V4UA 3BJZA 3WLEA 3V4PB 3ZBTA 1A1VA 2P1DA 2EGHA 4ZHQB 4EEZA 1VA5A 2GF2A 4M9UA 3TQFA 5AVKA 1WQ3A 1WA5A 2QJTA 4KKXB 1QP8A 4RJTA 3NEYA 5CFPA 1E98A 1S4MA 1CX9B 5FWXB 3R7LA 1S96A 4PC6A 4HOYA 4JKOA 3DMTA 1BEZA 3O1HB 4BP9A 2K4MA 2OP0A 1ZRSA 2PRYA 4L85A 3JQFA 4UXIA 4FSDA 2LPMA 3ETEA 1TEVA 1REQA 3EULA 4R9RA 1SUDA 1ZMRA 4PANA 4MYSA 3L4JA 5F7JA 3I9JA 2APJA 3WE7A 1L4MA 2PQ0A 4YQFA 1RXVA 2WDZA 1XDSA 3QXCA 4D8VA 4ZK6A 3WLSA 1GZ4A 1LFDB 2DULA 3G2LA 1RC8A 4EX7A 2PS0A 3DS8A 2JA2A 3H87A 4CL0A 1R0YA 1P5FA 1OLUA 3C3EA 3SQWA 2C8LA 4N76A 4S1VA 2R62A 4JJ8A 5BNWA 4IVQA 2Z6VA 1NQAO 5TJ9A 1Z0JA 2VWHA 2D1TA 1VLLA 1HR0B 1C0LA 4JCOA 3FTCA 4GQAA 5EJFA 5JS2A 4Z5ZA 3COPA 3TB6A 2B35A 4H7IA 2Q41A 4DPLA 1Z6PA 1GN8A 2QDSA 1YACA 1HE3A 1EFDN 1WDLA 4WK0B 3REFA 1UKBA 3WWDA 2R65A 4KPFC 1QLWA 2YXDA 1AN9A 3FNQA 3PQFA 4Z7JA 1KEEA 4BNZA 4OBBA 4DSTA 5K8VA 4G8BA 5LBUA 3Q12A 3EFEA 2UYQA 3IAUA 5TF0A 3HHPA 1PJAA 2JAQA 5JW6A 3G5TA 1U0RA 1E2UA 1C2TA 4TS9A 2HRRA 1WL8A 3UGKA 1JEAA 3BWMA 1TA0A 4KBFA 3GFSA 1QWSA 5D6NA 2IHJA 3L1IA 4DR2B 3CH5A 1AM4D 1N7GA 5CHEA 1W88A 3VH2A 4DCPA 1GYQA 1U5AA 1Q1GA 1VSUA 4AO8A 4DCVA 1I3CA 4S12A 3DOOA 1HUQA 1YR2A 3WSWA 4CQMA 2ZE6A 5AVSA 4Y0AA 1IRIA 1WLYA 1B0PA 4HUQA 1NWHA 3VZCA 4DW8A 2G28A 4JAVC 2CFRA 3MOSA 4D1UA 1W59A 1WPRA 3PY5A 1Z47A 5EW0A 4Z3KA 3ZHCA 4LJ7A 4KHZA 2GFKA 4MVYA 3TZKA 5EJEA 1YHYA 3CSSA 1H8ED 1BROA 1H1TA 4KFTA 3MCWA 4WDRA 4XSHA 3QFSA 1NONA 1G291 4E2WA 4FZ3A 2IOYA 5LZ8A 4X9XA 4C3UA 1GSHA 1WEHA 1WB5A 2ALJA 2QT0A 3G02A 3PUIA 5FWXA 2JFUA 3WBFA 1YR9A 2I6QA 1WHSB 2DB3A 4FYHA 3I2GA 5I9MA 2JKZA 1JQ5A 1UPFA 1PLLA 2W93A 3MQFA 1XVAA 3T9MA 5BMOA 1UK7A 3FYHA 1SA0B 2C0QA 4Y2RA 3VAZA 3UG6A 3E22A 2DPYA 2M6SA 3KOXA 3L2OB 3QJYA 4L07A 4PCLA 5A5FA 3P0JA 2OQVA 5BSVA 2ZANA 1GO2A 1LDMA 3ZY4A 5IK2A 3KB2A 1TM1E 5JHGB 3AB8A 3ANLA 5E3HA 1XXLA 5HUQA 4DXAA 2HW8A 3K0HA 4IEEA 3KSZO 1GR0A 2YVQA 5F3RA 5KKCA 1TZJA 2WYUA 3D64A 1X8JA 1HEIA 3KB8A 4NMMA 3COYA 1CLUA 3TRHA 3DD1A 2BHRA 3DOIA 4RF2A 4YAFA 1CUFA 4NCKA 3A9CA 4C6HA 3OCZA 3NM5A 4MKHA 1KAMA 4Z3OA 1H5UA 4UMDA 3RVMA 1KEPA 1SCQA 1C3VA 2NVWA 1YIDA 2JD1A 2HHLA 2VPQA 1C4OA 3I37X 3IKMB 4HN4B 5ED0A 3N9IA 1MO4A 2A0YA 2E4YA 2ZRCA 1JMYA 1OCEA 1EFLA 3IA2A 1OB5A 2OESA 3GRZA 2JJYA 1ISMA 4HSGA 5AO9A 2G9UA 3JY6A 2NT4A 1RWWA 1YR8A 3M70A 1ZL2A 1PNQA 4KGDA 1ZH2A 5A2GA 1NW4A 4BMXA 3C6XA 4D80A 4U9HS 4E3ZA 1RYHA 1GGMA 3BCRA 4L75A 5THQA 3T8YA 5K03A 1TFUA 1G1AA 3EZ6A 4GOKA 1ICEA 5COQA 1IY2A 4HNUA 1WY5A 4LX0A 2FEWB 2O0KA 5EWAA 5J5VA 2CHQA 2IU4A 1TF2A 1EX1A 5ESDA 1FW8A 3KYDB 4QU0A 1HYBA 1F06A 1Y6RA 3COSA 3NI2A 4BV9A 2ZULA 2PQ6A 2WMDA 2ZUBA 3O4HA 3CH4B 4RC9A 2PUFA 4L9SA 5HQ3A 2CLKB 4B7ZA 2QRJA 4X1OA 1ODLA 1T0HB 3Q9SA 4GH5A 1ULHA 2YNTB 1YDWA 4KLRA 1W4CA 1W6RA 2I3GA 4IGFA 3FPJA 4X24A 5KYWA 2WV7A 