4ZTUB

Structural basis for processivity and antiviral drug toxicity in human mitochondrial dna replicase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
418
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA polymerase subunit gamma-1
publication title Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ztuB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4ztuB02
3A5YA 1YB3A 2DU7A 4P73C 3DSQA 2HNIA 2PMFA 3UH0A 3HXWA 4H2XA 3VQWA 1BBUA 2J3LA 2ZR2A 3A7RA 3QO8A 4YP0A 3M4PA 2C7IA 1E1OA 1ADYA 1LYLA 2ZT5A 2ZT8A 2QHVA 2LW7A 2E65A 3V8LA 4YPFA 1YFTA 3BFMA 4P71A 2Q7GA 1B70B 3LSQA 4CS4A 1NJ1A 2ZR3A 4ZTZB 1E24A 2RHSA 2EJGA 2EWNA 5K1XA 2QHTA 4YROA 4UP9A 2E3CA 1IL2A 1EIYA 2DU5A 3P8YA 3TEHA 2DZ9A 3V7RA 2RHQB 4AH6A 1ASZA 1WYDA 3HXYA 2ZZFA 2ZNJA 1EFWA 2AKWA 3G1ZA 4K87A 1JJCB 4P75A 4TQFA 4YRTA 4BWAA 4YRRA 4KR3A 2DEQA 1J5WA 4L87A 4CS3A 3IG2A 4DPGA 2XTIA 4H02A 1EOVA 2DXUA 2I4LA 4YRPA 3L2ZA 3UGTA 3VBBA 3HXXA 3LSSA 4XTWA 2CGHA 1FYFA 2EJ9A 3VQYA 2IY5A 3RKWA 1NYQA 1WQWA 3L1AA 4CH3A 1B76A 2E10A 3ICAA 4WI1A 5C51B 1WNLA 1SRYA 2P0LA 1EVKA 12ASA 3IALA 2DZCA 4YRNA 11ASA 4H2VA 4RQEA 2ALYA 3NETA 3E9IA 3R07A 4YRKA 1H4TA 2ZINA 4EX5A 1NJ5A 2ZIOA 2I4NA 3FJPA 4YCWA 3I7FA 2CJ9A 3W3SA 4YRQA 4HWSA 3NELA 4XTXA 3MEYA 1WU7A 4XTZA 2G4CA 2ARTA 2C8MA 4HVCA 3HRIA 4P74A 3E9HA 2AMCB 3RKXA 1X54A 4TWAA 4P71C 4OLFA 1PYSB 1H4SA 1NJ6A 3QTCA 4YREA 3TUPA 4RDXA 4J15A 4P3OA 4YRLA 3VQXA 4OP0A 1SETA 1B7YB 1GGMA 1NJ8A 4ZIBA 3A7UA 4TVAB 2ARUA 1C0AA 2J3MA 4HWTA 1X01A 4P3PA 4DQ2A 4H2XB 2ZXFA 3HY0A 2DTIA 3WQZA 4KR2A 4XU2A 3REXA 4K86A 4H2TA 3EFSA 3CMQA 4P72A 4YRIA 1L0WA 4P75C 1NYRA 1H4QA 2E1HA 4X5OA 2E5AA 4TVWA 2Q5IA 3RUXA 1YFSA 3HY1A 3VQVA 1SERA 2Q7EA 2E64A 2DKGA 5KNNA 3KFUA 2QHUA 2ZZGA 3QO5A 3L4GA 3BJUA 3HXVA 3REUA 2Q5HA 3P8VA 4YRMA 4WJ3M 1NNHA 2EJFA 1BIAA 5E3IA 5ELNA 3UFGA 4P3NA 2CIMA 1WQ7A 3IKLA 3PCOB 4YRSA 4YYEA 4Q6GA 3RGLA 1USYA 3QO7A 5K1PA 2ZZEA 1KOGA 3A7AA 4HA8A 2XGTA 3HFZB 3HRKA 2ZT7A 2DXTA 1G51A 1EQRA 1HC7A 2E41A 4K88A 2I4MA 4XU3A 2DDZA 2Q7HA 4TQDA 4XU0A 1B70A 3HTZA 3V8JA 3QNEA 4XEMA 1BBWA 1H4VB 4CS2A 5C52B 1BIBA 4G85A 3EFRA 1Z7NA 3RKYA 2PMEA 1KMNA 4TVAA 4P74C 1G5HA 1WPYA 4P73A 1HXDA 3RACA 4PHCA 4PG3A 3V8KA 1E22A 4HWOA 5F5WA 2RHQA 2IY5B 4YRCA 3RIRA 2ZCEA 4RMFA 4TVYA 2ZGWA 1RIQA 1X56A 1JJCA 3P8TA 2P5IA 1X2HA 1V95A 4Q15A 4WF2A 4O2DA 4H2WA 