2IYUA 4GZ5A 2X2PA 3DVLA 6YASA 4MX8A 2C8JA 4BKPA 1AS0A 2GN1A 2FEMA 4R9UC 3UB2A 5LYJB 1VC2A 5DH9A 2AV6A 2E4AA 2PEZA 3CZ9A 1ZJ5A 4IQ4A 2R4UA 2PMCA 3O8OB 2IXAA 1HDIA 3WLHA 5C7LO 5CVJA 3TNYA 1U7DA 3DVQX 4QJIA 2GAJA 2YY6A 5EIFA 1FDVA 5JR3A 4W9NC 4MWDA 1XN1A 4H7EA 2PU7A 1HNZB 1W93A 4MCHA 3RC9A 4KXNA 4CXMA 4PNPA 1XTUA 1N8TA 1YB1A 1MC1A 2HMYB 3OQVA 2P9GA 2DFDA 3ESYA 4BO9A 3OKFA 1L5VA 1O9BA 1VE5A 2FK7A 2JJ8A 1C81A 3GPIA 5IYZF 3W3AA 5LN1A 4I9UA 1YZVA 5LQDA 1OC4A 3ZE9A 3PICA 1RYZA 5SYNA 3X44A 1R6TA 4P08A 2YJTD 3A2NA 4OQPA 3FTDA 3PQ3A 5IQKA 3Q8KA 3PXAA 4EYEA 2P69A 5CXSA 3LC0A 2XB4A 4OUDB 1NMQA 1QIMA 1S01A 1YZLA 2VK8A 4G5FA 4I5FA 3W2HA 5JJKA 1AMUA 2PM8A 2FPMA 3LPNA 5K51A 1ID1A 3JQ9C 3GROA 1NUUA 1OOEA 2E5FA 2R7LA 2YYYA 3MBIA 3MWGA 3QA3E 2ID9A 4JUIA 4O1HA 4BKUA 4CCYB 1I1NA 5ACUA 3D3WB 4F12A 2ZIVB 4HL2A 1KBQA 4MDYA 4D3SA 1MHTA 1DXHA 1KXZA 1XFDA 1YJAA 2ZU6A 4RLQA 1DP4A 2PSSA 4XZ3A 3VSAA 3W34A 2WNHA 1ETUA 3H9UA 2PZMA 4LWZA 1IYZA 1U28A 1D0IA 2QLTA 4PYNA 2NU9B 5IASA 2FZKA 1GD1O 1CZOA 2X0RA 3A7EA 4B5LA 2RK3A 3KYDA 5DCYA 4O8ZA 5DEIA 2D2XA 2FFHA 2OE2A 4B33A 4R51A 3TZCA 1NFFA 3HFGA 5LBIA 2JC3A 1EUCB 3CO5A 2DFVA 4IG4A 2RH8A 4H3HB 3TQIA 2G77B 5KEIA 1IJKA 3QZUA 4OMUA 1MG5A 2EJUA 4RPGA 3RJTA 4ZD6A 5FBKA 1PJCA 4CF5A 3W6ZA 1OD6A 1P1RA 3DZ8A 1FSPA 1DC4A 2JFQA 4PCAA 4UDNA 4B4DA 4EZEA 4RAQA 2JLCA 2WVAA 2ZSBA 4B81A 1PAUA 4PPGA 4XXHA 2HCJB 2IYZA 4JZYA 5LYJA 3M5DA 5BSUA 3V4OA 2DPHA 2HNKA 1GSAA 1HE1C 1HMYA 2ZB4A 2R87A 3JQEA 4R8RA 1DQRA 3SYKA 4C14A 2G71A 3OZSA 4C4ZA 1M34B 5C34B 3RRMA 5LQRA 2NSYA 1X39A 3T5DA 4CR8A 4F3CA 3DUFB 2ZZNA 4F72A 4V39A 3I34X 1Z34A 5FTMA 1D2RA 2QUBA 2VHYA 1XTSA 5CIYA 1LD3A 1V16A 2IYAA 4OSOA 1VI2A 3VYUB 3WIVA 1GCOA 4BTEA 4NEHB 4NU6A 4Z1OA 3TW8B 2ZRQA 4O4IB 1AQ6A 3H1PA 5ALPA 3WGTA 2DH5A 1XDWA 4RQUA 2B1GA 5FI3A 3ILVA 3MB5A 5BQOA 3ROEA 1AKUA 4LF4B 2G5TA 2HV8A 3EZ9A 4DLAA 2Z4TA 5BSRA 4DZRA 3RVSA 4I3GA 3LU1A 4R16A 1RZ3A 4HRYA 1QVRA 2BM1A 1XELA 3MTBA 1PS0A 2WMOB 3AHHA 5FLYA 3LIPA 4HN9A 1CS4C 1M66A 4OUDA 1TUIA 5E1MA 4B44A 3S29A 2FSUA 5G4KB 2I1VB 1G4UR 4B87A 1V3UA 2EFCB 1P7YA 4HB4A 2B4RO 1YHNA 5JU6A 4OCZA 3QFCA 2SECE 2I2WA 3D3WA 1UMCB 2QUIA 3RIEA 1NI5A 4O4HA 3CC8A 2V98A 1G20E 3S4YA 1K86A 3DC2A 3L9WA 2GKGA 1JBQA 2OZVA 4JR1A 3CZQA 1RKQA 1QGYA 1W9HA 4OHZA 1QE5A 3RABA 4DAOA 4Y6RA 1NM5A 3RFXA 4TS1A 5MFPA 16PKA 1FFGA 2NU9A 5A62A 4RY2A 1NDQA 4ZZ2A 3PQ5A 3RS4A 2XCTB 1VHJA 2X8JB 5CM8B 5A05A 3V34A 1HTTA 1A2KC 1EUCA 2QRMA 2YFKA 3R3HA 4X92A 2FRXA 4HNAA 3SM9A 4ETIA 3IXMA 4NZMA 4PWYA 4OQMA 3C6QA 3P71T 1KOLA 1JAZA 1AKVA 4HQ6A 1ADJA 4M87A 3KCNA 4B7AA 3DE4X 3GAFA 2CB9A 1RXSA 2Q7XA 2ZJZA 5ALMA 5B3AA 4BKOA 4E4TA 3NORA 3NEAA 4M76B 4G85A 2R1ZA 3WGUA 3D6VA 5B1IA 3YASA 2AYYA 3R4VA 3B8HA 3LK7A 4JB0A 4TV9F 4HFNA 2DSNA 