3A31A 4UPAA 1Z7MA 3OD1A 4NCXA 2DTOA 4EO4A 2QHSA 3LC0A 4XEOA 4YRJA 5HGQA 2ALYB 1SESA 1HTTA 3TEGA 4CH5A 1YGBA 4XU1A 2DQ3A 1N9WA 3MF2A 4YRFA 4P72C 3HXZA 3A5ZA 3PCOA 1QE0A 2ARSA 3NEMA 2DJZA 2I4OA 2DVEA 4YRGA 5C53B 3MF1A 2EL9A 4G84A 2FYKA 3M4QA 4YDQA 2RHSB 4UP7A 3HFZA 4ZTUB 2ODRC 2ODRD 1E1TA 4HWPA 4XTYA 2CJAA 3HFVA 3RF1A 1ASYA 1WLEA 1X2GA 3V7CA 4XTVA 4YCVA 4H2YA 1EIYB 3A32A 4H2UA 3TEHB 1X55A 3V7SA 1USYC 4KQEA 2ZT6A 1G5IA 4RQFA 3PZCA 3RL6A 2CJBA 4CH4A 2DQ0A 3NENA 1ATIA 2AKWB 5ELOA 1KMMA 1B8AA 3UGQA 1VQZA 1NJ2A 4LNSA 2AMCA 3A74A 2EAYA 4H2SA 4HWRA 2ZNIA 1PYSA 4UP8A 4E51A 2DTHA 4BW9A 1ADJA 2ZIMA 3ERRA 3IKMB 4CH6A 1W66A 4WJ4A 1EVLA 2ZTGA 3HXUA 3L4GB 1YFRA 4YCUA 1QF6A 4XTUA 1B7YA 4TTVA
chains in the Genus database with same CATH superfamily
3TL6A 1DU4A 3K32A 2WG0A 2WUDA 5AKHA 5G3YA 4CF4A 4DEYA 3KJZA 4EA8A 3IIEA 4FQ5A 5FA6A 3RRMA 2RI0A 4EW1A 3E3OA 1WUIS 4PHGA 3TCKA 3D43A 1VRVA 4QBIA 1F4PA 1FDIA 2J9FA 2WRZA 1KFEB 3QNMA 4MYRA 4M0KA 1RKQA 4CZ2A 4ZYLA 1WP9A 2Z3VA 3AHCA 3H2HA 1GN9A 5NLLA 4IJ6A 3ZBUA 4BPBA 1MDBA 3QVLA 4FNOA 3TFQA 2J6BA 1P7ZA 3FUCA 2IELA 3K9HA 4IJKA 3A10A 3LW8A 4LOKA 4RA6A 3BE8A 3WGTA 3E22B 4BBAA 5J2UF 3K6SB 1N4DA 3W34A 4CM1A 3NZEA 3IVGA 2VHYA 4R1TA 1VKZA 2WHPB 2B1JA 3QMPA 2C88A 4OGLA 4W8GA 2I4IA 4L73A 4FD3A 2OMEA 1PN3A 2VP9A 4FHZA 2PT7A 3S0JA 1KJJA 1Q6ZA 1IZZA 3VO2A 3GLIB 5A9RA 3FKJA 1TAHA 4B33A 1XXLA 1TQ4A 1C41A 1K3TA 5ETJA 1ADFA 5JAIA 4Q4CA 4IX9A 4HAXA 4CS4A 4RPLA 2AKEA 3NB0A 1FYVA 1S89A 1S8OA 3FYDA 3IPXA 3N39C 4BB9A 5IXSA 1WBDA 2HWUA 4PM4A 4D0RA 5GOTA 2C54A 4AN4A 2IU4A 3DEYX 1KP3A 1UCFA 1JPNA 2V6BA 5FPHA 3VGJA 4AJEA 4B6FA 5KC9A 2C3PA 16PKA 2V45A 2DBVO 3VXKA 2CE7A 4CQMA 4II2A 4IZHA 4Q16A 2WB2A 1T29A 3E1KA 5K0SA 4IL5A 4LDRA 1IAVA 5HCIA 5NULA 3W05A 3NQ41 2I5PO 3CZ4A 3B9RA 3C45A 3EJWA 1DIOB 2JI9A 5T64A 2P30A 2GEJA 2XNJA 3IRVA 3L1IA 3R6GA 4M22A 4XPZA 5DTEA 4TMFA 4UM9D 3H6GA 2O2SA 3FHLA 2X3YA 4LJ5A 2H11A 1AU9A 1PCXA 2X15A 4GT1A 3VAAA 3W1VA 1N3BA 4JX9A 2FUG1 2WM2A 1FDOA 2Q9CA 5IUJC 1CUAA 3V8PA 3HE3A 4YRBA 2BUBA 4CJXA 2DZ9A 3JQGA 4RVHA 1W85A 4AH6A 1YS1X 4DJAA 5TEWA 2GXUA 2H06A 5ELXA 3DLHA 2QZZA 3HXYA 4YT4A 3ASUA 3D0QA 3PQ4A 1UH5A 1XD9A 5D7BA 3PQEA 1Z83A 3PENA 4FCVA 2XOEA 4CL2A 3MNFA 4U3JB 1HGXA 1XLUA 2EKQA 3T0IA 4Z49A 2PLFA 4K2HA 4B0PA 2R25B 4Y6SA 2O3QA 1TGYA 5AK0A 3I0ZA 1F5SA 3PNPA 3TFWA 2NU6B 3CFYA 3CRMA 4X6LA 4UU0A 1DMRA 1N1MA 4BZZA 4CMIA 3OTHA 3SHTA 4PZPA 5AESA 2PYDA 3CXRA 4GMHA 3ZXYA 5CP8A 2PT5A 1T3TA 3QUCA 4FCCA 3R7SA 4L5JA 3WLIA 5K0ZA 1IH8A 1Y7TA 2CE2X 2PY6A 1ISHA 4HTFB 5COBA 4MARA 2VNIA 1KNXA 1L5WA 1EFRD 2AFIA 3GZJA 1M2OA 2QNRA 3BN3A 1AVTA 1MAUA 3CZMA 2GGSA 1OHHD 2C59A 2X0JA 1C7IA 4GOOD 4L5CA 4QNNA 4YRPA 3IOYA 4K26A 3AHDA 4PGHA 4YAOA 5IJ0A 4TXNA 3SS8A 2ZR9A 3GT7A 2JA2A 3AG6A 3CNHA 1MOZA 3L1HA 5DCWA 2COKA 3QFHA 1M6VB 4NONA 2AN3A 1VFNA 3JVUA 2OVFA 3AUYA 1EFPB 4M60A 1NMZA 3DXZA 5LMCA 3FUWA 2XYRA 4ETIA 1XDDA 3ZWMA 4A16A 5HUHA 4FDVA 4JUAA 3ZWXA 3ZQKA 2WJJA 3TIVA 1C1HA 4B6RA 4CFZA 1E4VA 4D81A 3U7RA 3MWGA 4JA2A 2XBUA 2W83A 3EMDA 3OU7A 3G9XA 4W5TA 2A2ZA 1YZUA 1DOZA 2OGZA 2G07A 3QYAA 5AI9A 4ZREA 2R8PA 4I3FA 2LKDA 5KJ6A 1YZLA 4ND5A 3RKRA 1UKAA 2FR8C 4KO3S 1ND5A 2I2BA 1PLKA 4HJRA 2IHYA 3DXXA 4HNAA 2ZRPA 1OAAA 1DARA 3A11A 5JJIA 2Q27A 3RTGA 4EJFA 3WGYA 3QKSB 2HSZA 2FPGA 4KRXA 1KJNA 3UMBA 3ILYA 1CHNA 2XGMA 1FPMA 4I8IA 4KN9S 4E30A 3RG8A 1X9GA 5EE1A 4TTJA 1A8HA 2HXYA 4FUQA 4JJFA 1CY6A 3RHZA 2CFTA 4TKVA 5AVWA 3LDUA 4CTNA 1A8IA 3KQPA 4WADA 4BV8A 2Y1DA 4P0TA 4RMJA 3HO6A 5ALOA 3HRHA 1C1YA 3TCXB 3C3CA 2V4UA 3WLPA 1KRXA 3UB2A 3AWDA 4AKTA 2N42A 5AKIA 4IRXA 4F3CA 1I7QB 5L6LB 2PKYX 3FYSA 2BP7A 3EXIB 1FRFS 1QMPA 1CRWG 4EHAA 4F6LA 4XVQA 5HQTA 1H6BA 4QYMA 2OHJA 3GBVA 1A9TA 3HABA 1SCKA 4LV5B 3BK7A 4TKUA 4B40A 2B8TA 1P74A 3E7DA 1U9JA 3C1UA 3G82C 5KJFA 3FWHA 2J3JA 2JD0A 1VG9B 2Q41A 2ZJ4A 3KZ1E 4FLFA 3HRIA 4WCFC 3S44A 4B76A 3DA8A 5F77A 3O84A 1ACJA 2ZR0A 3VYTB 4EG5A 4NSNA 5HJ7A 1Z5WA 5LM3A 2A5JA 3EEIA 4DDMA 5BXYA 5AW3A 1VSBA 2FPPA 5FH9A 1FFYA 4QYIA 5A5DA 3BAFA 1BCRB 1KJ9A 1ZU5A 2Z9DA 2O2JA 3BMCA 3HLYA 2WJ3A 3CUTA 2I03A 4X9XA 3UJAA 1AV6A 2R751 2Z8YA 4OYRA 5FI3A 3U7EB 3KHKA 2PDAA 2B1GA 2ZS9A 6LDHA 2AYYA 3DMRA 2HLDA 4UXHA 1RKUA 3FETA 3N8NA 4P3OA 3BT7A 3BZUA 3VQXA 2AWNA 4DMCA 4FZ5A 5EHQA 1NJGA 3L0ZA 1XMPA 3QG5A 5LQCA 3V8BA 3ZQUA 2IOQA 3H65A 1GGMA 4A36A 1GYQA 1WHSA 2OFXA 4W9NC 3HJGA 1GPNA 4WZ6A 3I9OA 5HF6A 3ROPA 2G40A 1TECE 2J09A 3TEMA 4HY3A 2XA9A 3ETJA 4RTPA 3DWFA 4E70A 5CA0B 2WIJA 1P6QA 3LY7A 4UUPA 1A27A 3HZOA 3ENNA 5ITVA 3C4JA 1NAHA 2H1SA 4HBZA 4NENB 1KL7A 2ERCA 4G0XA 3W5HA 3IIIA 1VJRA 5I45A 1C3LA 2LNDA 2LGJA 3RFTA 3R7WA 3SBOA 5F2EA 1M73E 2EJWA 3UJ3X 1A2OA 4BNJA 2O3RA 2ZIXA 1X86B 3AJDA 5ALGA 1G6OA 2X0RA 4OU4A 2D8AA 2NO5A 2VXYA 