2CVOA 3THSA 1NN5A 1NPYA 2JFZA 2ID4A 1I36A 2XTMA 3OEHD 4FYIA 5D01A 4EYLA 1JW9B 3HBMA 1TU0A 1H6CA 1Y7LA 1Z35A 2XVMA 1YJ5A 1BJRE 5AKIA 5FNZA 3CRZA 5LS3A 2O05A 3DAFA 3VR3D 2H29A 4JBLA 4P62A 2R6HA 2NZVG 1RHKA 3V1YA 3SZLA 2AWNA 4FJ1A 4JXJA 1PR4A 4RVDA 3TW8A 4H0CA 3EYWA 4O4IA 2G1AA 5L4NA 1WDKA 4MQFB 3QFTA 5ALDA 1Z16A 3KEGA 3CSUA 1AD2A 2EFHB 4E2YA 1FRFS 1Q3KA 1Z0IA 3DE2X 1OBCA 3LX8A 1HG0A 3NBAA 5LNK1 5C32A 3HXMA 4AY2A 3ED5A 2AR0A 4ND8B 4R71A 4UC0A 1YQGA 3W2GA 1H2FA 4W4TA 4KVAA 3KPVA 1K8ZB 1UZNA 4TXLA 4WFQA 1AMOA 3NDIA 4D5GA 4P92A 3GY0A 2XAUA 3ZIDA 2RHTA 4EITA 4Z2YA 5G4KA 2LKCA 4FILA 4CTMA 10MHA 4DR6B 3UJPA 2HHJA 3H05A 2HNBA 3NHRA 4H6XA 4LDPA 3IRUA 1VGQA 2H7CA 1NR7A 1OILA 1L7EA 3QKRA 4AXHA 2FSVA 3DWEX 3L8DA 2QDTA 5J5CA 4UWRB 4F97A 5H4HA 3T3GA 4X7MA 5IN5A 2RGAA 2NPFA 2ILVA 4YEDA 4QQRA 1FMFA 4N8EA 4EO4A 3CUKA 3MS7A 4MGEA 5ITSA 1BEEA 1Z5WA 3HDYA 2HIMA 2A0WA 1WRBA 1ZITA 2Q6IA 4GU5A 3LXMA 5IC5A 1JXQA 2FN7A 2OHVA 4CRWB 3KBOA 4B74A 1ZRMA 2X8JA 4GOXA 2WP8J 3E48A 3QUTA 4J07A 4YMUA 4JQOA 5KYXA 1J6UA 3QE2A 4MI3A 4W5OA 2O8BA 1I5RA 4NMWA 4DMCA 1EA7A 2BEVB 2BMFA 1CNMA 1JR2A 2I78A 2XB6A 3V33A 3ZCXA 3TR6A 2QR3A 3LQFA 1SK8A 3NTLA 4UU0A 3SZOA 4MW9A 4O98A 1QHHB 2Y05A 3PGXA 4PHGA 2A5JA 3FLAA 5KUTA 4GL4A 1KJ8A 2VZ0A 4OHYA 5HFNA 4FDVA 4B4KA 2H1HA 2YQ4A 2HRQA 2ZI4A 2XHEA 2WF5A 1JFRA 2RHCA 3QH8A 3COJA 4FHGA 1PG5A 1U1CA 1XEXB 1W581 1RC1A 2VHTA 4NOMA 3WLMA 3OPVA 4DQ0A 3K0AB 4W6QA 1IHPA 4M9SA 3SHVA 4AF7A 4LFBB 4TMYA 3OCCA 4INJA 5A0VA 3LWBA 5C1DA 4XLZA 5CFMA 1Q2UA 3EQ6A 4HWGA 5DI3B 4QUHA 1PEKE 1YDGA 4MQFA 4F04A 1D2GA 1Y5NA 2FZVA 4GPEA 2VTDA 1HURA 4LGYA 2IVZA 1I0ZA 5DMXA 4L8WB 3R9IA 4CLOB 1GYRA 4UJ3A 4F1WA 3UICA 4UZFA 4HFMA 1Z8HA 1R4MB 2RGNC 2FH5B 3D3JA 3B3AA 3JVEA 3QVWA 1ODJA 5DF1A 1BS9A 2PA3A 1TO2E 3L93A 3RKKA 1YB6A 3T7TA 1N0WA 1OWPA 2VXCA 3TBKA 3IJ5A 1ZRHA 2RHOA 5HMLA 3D7LA 3L46A 3H3FA 2IUEA 3D1VA 1D2MA 4Y9UA 5BYBA 5TE9A 4W5TA 1AY0A 1IBMB 4OMFG 5A5GA 1XZHA 3LYUA 4OJTA 2ZYSA 1L5FA 5DGDA 2HAEA 3PF9A 5AVTA 4AJJA 3ANNA 2AMVA 1C29B 4RS3A 2JHFA 4NPHA 4R81A 2B21A 4B1FA 4MCJA 2EKDA 3NBQA 3VMMA 4CMBA 4IDOA 4NONA 4L22A 4CLEA 2QX7A 3NDRA 3C6YA 5ADVA 3LNTA 3WL6A 3FX2A 2WHRA 2GPWA 1JEYB 3HR7A 1C3LA 1O6CA 2OORA 4FSHA 4RKFA 4X95A 4BO7A 1J0DA 4OEHA 3CZMA 3U56A 3GRAA 4IDPA 2G76A 2HHAA 2BEVA 2QJOA 3PC4A 2GHIA 4LNHA 4MW6A 4XOUA 3F3KA 3E53A 3PFBA 3U7RA 1YNOA 2UUPA 3F6PA 4P7JA 5JAMA 1B6RA 4OK5A 1VYUA 3ZTWA 3FOFC 2DMRA 1GGVA 1OI2A 5FWDA 1EESA 3N2NA 4IMJB 4IO0A 2NXEA 5CYOA 1LXCA 3TLAA 1P33A 3E4CA 5KX5F 1EUDA 2II6A 5L3QA 3ZH9B 3OD1A 5A5DA 1DB3A 3RVDA 2ODQA 4ZHQF 3QEOA 3ROGA 1G2PA 4TLBA 2OCIA 4RH0A 5ALXA 4RQTA 3BMOB 3CN9A 5AJWA 3HPQA 5AIBA 2VUUA 1L8XA 5HCNA 3U6BA 1R4NB 4PYMA 2H4WA 2HUPA 2OCDA 4YRFA 3K5IA 4M36A 1BYIA 2Q1TA 4P98A 1MW9X 1NYQA 5FPSA 5FLKA 1UT8A 3ZLVA 4R2WA 4YCCA 4HZUB 1ZLXA 4NJEA 4YP1A 5FRDA 1JPUA 2IYFA 4PRKA 5JG7A 3G1PA 2ZRMA 2P97A 1FU7A 3EZFA 1J2RA 5LCXA 1VHWA 2IZOA 2FPGB 2YHUA 3CLRC 3DEAA 2UZIR 3AHFA 4U9UA 1W1WA 2B99A 1W75A 2C88A 5KYXB 2J7KA 3N3BC 4GQIA 1QGED 4Q1CA 5EQDA 1NQTA 5A3VA 3VSEA 4E11A 3LZCA 3HWX1 3JD2A 5HISA 1LPAB 3Q2IA 4Q9NA 2WV9A 2WI8A 3PWZA 4XQEA 4QPPA 1FFCA 5E4YA 3QVVA 4HS9A 4WRRA 2H4YA 3KCQA 1V7CA 4F5YA 1JMVA 5L6LB 3Q6VA 5ECYA 4ZARA 1PBNA 3IXQA 2FR1A 4G41A 4C7KA 2R7MA 3HJAA 1I9GA 1Z68A 2VJCA 3U5ZB 3I45A 1ZH0A 4XVRA 1H6AA 4ZQBA 2XB2A 4M7PA 3HG7A 2OBXA 1MZPA 2PZKA 4P5PA 1EX6A 3DT9A 3FKJA 5DOVA 2B1RA 5DU2A 3ZS9A 2ZYIA 1EYZA 4FKZA 5I9LA 5HH6A 4F5WA 2FVXA 3WI7A 4B3JA 5C80A 3C3XA 2JFBA 4GUAA 3LQYA 2Q1XA 1VFNA 1L4UA 4L4UA 5EMMA 2FW8A 4OAQA 3DBHB 3SS8A 2RHGB 3QQPA 2QM8A 1CDOA 1KFCB 1Z6XA 2SKCA 1AF4A 4PGMA 1N5MA 2HCBA 3TO5A 2M1ZA 2V45A 4HCJA 3JQDA 1R66A 3UK1A 4KMOA 1WY7A 2CFOA 2VKQA 4K3UA 2Q4OA 4JKYA 4HI0E 5K0GA 1TD9A 1DADA 4YT8A 2IZZA 3OCYA 5EQJB 5H8WA 4MUMA 4UVGA 3BMOA 2QRNA 2WUEA 3AF0A 1G8HA 1W73A 4K9OA 4NENB 4PV7A 1BMCA 1KORA 1B14A 1ZM3A 4BQPA 1NU8A 3W78A 3TPFA 1RXUA 4DV5B 2PAAA 2BI7A 2YN0A 1Z0AA 2C92A 3DCNA 4RM3A 3FOEC 3AM1A 4HZUA 4YK7A 4TGLA 1P77A 2A30A 3U7FB 4GOOD 2YQZA 1CUWA 1Z45A 2JIZD 3GBVA 3M9WA 4QFMA 4UZEA 1UJ4A 2POQX 4ZYWA 4MQ6A 4QNMA 1OPXA 1U0HC 2OUKA 3L7JA 4XR9A 3G0GA 1TZ2A 2O8VA 3GLSA 4YRJA 4XDHA 4ZOLB 4EA6A 3GW8A 1W5FA 1DARA 2HJSA 4TLEA 1T9BA 3H4MA 2CJYA 1G5PA 2ETVA 3ZWMA 1BTOA 1ODFA 3CLVA 3BE6A 1M1UA 1Z0UA 1J07A 5GAJA 1QF6A 2C3PA 2WJ3A 3Q88A 1QC5B 4BUJA 1Z2EA 5EUBA 3ANMA 4BL5A 1Q44A 4ADSG 2C7BA 4NV0A 3ZJ5A 3VDXA 4P7KA 1HDZA 1P8JA 4BX8A 1PL8A 3PXCX 2C00A 2X4LA 3M49A 4K6HA 3WOVA 4GNRA 2IS6A 1NP6A 3H5NA 3VR2A 2ZRBA 5KVCA 4LHYA 4FZ5A 1HBJA 3TB4A 1TO1E 2BT4A 4B80A 2GMWA 4QQKA 3R75A 4E32A 4Z7RA 4PIVA 3NM4A 1F17A 4KTTE 1CUSA 3R3JA 1EEHA 5DX0A 1FNSA 2ASEA 1JLSA 3A0UA 3C8DA 4DNOA 2PWYA 1O8BA 3CFYA 3DMGA 4FFMA 3S5UA 4EYBA 3QPCA 2BGJA 1PD1A 4M46A 3ZU4A 5KREA 1DBPA 2J09A 2QW1A 4RVSA 5G4LA 1JR3A 1RFGE 3BZBA 3I9NA 3EWAA 3SI7A 5CH8A 2PUCA 2H54A 2JARA 1GRRA 1LZLA 1M2GA 3A3PA 3IURA 1EVLA 3NQ41 5I4KA 4JOQA 4GMGA 3GNTA 1J2EA 5TEWA 2HMTA 3AFHA 4CMEA 5L3SB 3ONNA 3HEAA 1CIVA 4LMRA 5I9TA 3BRQA 4D9NA 3A2MA 2F3QA 4KQ1A 4ZWNA 3A70A 4ESOA 2DWPA 2IXTA 3GJ3A 3CZAA 3ROKA 4KI7A 2OQIA 1DGQA 4K9MA 4ESHA 1Y48E 2XRFA 3EGCA 1JJAA 3QFRA 4NENA 5HK9A 5EJ2A 2O0LA 3U37A 5FAXA 1I2AA 4ME6A 1HOTA 4HO1X 4M54A 5LC1A 5T57A 4TZFA 4H9GA 2G4VA 2QXYA 3R7NA 3PG4A 3KK0A 3UK0A 2X7HA 2Q2QA 1E1KA 3EODA 3U2QA 1RPZA 2GRAA 1LGYA 4ZYTA 3COWA 4LZZA 2NVUA 4OXXA 1KEKA 3NRBA 3P1JA 3Q2KA 1URPA 3A4IA 4Q34A 3ZI0A 2EZUA 4QZVA 4JEHA 3E03A 4ZOLA 3L7AA 1IMOA 2V59A 4NURA 2BGGA 1UBKS 5K3SA 3RS2A 2EKPA 2K7FA 3OOYA 2ZBGA 1L4LA 1N6IA 