4RJKA 4TT3A 4K9OA 1CZRA 4JHXA 4OHUA 1VMEA 2CXXA 2YDYA 4YI3A 1M6EX 3DKKA 5BNZA 1KK3A 4UBLA 5GINE 2KM1A 3YASA 2XH8A 3OTQA 3E2IA 2XUDA 6AT1A 4AO6A 2JLAA 2RBEA 4GSKA 3HJBA 1L4NA 1VG8A 4DJTA 2I1LA 4DDWA 2IUFA 1JEEA 1XA0A 3PX3A 4GPBA 3WICA 2O3JA 1PJQA 2NU8B 2I3AA 4GOMD 4M6WB 2PZKA 2QHUA 1JKJB 5DM2A 3ND8A 1QYIA 2XITA 4FSHA 2W5UA 2CCJA 3VX3A 5EWJA 2GBCA 3IMGA 2GCPA 1O97C 4U8GA 4ZDWA 4A2PA 5EEGA 2R4TA 5EIOA 2IUYA 3AF2A 4ZQHA 3RFCA 3UN1A 3VDMA 5K6TA 2IBSA 2IC5A 1E3EA 4CNQA 4CMEA 1E3JA 2G04A 3WGHA 3HUUA 2XQIA 3GEGA 5BMVA 1H93A 2CXHA 2HK9A 2R6R1 4QGGA 4UU8A 5AM5A 2IXEA 3VRHA 1RZ3A 2QX7A 4N48A 3V9PA 4YRSA 3PUKA 3QLUA 2VPZA 4Q82A 1L7PA 2ZBGA 3LP6A 3TKYA 3VU3A 4B6QA 4YV2A 4JP2A 4OQPA 2VJQA 4ZMSA 2HQRA 1JI3A 3I39X 4PW0A 2D8MA 4FFSA 3PPXA 2VQFB 4L75A 5A5VA 2C1EA 1SU8A 1FUEA 1SOWA 1SIBE 1DJQA 1WUTA 2PWAA 1QMGA 1A7AA 3PUJA 5EN4A 4GUAA 4XR9A 3KOZA 2ZZEA 1COWD 3NTOA 3TR6A 1YBVA 4P22A 1H2WA 3ROZA 3UWMA 4QT0A 1TCVA 3COPA 1ZC3A 1J8VA 1RMTA 2GPJA 1IM8A 1EQRA 1Y3AA 2YXPX 3FTCA 3GLVA 3MFYA 2CYAA 4EO7A 5JWOA 4XU3A 1XCOA 3DOFA 3VPHA 2Q7HA 3SMVA 1A8QA 1JW9B 3DLIA 1MRSA 2WSMA 2DHCA 3V8JA 1N8KA 2JW5A 2Z0MA 3ZZNA 1X2EA 2J9RA 3O82A 1DT3A 4Z4HA 2W22A 5IBRA 5J4HA 5CYFA 821PA 2GD2A 4BO5A 2JLBA 1FRNA 1R9GA 3KKZA 4UBKA 5JH7B 4F3YA 3FOBA 1BIBA 4H7IA 3R23A 4KGZA 2FPRA 4ZU3A 4LWPA 5A04A 5LLSA 3MIIA 3MAJA 5IKPA 1H9AA 3JQ9A 2C8LA 4HAZA 3NT4A 3RYIA 1PX0A 2C2GA 3E0XA 3EGDB 3OCUA 3ONWA 3IV7A 1R4NA 3O8LA 1P0FA 2DFVA 3FVVA 3QY9A 4D9FA 1HXDA 3HDQA 2F7SA 4M7RA 5F1KA 3TRKA 3TAHA 2VNJA 721PA 1T5BA 1MW8X 4CNBA 2B0CA 1VLJA 2WDPA 3DEIA 3I6MA 2BZGA 1MBZA 3E9CA 3N0RA 3UT6A 4MGHA 2X2PA 2OQIA 2XZDA 4MPJA 2L18A 2X40A 5AI8A 2AOWA 3RGGA 3SK0A 3MJSA 2XQGA 2VDOB 4P4TA 1L5HA 4MIEA 2J0EA 3HFJA 1RYYA 4H0FA 1KFBB 5L3ZA 1K8QA 4G2NA 2XXAB 1M6YA 4OHXA 2GR9A 1HZZC 1NVMB 1UC4B 3QVWA 4AW9A 1FVFA 1PNVA 2EQ5A 1O54A 2HZBA 2M2IA 1X7YA 2PEYA 3AV0B 5D8DA 3SZUA 4AJOA 4OVKA 2VPIA 4MUAA 5A06A 1AB6A 2NAFA 3RV4A 1PJAA 4UOZA 5HM8A 4MUJA 4YMHA 3UQZA 3M4JA 4C2AA 4XEOA 3B7WA 3V4PB 3ZG6A 3PX7A 3PFHA 3T35A 1YR6A 1RHKA 4MQLA 5LYJF 2IT1A 4PG4A 4MROA 4UE3S 4DY6A 1S2DA 2P7IA 5CG1A 1X7XB 2IYWA 2PRYA 4CMCA 4BZXA 1SK8A 2CBXA 3O2QB 5FL7D 4F85A 4L6IA 2I8AA 1Q12A 2SCUB 3ZBTA 4R8MA 5A2GA 1MPXA 5HKLA 3WKEA 4RXMA 4FKZA 4J0QA 4TXLA 1ZR2A 3SSNA 2D06A 1NVTA 2OMKA 3H8WA 3I04M 5THQA 5BWOA 3PA8A 2PVSA 2BI4A 