4L50A 2RB5A 4KN6A 4NABA 2B5OA 2PV0A 4FMDB 4V0MA 3WOHA 4PF1A 1Q7RA 1C9NA 4IX9A 3VPGA 4EHLA 2FHXB 3OP4A 1QC5A 3NHAA 5DKFA 3KLPX 2C9CA 3SD9A 3GUYA 5BUQA 3QPWA 2CHUA 1YB7A 1BFUA 1VRWA 1W0JA 2J3LA 4JOCA 4BNDB 4XPIB 1KYTA 1BC5A 3N58A 1T6BY 2KE5A 4HGYA 5CHYA 3JVDA 1G6KA 1FA9A 1ZMXA 1K4YA 2VYNA 1RVDA 1DWUA 1Q0LA 3L6RA 5F7ZA 3E9YA 4ZOCA 1AUXA 2F8SA 4ARSA 5GIPE 2P9BA 2IP2A 1MO3A 2QVZX 2Z3VA 4QG7A 5IAGA 2I9PA 1B76A 4C7OB 3WIEA 1MDFA 1OA1A 2ZSAA 3PI6A 1M8KA 1ZD2P 3R5TA 5DNAA 4JOBA 4UCWA 1DQPA 1MIOB 2XWJI 3F78A 3E5MA 1LNSA 3BB4A 4HZIA 4BNMA 3EAFA 5LQNA 2EQ5A 4EY5A 1N77A 2Z1NA 3PZRA 5I7VA 5L3SA 2O5VA 1CEQA 2AKAB 2H92A 1R88A 1WUYA 2PY6A 1A9TA 1GFWA 2J3DA 1MFPA 4Y1GA 5CDHA 3X0DA 2HU5A 4XYEA 2D1RA 1G16A 2AZDA 1P3DA 2X9GA 3AFMA 2QJFA 3GEIA 4PG5A 5FR1A 1NOKA 4BZQA 3MMSA 3L0DA 4GBED 1K8QA 3AVVA 2JATA 5U1PA 1DD6A 1SHTX 3LDHA 1KRXA 3U16A 3GRCA 5B55A 5AKGA 4L6AA 2BUBA 5AVOA 1L8QA 3LSYA 1LPNA 3OZVA 4HAVA 4P3YA 3RG8A 3WAKA 2NIPA 2LR0A 1HQCA 2QEQA 2H1IA 5FI0B 5C51B 2GM4A 2CMDA 1ZO8A 3KZVA 5T7BA 4G9BA 1Z83A 4CG2A 1CJMA 2ETXA 5BV1A 2GJ4A 3SYMA 1E0DA 1LA2A 2WYHA 4HB3A 4WE3A 2DBVO 5CG2A 2Q2NA 3T06B 3IQZA 3NHYA 5HMMA 1BFKA 3KWFA 1QCZA 1NXPA 2G1UA 1B00A 1UPXA 1P81A 2YHAA 1HYQA 2D5IA 4JHLA 3EQZA 4KQ6A 5ABPA 4ZV9A 2D7DA 2FG5A 2VAMA 2FZEA 3CTMA 3FSRA 4Z4CA 1LLFA 5CFRA 3AJ3A 1SAYA 3B82A 4BRWA 1LW7A 3KHSA 4P93A 4Z7OB 2A9QA 4C0AC 2AI1A 4PSDA 4BNDA 1CD5A 4M21A 4XPIA 2UYGA 5BT8A 5KKNB 2QD5A 2NVBA 1EAMA 2D0OB 4TWJA 4NG4A 1S02A 1AGYA 2B2CA 3P9CA 1GTL1 2G25A 1QXSA 4B40A 4NBVA 4BNKA 1IY8A 3WTCA 5M7EA 3U3DA 3M1AA 3PWSA 1OV6A 1JHXA 2B8WA 4UHDA 4QM7A 1P80A 1MB4A 1HTWA 3RFFA 2E1RA 4TT3A 5KQSA 4UM8B 2EATA 1E79A 1T24A 2QRGA 4A8PA 5KNDH 5B3JC 1MIOA 1NVBA 4IIUA 3NM6B 1V25A 1RADA 1VLZA 3D8RA 5DLYA 4F56A 5ITWA 4MDFA 1Z17A 3DE5X 3A6HA 5EP3A 3TSYA 1OR8A 1U2EA 4W8HA 1XLVA 1GOTA 1XE3A 3KVRA 4KPUA 1E1DA 1V5FA 3PKIA 2VDRB 4GX1A 1EHIA 1GCUA 2RCNA 4IQ0A 3WQRA 2A7MA 1JBEA 3NJ8A 1T2FA 2WPNA 1Z5ZA 1WP9A 3CZCA 1CY1A 2A4KA 3FM9A 1QV7A 4NK5A 4OYRA 1NW3A 1A2QA 2GNOA 3OF3A 2RGYA 4WKPA 5THKA 3HDHA 1KKUA 4HEA6 5LMUB 3V97A 4MVJI 2V6IA 3PRJA 2VCEA 5KNBA 4YJGA 5DN6D 2EWWA 2GCIA 1Q0SA 2IZ6A 1Q92A 4E4RA 3LCJA 1I2CA 4MKFA 3WK8A 5AW6A 1YK1A 4CLDA 4ZZ3A 3ONEA 3EA4A 3FPCA 3SC3A 3B6EA 1YF3A 1ECCA 2C9BA 5B1DA 1Y37A 3C6MA 3GT4A 3I1JA 4HGZA 1DG9A 4YRSA 4J29A 1M2XA 3Q3EA 4JT2A 1RYDA 4XWTA 4TSRA 4C5BA 4C1DA 4GPTA 4UTRA 3LWNA 1XA4A 3CZPA 4MEBA 1D5WA 4AS2A 1OWLA 1XQYA 4MYDA 1IWPB 4W9NA 3S28A 3VO1A 5K99A 1HT3A 3QOFA 4PQEA 4XB1A 4PC2A 2QN2A 1JJ7A 3SYRA 4EGCB 1GPAA 1VJ0A 2QVYX 1K68A 5DCUA 1NJGA 1PFUA 1XMXA 4MUGA 1RPTA 3LV8A 1EVJA 3Q8WA 3QE9Y 2XD9A 4FEEA 2F8MA 5EFZA 4RAMA 4BBZA 4EPRA 2HBYA 4G8JA 4ZMSA 1QG4A 4OHKA 3PSHA 3RUCA 4EKNB 4L5AA 1T0UA 4FYMA 4ZRNA 3S1LA 3H9BA 2ES4A 4CI0B 4QXAA 1II9A 1QUEA 1JTFA 5B58C 3DLTA 3ZCRA 5HS4A 4KZKA 2XI4A 3NG1A 1P39A 3F3MA 4IDFA 4C3VA 3I6YA 2ZJ2A 3OQNA 3ZHYA 4BMDA 2EGUA 3P2YA 5LDDC 2NZ8A 4E5NA 5LOVF 4DRYA 1Z4KA 3ADCA 3JQ9A 4F60A 1G4HA 3E8SA 5ALZA 2JI9A 1KJJA 2A4MA 4L8LA 2B20A 1RAAA 2RBGA 4I8DA 3VYWA 1NTRA 3W2EA 3RNLA 3BDAA 1O97D 4MQ5A 4UASA 1U0SY 4DLLA 2ZB3A 2JCVA 1GL9B 1AC5A 4OHRA 4WZBB 1QH8B 1E3WB 1UDXA 3NDBB 2OCGA 4ACBA 2G82A 2JGIA 2QS9A 2Q2WA 4LQDA 3I64A 1NG9A 4YJ3B 4DIOA 3MS4A 5F35A 3EXG2 2O06A 5K0FA 2ST1A 3I5AA 3EPLA 4M0CA 1UK9A 3MJRA 1ESMA 3E9ZA 4K1XA 2EXXA 1M6EX 3AUJB 3GJZA 3Q9LA 1OLOA 3GLHB 1GNRA 2FEXA 4UVEA 1HNXB 5ALJA 3BXEA 3W9BA 1LY1A 4C89A 2XSZD 1KXJA 2UYOA 3AF5A 3DVRX 2QMOA 3CG0A 2G88A 6ADHA 4IDCA 4ZGGA 4CGZA 4BLOA 4FSBA 1TLLA 3OZEA 3RE1A 4CM7A 5EWJA 4EKDA 5CB0A 3FUVA 3OTOB 3VISA 1HG1A 1K3FA 4K1LA 3RFVA 4PRZA 4AF8A 1AGXA 1JF8A 1UMBA 3TFQA 1RWMA 1M8GA 3V7NA 3DEJA 1LX6A 4DTCA 4YLYA 1C4XA 1PDOA 4ZVPA 2PUEA 1SVNA 5FBHA 1Z6AA 1WCV1 3GFOA 3NGMA 4DQDA 5JNVA 3AETB 5IF9A 2CLMB 4HNRA 4AUKA 1CERA 1LTQA 1RQNA 2JPDA 1I10A 1U2PA 4WAUA 4WJKB 1P1HA 4IL5A 4WK6A 3C5VA 1DIHA 2CXRA 3FB1A 3P0HA 4IO1A 4J0KA 1RW4A 2J0EA 4Q9JA 1Y9AA 2P62A 3F9IA 3UH0A 1OMOA 2CF6A 3DC7A 4FCTA 3Q6MA 3G1UA 4DEVA 2AG1A 3AEUA 3HJNA 2BFCB 4LZLA 1MGPA 1B16A 4MLCA 4S0XA 3UV3A 4F2WA 2HA6A 3SX2A 1E8MA 2FXVA 2LIVA 4NCXA 1P4SA 4F6CA 5BPHA 2PUBA 3QXHA 3I8OA 4DHWA 4R0NA 2NUPA 5CT6A 1MKYA 1W44A 2DE0X 4MOWA 2OFFA 4HDRA 4BLSA 3DEKA 4X71A 2C7OA 2JHPA 3W1WA 2WY2D 1WUIS 1UBFA 5JH7B 4AXXA 2J46A 3NTXA 4PZLA 2TS1A 3N8DA 3FMGA 1BN6A 5FO0A 3R0JA 1EFVB 1MV8A 4L0DA 1PNVA 4FFBB 1NZFA 4XJTA 1LV8A 1QH8A 1E3WA 4HDNA 4ZDIA 1WXIA 2OB1A 3QVMA 2HLNA 1U0NA 3SYNA 5C8VA 1RHRA 3CZRA 2DUNA 2ZITA 2NQTA 4RPLA 2C84A 2VSXA 1BE0A 1F4VA 2W2PA 1E1NA 4M22A 1VDZA 4I3HA 1DDKA 2X23A 4P7BA 3X2ZA 4D8WA 2VDLB 3LECA 4HDMB 1YZTA 2NXCA 3GLHA 1B15A 1JA1A 4L4SA 5GQSA 3ZCUA 2Y87A 1WTCA 3FNFA 3ZLUA 2QQFA 1W25A 4AQDA 3ILHA 1FQWA 2JIOA 3IUPA 2HI0A 2IXFA 1L4EA 3CEMA 2FR0A 2JKYA 4GF5A 1Q83A 1HC7A 4OU4A 4BX0A 4E6PA 4OSPA 5FADA 5AESA 5EUQB 3ESBA 3EMBA 4IV0A 2HQ1A 2QXUA 5AMXA 1XNQB 3EVNA 3C24A 4BXOB 1KR5A 4Y30A 2B9EA 2IEDA 2J45A 4GBMA 4X8MA 4K8OA 2OSVA 1HFKA 4QDKA 2CK3A 5JE8A 5C8XA 1D09A 1TX4B 3CG4A 3MILA 3BOSA 1Z15A 4I4CA 5A02A 1JJIA 3AETA 4RBNA 3FJOA 2JFYA 3RFUA 1ZJYA 2JFOA 4OLHA 2X4IA 3N2YA 5JXHA 1XQ6A 1BS1A 3OFNA 4KBGA 1SG6A 1J1IA 3PNOA 1J99A 4DHEA 3ZK7A 1X15A 1Y7IA 3V9AA 1JSCA 1JVNA 5CDYA 5DBIA 1IZ0A 3W8FA 2XCRB 1M75A 1ISRA 2ZBPA 5B37A 5CD9A 5ICFA 2BFCA 3LHFA 3MPOA 4Z9BA 2JCGA 4JI1B 1JAYA 4F38A 4PYRA 4MPRA 4YT2A 5E9AA 5TS3A 3AVUA 1SBHA 2YNUA 3MT9A 1OSNA 3IPCA 4BGDA 2BTQA 4UPDA 5FA8A 7MHTA 3RT7A 3NRCA 2ZAYA 5AUPB 5EQTA 3KOZA 1MPTA 4DQKA 3A6GA 3GEPA 1Y0BA 5B53A 2CG3A 1P1CA 1C7EA 2B8EA 2IGBA 1FP1D 