3I1JA 4D9GA 3Q8MA 1XZMA 3R75A 3FMPB 3PEYA 1JTVA 3KFXA 5I4CA 2QQ0A 3O83A 3IIJA 2D1TA 2X4LA 1L5NA 3MF1A 4N7MA 1JQLB 1OD6A 2OLKA 1KQ3A 3E2PA 5TR9A 4BX9A 4LS3A 1W49A 1DFIA 2BMVA 4XYGA 1WDLA 5AI5A 1OX5A 3CZRA 3ZWDA 4G5HA 3OPXA 1LGYA 3VJRA 4I66A 1J5XA 4ZT7A 1XT6A 4BYGA 4RHEA 2X5KO 4URZR 1OT3A 2C9MA 3NRCA 2EF0A 1WPXA 2FETA 3GQBA 2D54A 3L6UA 3PXBA 4AZTA 4CPDA 5LJLA 1R00A 3MELA 3KLPX 1XZGA 4TZ0A 1LVUA 1L4BA 2W2OA 4EYKA 4C0XA 2H5LA 5BRJA 2AMLA 4FFOA 1QJCA 1PZGA 4WV3A 2LBPA 2JJMA 3LWZA 3GHYA 3OA0A 4EEXA 2BBTA 3K16A 4MV6A 3P9KA 1GL6A 2ZRAA 3UEOA 1E4EB 1TCBA 3ID6C 2QW1A 3F47A 4NATA 1WMSA 3OU6A 4E13A 1O57A 4LV8B 3AVVA 2O8EA 4G26A 1K4KA 1N0UA 3KQTA 4RIFA 2CNOA 3F90A 5FWXA 2ACVA 3EUWA 2DUUA 1HNXB 5H0IA 5C3MA 4QULA 2Q50A 4IOJA 4KQFA 3X43A 4RQTA 4ZV7A 4DV5B 3HJCA 4DIFA 1AHNA 4OIFA 4NWIA 5DIFA 1L5ZA 2OFFA 2W2QA 1RXCA 2QTMA 2RJ3A 2DQ0A 3JQAD 3SR3A 4F7WA 5CDSA 4JI6B 5LL6P 1ATIA 2PQMA 3A14A 2C1ZA 2RAPA 2WU0A 1WVGA 2DFLA 2WA1A 4WECA 1LBEA 1RZVA 2AHOA 4J2HA 3ZI4A 2YFYA 1II9A 2P4UA 3KYDA 4OH1A 1QYDA 3OZDA 2V3CC 1BHSA 4PS1A 3IP7A 3TSAA 2E5LB 2H3HA 4NE7A 4BDTA 1ZM9A 4G1FA 2ZQYA 4B4KA 4UTXA 3CVUA 4M87A 5JRDS 3C24A 1PYGA 4QSHA 4O2BA 5F7ZA 2D5IA 2G3YA 2ZI3A 3AZQA 3PGVA 4MKGA 3WV4A 4E15A 4N41A 6NULA 3SD7A 5DNWA 1OJLA 1E2EA 2BM9A 1GWNA 4B2IA 1GOTA 2VYCA 3OEWA 1EX6A 3LK7A 1VG1A 1W73A 1KO1A 4YEDA 1VE6A 1YB3A 1ZIXA 1JFLA 5B7QA 5FQNA 1PK8A 4KOEC 2Q5QA 5IU6A 1TTQB 5E7QA 4K0KB 3B48A 4II7A 1HETA 1CVLA 4P73C 2ZTVA 2QRPA 2ZTLA 4HS4A 4MV8A 3G79A 4JDUA 3WB0A 3NM5A 4S12A 4ZO9A 2J3EA 2EBWA 5BNFA 2Q9AA 4PNZA 1BHJA 2XOKD 2TYSB 3G17A 4BZWA 3Q7RA 3O4VA 3GFVA 4J6FA 4NRDA 3RQSA 5A3JA 2GX6A 4TM8A 3KLMX 1J8QA 3M8KA 1DRKA 4QXAA 4PN3A 2VJKA 5EOVA 3SKVA 1GZ6A 2NN3C 3LVRE 4OHCA 4PSDA 4RVSA 4UARA 4KNYA 4LOJA 4JQSA 2NQTA 1NPDA 1ADYA 2O7NA 1XFAA 3QJYA 4G67A 4XQ0A 2HJWA 1ZDMA 1CE8A 2WAXA 1PFWA 1QHXA 3K72B 5KYUA 1EXVA 3T3OA 1O9HA 3N07A 3NTLA 1RT9A 3BL5A 2R1TB 3O8OB 1YVRA 1E2DA 2DULA 2FWPA 3GUUA 2RK3A 3L7JA 1UXKA 2PTGA 1F1JA 1PHRA 4H17A 3NUQA 1XKTA 2Q7OE 4HLUC 3R7AA 1B70B 3C43A 5IAOA 2XCRB 1EQ2A 1QO9A 5CHYA 3UMGA 3ZLTA 2OTCA 2WQZA 2QLNA 4MYHA 1GPJA 3PGLA 3RK4A 2VCHA 4HQ0A 1JVBA 3MUFA 2IUUA 1RLUA 4EJSB 3UJCA 4AY6A 3EVTA 4D9KA 2ZR8A 4GE3A 4D9NA 2UYQA 1H1LA 3C6KA 3QNWA 3CUUA 3F8SA 3INNA 5ECWA 1FUIA 1U3FA 2JIQA 2Q6VA 2ZPTX 3NBKA 3MZ0A 4IIVA 3FH0A 5JDCC 3TW8B 1DKPA 3UFBA 5LUAA 2AMJA 4MO2A 2H08A 4Y9UA 1QR6A 1T4GA 1QH8B 1D4ZA 2R6JA 4JU9A 1W2HA 3Q2OA 1SQ5A 2NVWA 2QUZA 2OZLB 3AEKA 2GK7A 1G8SA 2C0PA 3DTNA 1UDAA 2ZBDA 3CZ9A 3O9VA 1Y8QB 3TPFA 1FXWA 3VPDA 4RKRA 1RIFA 3TBFA 4JMLA 4FJ1A 2RHQB 5KPDA 1T3SA 1RNLA 1TLLA 4GX0A 3KHSA 4I55B 3PHBE 4R2WA 5LFAA 5DT9A 4KXUA 1H2HA 3T7DA 1F7UA 7YASA 2PAAA 2XI4A 2BM8A 3P0FA 1SCJA 1UBSB 2HJVA 1E8NA 3HCEA 4KVAA 4YHHB 2F8TA 4K87A 5AH0A 1E0KA 4PFJA 1U4OA 3PCRB 5JCOA 2PTHA 4AUMA 1IMJA 2XWQA 2CLHB 4IZIA 1DFHA 2CLCX 2XLCA 1PWEA 1OJ7A 3Q88A 2V8OA 4JSRA 1N0WA 5ALDA 3CIFA 4RZIA 2R62A 3LDFA 4U7GA 1Y0BA 4GMFA 3KKMA 1R3UA 3M4XA 1CY2A 2J4FA 2I6GA 2XADA 2XQVA 1GL9B 1T2FA 3DZJA 4FSDA 5A7FA 1J70A 4XLLA 2DEQA 3VFDA 1U2QA 2CV0A 4Q3BA 1DUVG 3MFQA 4C29A 4M0PA 1M6WA 2IZ0A 2VNKA 4LFAB 1FP1D 1KMIY 4H02A 1PGJA 3NDIA 2B5WA 2CKMA 1U0HC 3PI6A 3AEZA 4ZCSA 3L4EA 4CKWB 5IK2D 4MLDA 2ZW9A 2YASA 3CISA 4AYWA 4DOMA 3EAFA 3AEQA 3M89A 1V2HE 1WD7A 3HVIA 1E1QD 1IOVA 3OLYA 4ZEMA 3N0VA 1Y98A 2ZROA 4XTWA 1IPEA 1V1MB 3PKJA 4H0NA 1B4DA 4RACA 4F06A 1DAIA 2CGHA 1EHCA 2A0XA 2XTAA 2QNIA 3IJPA 4ZD6A 4OBXA 2Q5OA 4MHSA 4C2BA 1JPVA 1R5BA 1U4NA 4X61A 2ADFA 2WTEA 1WX1A 1XQYA 1UWCA 2XJ4A 4LZPA 2CLIB 3BMNA 3ZW7A 4CM9A 2ZREA 4DLBA 3O75A 3RC9A 1MQ9A 5EP2A 1S3IA 2OBMA 5TARA 3WI7A 2BEWA 2ZBPA 3MUOA 1E99A 3ONDA 5I7EA 3UTCA 4XXHA 1NYQA 2FZKA 4NU5A 4F3NA 4ALJA 4KGVA 1HT3A 5C8VA 3ZGLA 5SICE 1U0EA 2IZ6A 3AETA 3VDRA 1WQWA 1EYZA 2DFNA 1PYOA 2IS6A 4WI1A 1OAOA 3LCMA 4DBZA 4PS0A 4FQ7A 5AW9A 1VLQA 4QKQA 1MO5A 4JLAA 1OTXA 1VL6A 1WUHS 3MF4A 3AB7A 3NTQA 3OZTA 3UO8B 1CTQA 1OW3B 2EP5A 2VCEA 3FFTA 2YWEA 3T5DA 2JLUA 2DZCA 4DPKA 3P32A 1Y37A 3M6FA 4D74A 5F23A 1TCUA 4H7FA 4LRQA 1XU9A 2ZJOA 1SXIA 2C7VA 5KX5F 2R8BA 2WOJA 1CF9A 1ODJA 5KYYA 1FP4B 5IT9A 3TJRA 4XD2A 1N2CE 1H4TA 3DR5A 3CF4G 3F9RA 3HU2A 5IMBA 3COVA 3WDKA 1NJ5A 4KCGA 1XWWA 2IUTA 4OQXA 5DGTA 4BNUA 3UK2A 3W5VA 4U02A 5EGNA 4FFMA 5L53A 4ZOBA 1DX4A 1N77A 3AUAA 4O33A 1QS0B 1A98A 3OM9A 2EWVA 4BTLA 1EWRA 5KTKA 3LXMA 3PDHA 2ARTA 2HHAA 3OFND 4BBPA 3VKUA 3I5AA 5EXXA 2YYAA 5EUCA 5EHGA 3WK5A 4WNIA 5C3UA 2R68A 3SVLA 1YI1A 2XB6A 3FDIA 5KZMB 4JY7A 5LQAA 1DDOA 3A6PC 4R0NA 4HK4A 1M1NA 4KJZA 3RSZA 2VH5R 2ZQ5A 3NYQA 4BJ1A 2X8JA 1X74A 3RT7A 2P1RA 2VF8A 2QUJA 3K8OE 4OQMA 4YREA 4P80A 4RV9A 1B15A 2IV7A 1ODLA 2VUHB 1RW4A 2PA0A 2CDRA 2UKDA 4HH4A 2VT7A 2AZDA 3GUCA 4LRUA 2FFBA 