1L7NA 2NTYC 1OI4A 4OP2A 1QZZA 3TH5A 4TZBA 1EFVA 2JHGA 3M7IA 4QBTA 4E22A 4NBUA 2YXNA 3FRJA 2C3OA 4FFBA 4ENVA 3S1AB 4KXVA 3HYRA 5ACSA 1WQ4A 2QVBA 3C5EA 3GMDA 1V8BA 4PIPA 4PLGA 1TQHA 3TD9A 1V8OA 2ZI9A 5EYPB 3AVWA 4OV6B 2EAUA 2HLHA 2IOQA 2ZPAA 3A1EA 3LW8A 1P45A 1T5TA 1C30A 4JBWA 4K9DA 4X8OA 4F86A 2IK8A 1T4DA 2E21A 3K31A 2GN0A 4G0NA 2R6DA 2X9LA 2BH2A 5FP0A 4A91A 3KZXA 1J33A 4H3VA 3UAGA 1YUBA 4XB6B 4IIJB 1N25A 2AKYA 2VS1A 3P9RA 5LWQA 1CY8A 5C7OO 2DEUA 2XZOA 3JALB 5B15A 1TQ2A 4YRKA 2KYRA 4OQDA 3L1KA 2QRVA 2P1RA 1JG2A 4CMHA 4BXOA 1VCHA 3SXJA 5I7RA 4CHTA 2HH9A 4PC7A 1RP7A 2VWQA 1JH8A 1L5ZA 4FHEA 3LOPA 2V97A 2HWUA 3AERB 4LW8A 4MA4A 4DB4A 2XE6A 4UAJA 2N9UA 3D6FA 4M0EA 2FJPA 2RFLA 3RVRA 3SLGA 4PBSA 2QOEA 3UAZA 4B45A 1J0BA 2LTAA 1L5WA 4UW9A 1AQNA 3LFHA 2J0UB 2OGUA 1TMGE 4UZSA 5EPUA 1SKMA 2BG8B 1X7WB 4ZRMA 4GWKA 4OBWA 3DKPA 3LFTA 1Q0ZA 2GWRA 1W35A 4ZT5A 4DDVA 3VNQA 4DWWA 3FSGA 4TMVA 4BO0A 3HO1A 3QX7A 2V65A 5HYVA 3NVDA 3KUKA 4DVGA 4HNVA 1QRSA 1E1LA 4IEIA 4PIMA 4RMIA 3Q3GE 2UZ1B 1FQKA 4PM4A 4U8HA 2QSJA 1KI7A 1MR3F 4NS4A 1P2DA 3SBLA 1KP9A 1R50A 1XMQB 3CUUA 2RGNA 4J2TA 2O4UX 2GBFA 4LTNA 4EEKA 3AKEA 4LC9A 1XX6A 5IZ4A 4ROTA 1M6VA 5JS6A 1CNFA 3AR5A 2VOEA 3PEEA 3PXEA 5DBFA 1YU9A 3G9ZA 3HWWA 3K70B 2UXBB 2X58A 4R3WA 4FR7A 1W4AA 1PYGA 4MA0A 3HWRA 1UJMA 5BV2P 2LKDA 4BJ1A 3OMLA 1BMFA 1V8PA 4RY9A 2FOLA 2YR0A 2IXEA 4L1KA 4YMGA 3VGPA 2JJMA 2AYZA 1J2JA 1GSIA 1L8LA 4LF9B 1MPXA 2WU3A 3CU5A 1BDIA 2GSWA 4IFIA 4J7UA 1CR6A 3S1AA 1VKHA 4BVAA 5IHPA 3ELBA 3N3AC 3ZDRA 4DIFA 2FPRA 1DV2A 1K8XB 4L51A 3OQIB 5L95A 4BAZA 2ZT6A 2XUGA 3AJ9A 2XPCA 1LX7A 1XEWX 3JSXA 5EYPA 4JJKA 3NIWA 2LGJA 2DWCA 4O5AA 3M81A 1D7OA 1TCVA 1ZZEA 4KSYA 4W5RA 3Q3VA 4ZJYA 3H4VA 1L9XA 2OZEA 3N86A 4EHFA 5IM5A 1KQNA 2FK6A 3BV6A 3TLEA 3V7UA 3DL4A 1TCBA 4A3SA 1HKHA 1AG9A 4Q1BA 4ILEA 3HJGA 2H1OA 1W36C 3BTUA 3JALA 4QTXA 4EXSA 2QY9A 4NBRA 4RSGA 5KB3A 4Q1AA 4LOKA 3KNRA 2YTZA 2IV2X 3JQAA 4DM3A 4JLBA 1M67A 2HADA 2HO5A 3AERA 2GK4A 2IDMA 1FFSA 4C0HA 1H5NA 3NOQA 4LXHA 3K32A 4WEQA 2PJUA 1VL0A 4I4IA 4FDTA 1PL7A 4I4TF 5DCLA 3RUDA 4C29A 3BHNA 5CVUA 4DLTA 4EHBA 1XQXA 3M89A 2JGJA 2J0UA 2XECA 3A4NA 3LY7A 2W70A 2BG8A 1ODCA 3WGYA 4MRMA 4OB6A 4P54A 5DV9A 3U4MA 4G0YA 2AX4A 3GU3A 2AWOA 2I67A 2ZAOA 5L7TA 2A14A 2YHBA 4DLRA 1DCKA 3CLSD 3PVCA 3O3OB 2RJ3A 5A4DA 5F2NA 1FRVA 5BW5A 5F52A 3JQCA 3U3MA 2IHZA 2UZ1A 2R8YA 4PVDA 1NF3A 1PFKA 3CW2A 2DY1A 4QARA 3AF1A 4ARUA 4ZMBA 6CHYA 4YMWA 2Q0IA 2ZUEA 2A0UA 1ABEA 4UARA 4JWKA 3WGQA 1VBFA 3LGXA 3H2JA 4Y7CA 2CXTA 3I9FA 3RROA 3ZPXA 2PR7A 4GEKA 1GQQA 3L5KA 3DH8A 4G9GA 1SN7A 2KS6A 3ADKA 3NIDB 5BWCA 3FN4A 3G17A 2TSYB 3UJ7A 3PFFA 4RTLA 2DETA 1NXOA 1YCGA 3KALA 4V1CB 2RAFA 1C0IA 4EGFA 2GHRA 1I51A 2I8AA 5IW8A 1OHHD 4WQMA 3IALA 1ZGBA 1P1JA 7ABPA 3KR9A 4LRWA 1NJ1A 3DE1X 3FWZA 4GKAA 1Z5UA 1OFUX 4NXNB 1SMLA 1FXUA 2NVOA 3CVWA 1BNCA 1SBIA 1E5VA 2H2WA 2CZCA 3OQIA 3H5TA 4P3NA 4DMRA 2ZM5A 1BJTA 5LU8A 4JU8A 1ZUD1 1ONBA 2NSDA 3THWA 2WU0A 3L4SO 4POAA 4UM9D 3ZGNA 4BE7B 1GWNA 5CLFA 1A8SA 1H3FA 4KX5A 3P96A 1H4VB 3T4EA 4FW8A 3TQHA 1T9DA 3MG9A 3FRHA 3OJFA 1GNPA 4MUXA 4Q03A 4BB6A 3GPCA 2WSSA 3KLOA 1IU9A 5ITVA 3F3YA 3MBOA 1G7SA 3OA2A 1G21B 1LQUA 3JU3A 1ZA2A 2DWOA 3D5QA 2CXSA 1MJHA 2FGKA 2PN1A 3AUYA 3B7WA 2J31A 4OP3A 3BB3A 3NNDA 1S9DA 2WJHA 3WDMA 4I6JA 1QG2A 4CIYA 2L0XA 5DTEA 1Y8RB 3NLLA 3KLNA 1RJWA 1SHJA 4AN0A 5JSYA 3M34A 1V3VA 1UL1X 3PS9A 1C9EA 1KIFA 1NP3A 4JI5B 3V2GA 3VC7A 1A9OA 3FMOB 2RHBA 1MQ8B 1O1YA 1MVLA 4IDGA 5DTJA 2XZLA 3P2EA 3M9LA 5CEJA 3ZS8A 5EE5B 3ZWBA 1IBSA 2BKEA 2O2GA 2FCAA 3NTOA 3ZDAA 1KSJA 2IHKA 4YRLA 2JK0A 3JQ8A 2FJ0A 2NTNA 5JLAA 2WKRA 3ROZA 4BMPB 4CUJA 1DI0A 1XO1A 2XR1A 1XRNA 5JWOA 1RU3A 1NKSA 4E2ZA 4RD4A 2J67A 4K3VA 1Z74A 2ZQYA 3GRUA 4HAIA 2ZTLA 3TI9A 2P4UA 3DYIA 3LLSA 3UK7A 4RKWA 2B4KA 1Y7TA 3MJ4A 4QGHA 4YQEA 4JJFA 1MJGA 1EAYA 2P75A 1NG1A 2G7MC 3H5WA 1OBVA 4QJ4A 2H4FA 4L9AA 4KK4A 5FI1B 3GLKA 3L92A 3QYPA 3T61A 4TWZA 3KD2A 1AQJA 4OQFA 3DVAA 1J9EA 3E70C 4BRZA 2RGUA 4G5HA 4RTPA 4LZPA 4UU1A 3S99A 2YN2A 4XVUA 1M72A 1D1PA 3DL7A 3RH0A 1K7EB 2HF2A 3IKJA 1G66A 1J56A 5JWHA 1BOOA 4FGKA 3L84A 3VNSA 4AB1A 3STTA 4YYEA 5CW2A 3AFIA 4OIMA 1UBMS 5TQVA 2YC2C 1EK1A 3O2SB 2WJGA 2Z09A 4AX4A 4BYGA 1SD2A 3V2UA 4J3JA 2O2DA 4URHA 4LSWA 4DPMA 3AY3A 1HV8A 4YT5A 5EY5B 1Q16A 3BHIA 1X14A 3DAPA 3MT7A 5CGZA 5A5EA 3R9XB 2R96A 3I58A 2BC2A 2YWGA 4TN1A 3UATA 1ECPA 2AJBA 1G21A 1NU6A 2DHEA 2Z2XA 5JAQA 3TAUA 1Z5OA 1JB1A 2F17A 3C4JA 4IR7A 2ROQA 5T6BA 1C9KA 3GCZA 2OXRA 1E1RA 3E4DA 3IBFA 3TTUA 2QRUA 2FP4B 1B41A 1TIPA 3AFGA 3NP9A 4FX2A 2OBFA 2CEAA 5EHNA 2BFZB 5ES3A 1UKYA 4YRTA 5DB4A 1N5RA 3IRVA 3KAKA 1OI7A 2CC2A 2QQ0A 4RGVA 3T9EA 2GK7A 2EDAA 4U2KA 1Z4LA 3EY9A 2WLTA 4L16A 1XIVA 4QRDA 4TOIA 4DY6A 3ZR9A 4M1EA 1ZS9A 1WG8A 4XVHA 1G17A 3IH5A 2XJ9A 2ZI6A 4KCGA 1DIBA 5IAEA 4G2TA 1ZD8A 4OBEA 1T8PA 5TIIA 4EW3A 3KZCA 4JR0A 5FL7D 4LZNA 5KDLA 4TKMA 2Y1KA 3SPXA 3ZEAA 2BGUA 3OLXA 2EFGA 2AD5A 4PX3A 1MX9A 1ZOSA 5D51S 5CPFA 5DULA 3IIMA 4U4AA 4RTNA 3LD9A 1E94E 4IFTA 4JLKA 3NYIA 4UNIA 3R8XA 1T8UA 2QIPA 2XKJE 4XVCA 3WKDA 2OY0A 4PAWA 4QGSA 4Z4FA 2XTNA 2VHUA 9ATCA 1N9GB 2HV9A 4QECA 1Y6ZA 1PGJA 2AJLI 4WINA 2QMUA 2R11A 5JARA 5KIAA 2IH2A 3CR8A 3HSSA 7GPBA 2ZTUA 3L49A 2BGIA 4NBKA 3U4QA 2XWSA 1P75A 2EBFX 2C5AA 1VLJA 5LU9A 3ASZA 4ZICA 2IUYA 3R5XA 2XB8A 3GT7A 4RHCA 5MGNA 3EEFA 4X3OA 2G63A 2PPVA 4BJ6A 4LS3A 3JQPA 3Q1LA 2BIBA 4BNIA 2JVKA 1CUCA 4HPXB 2BBTA 3GZNB 2B2XA 3CRRA 4RJJA 3WXCA 1SQFA 1E3SA 2QTAA 2XUKA 1WJGA 4WA8A 4X62B 1JSRA 2GEBA 3RT9A 1RRGA 4J0JA 4U2FA 4W8OA 2XUAA 2PEYA 1QRRA 3BMQB