4RZUA 1LSOA 4GEGA 1RSZA 1JLHA 3N2KB 4H60A 3T7SA 2BFWA 4MQ5A 4O1MA 1W36D 3KR1A 5KSWB 4Y2TA 1AQIA 1EFLA 1M76A 1NJ8A 1SHZA 2RJNA 4MMZB 4PQEA 3TQHA 4D3ZA 5LKRA 4GSYA 5HW0A 1PLJA 2VQSA 4RKFA 4DJFC 4F4FA 2XCTB 3NKFA 2VDVE 3GMTA 4ND7A 3LMKA 2QTNA 2JGDA 5CT4A 5AOAA 1YWGO 2J3MA 1B26A 1ZJZA 1GLVA 3RFUA 1DAGA 1LBIA 3ZK9A 1WZCA 3IUSA 1T8UA 3B5JA 4D46A 3KOOA 1MEJA 4ENPA 1RWKA 3HV2A 3NVMB 3DAYA 4NNPA 2VG8A 3UAZA 2G5GX 3KWLA 3P0IA 3EQ6A 4QGAA 1LX7A 5I7AA 4C89A 4BMPB 1AUVA 5ICSA 3WMEA 4EA6A 3R3WA 4H1UA 1Q0RA 2EW1A 5CVEA 4E14A 2RH4A 3HVJA 4KI0A 3I5XA 1NPTO 1BWPA 1ZZGA 3BRQA 4P72A 5LNK6 4AL4A 4BLWA 2XE6A 3FOAA 4HO1X 2C20A 4RO0A 4UMDA 3B5EA 3VQTA 1GU0A 1B23P 1E6WA 4LE0A 1E2UA 3GH3A 3E9YA 4IXTA 3WLHA 5MN6A 2G72A 1EM6A 1R8SA 2BM0A 1HF3A 2PIAA 1PW5A 3GL9A 4JUFA 5EIBD 4MWZA 3W5DA 4PNHA 1Z15A 1ISJA 5T5QA 2H1HA 1BRTA 1H05A 3RM3A 4E31A 3H1PA 2RIPA 3EOZA 3K70D 4ETNA 3UJ9A 1FQWA 1NRXA 4BP8A 1JBKA 2YZGA 2C9YA 5AVXA 4ZAZA 3MXOA 1V9CA 3ENVA 3OQ6A 5AHWA 2FXIA 5BMOA 3EXFA 4WZAB 1DV1A 4PC3A 4PLGA 2Q5HA 4BV2A 3OEED 1CY8A 1GPDG 4F3KA 4KFRA 1DQNA 3NC4A 3PX2A 1ID8A 3SSMA 3U6KA 3MYRA 3ICWA 1GGVA 1PZFA 2PR7A 3F97A 4LXXA 2GVDC 1JEQB 3SY8A 3IQHX 3SLGA 4YLEA 4E3WA 3N58A 5JE8A 4TSKA 4BRZA 4O2AF 4AC9A 3AYZB 3SEZA 3V4RA 3BM5A 3IR5A 2VN8A 1VYVA 3Q8LA 3I1IA 5HK9A 2IHZA 3D6UA 3FNIA 3NJ4A 5FJIA 3LF1A 3AI7A 4UUNA 3WQQA 4CQJA 2KLBA 3SX2A 2JFGA 5ALNA 2JFFA 2PKQO 2O8FB 1W85B 1Y34E 1QPGA 2NNWB 7REQA 4ARBA 8ABPA 2FMIA 4D9HA 1F8XA 5EQTA 4LTDA 1JHRA 4NBKA 4Y9RA 3WLNA 3TN7A 1ZC4A 4X54A 2FN4A 3VISA 1ECBA 1RP7A 2XGTA 4WZBB 1GPLA 2ZT7A 1U9IA 2DPXA 2J9GA 1TF2A 1USVA 2R60A 2XNKA 3GC6A 3U2QA 3CC8A 1AMNA 4AKIA 1YJ8A 4LDNA 2AG0A 5T4BA 1MVNA 3KQOA 3GRRA 1YKGA 2OA0A 3ZHZA 2ACKA 3I9MA 2HRCA 3QVOA 2NGRA 4Q93A 5TVGA 4MW5A 1GT6A 2F3UA 1TA0A 2ZK7A 4L3WA 3VNAA 1U7HA 1BDIA 2QTVA 1IULA 3ETNA 3H1FA 4EG0A 4ALIA 3DQZA 4G0VA 4KO2S 2JZCA 3TWOA 2QRKA 4TVOA 4FN4A 3U60B 4G4GA 2ID9A 2UYHA 5A3VA 4HT4A 2BBOA 2QZJA 5A3SA 3HGTA 1U2DC 3THWA 2QTAA 1ML4A 1H2YA 3BXPA 2XCOA 5IJ0B 1LDEA 3DT8A 9LDBA 4FKBA 1GL7A 1Z06A 1RLMA 3RKYA 2O4UX 3F6RA 1QOPB 2IDJA 3U3JA 1X1RA 3EVCA 3LUGA 1XZNA 3V8MA 4NZYA 4KXWA 1XA3A 2X9VA 1LFAA 2VK1A 4ALKA 2KS6A 2O8DB 4NKRA 5FTKA 3I2HA 1I24A 2D5BA 2FXVA 3S68A 2MSNA 4PHCA 1RYDA 2PKWA 1B2LA 3FRIA 3Q7TA 1ZNXA 2ZJ1A 4M0UA 4DAEA 2WTXA 1WUJS 4BMZA 5BSUA 5K0EA 3IQIX 4RH0A 1E62A 2W2PA 4NZNA 4EAQA 2XECA 2JIBA 4HZGA 4JBWA 1RPNA 5H1YA 1SBHA 2ZI7A 1CLUA 3RIRA 1T0JB 2OAGA 3Q5GA 4BJ3A 1A5BB 4FMCF 4L5BA 4RFSA 1RPJA 4NMWA 3W90A 4B3TB 4M88A 2VUIB 5K2MA 2Q6OA 3DBLA 4RS4A 3TVTA 3EGIA 5KNBD 2GILA 1V3TA 4HNAB 5AXBA 1X39A 2O5CA 1VG0B 3CMMA 4BL5A 4D9MA 1IEQA 2VAPA 3FDZA 3VMMA 2FPGB 1I4TD 3O95A 5HF8A 2X5JO 3P2IA 2QLLA 3DKPA 3IQWA 3P2KA 4QPZA 4RHFA 2OFPA 2C2OA 3H83A 3HKEB 1N2XA 2A0KA 2Z2JA 2XXJA 1VMIA 3L84A 1GD1O 4INZA 4WESA 4WFIA 4BMCA 1VI2A 1JG2A 4JP3A 3AF4A 4TKVB 3R8FA 1Z75A 2CVOA 5GVRA 1P7VA 2IL1A 4BJ6A 4BRWA 2JARA 2WT9A 1BS2A 2XZPA 4A27A 4F1WA 3I92A 5KYNA 1A8SA 2ZWPA 4LHVA 2C3MA 4CH5A 1KPGA 2BSAA 3EMKA 4F96A 1OVGA 2P90A 5LN1A 2BP7B 4DCCA 2OYSA 2WTNA 5H82A 3TTTA 1A1VA 1EI9A 2EG5A 5IRCD 4F7DA 1E5LA 1GGEA 2QV0A 2Z6VA 4Y9DA 4MUMA 1SC6A 2UXCB 3LXRA 3BFVA 1IM5A 3LOQA 4LI0A 3LU1A 3QJGA 4PZZA 5F9MA 3A5ZA 3CNEA 5K3SA 1OXKB 1NXXA 3GZNA 2M6KA 3T3GA 3TLBA 3TUJC 2B4YA 4BS9A 1Y7IA 4DW8A 5LB4A 1XVUA 3R74A 4E88A 3BE6A 1RC1A 1IL0A 1RZRD 1K4YA 4OL0A 4CEHA 1NSYA 5A5GA 5FDFA 1K5GA 2A0FA 2ZYWX 2Q5CA 3BMCB 3GDHA 4L9AA 4QYIB 3HXTA 4PSCA 2CHGA 1SXJC 2G80A 3I9V6 3P27A 4FYKA 5J4VA 3DV2A 4JI8B 4NCAA 4UEQA 3T7TA 1A5TA 1NRJB 1P77A 1G6KA 2BFDB 1XD2B 4RGVA 1SRQA 4RK4A 1CETA 1JG1A 1L7MA 2ZWAA 1T26A 3NPAA 3PRKE 5GIOE 4UP7A 3B70A 4ZI3A 1N2SA 3H1EA 4B45A 3C74A 3K9WA 1RS0A 5AUNB 1HRKA 4Y1EA 3FPEA 2FPMA 3MERA 3RYCA 5BW6B 4MVJM 4QUIA 1WHSB 3RJMA 1BD4A 3OM0A 1V7QA 3H19A 4DT1A 4KMMA 1NDUA 2WINI 4P7KA 3DQQA 3LY8A 4BO2A 3OTWA 1X2GA 2P67A 4KE6A 1JHZA 5LA6B 1K7CA 2HWXA 1ESNA 4MVJI 1ZGBA 1L3BA 3DHNA 2PUGA 1J56A 1TRKA 2Q2QA 5LZ2A 1X55A 1EFDN 1OFHA 2LD4A 2E89A 1VCOA 4G4IA 4A82A 2VYFA 4I08A 3ESRA 3MSCA 1C9NA 1BYIA 1A97A 1FX1A 1IVNA 5K8LA 4F4DA 2WYOA 1YXMA 5I7VA 3I62A 1H6AA 3ZDEA 3W7AA 3KRTA 4HFRA 4PC6A 2E48A 3D3QA 3OVMA 4MITA 3U0VA 4MDYA 4DMLA 4DIMA 4Q1DA 1VQZA 2JAXA 3NIFB 3D8NA 3SKXA 3FPCA 3BL6A 4GX5A 2MCFA 1NVKA 5KS2A 3WAGA 1TJNA 4ZGWA 1M2VB 2G5PA 2M6LA 3O8CA 2VUSA 1JF8A 2WU3A 4MUHA 4KWTA 3RFXA 5KU1A 1YZFA 1BX1A 1M34E 3VX4A 4FFVA 1HYBA 1ZCJA 2Z2ZA 2N0SA 4L9RA 2H59A 4M8NE 4OJQA 4CVNA 3ZCSA 1ZN2A 1JYFA 2FPKA 3L0PA 4TTIA 1N2CA 4G1VA 5JCXA 4D02A 1Z6YA 4UBNA 4X44A 2FR8A 1TFUA 1I1QB 2OXEA 3HJHA 4FBGA 4FS8A 2XT6A 2FF5A 2YOGA 2BKEA 2CVFA 3G8AA 2O1SA 1ZRHA 1XKXA 3QYPA 2B5OA 3EH1A 3IUQA 1VYUA 3TRJA 1SURA 1ISFA 3R5SA 1UBOS 4H4EA 3BTVA 1XZKA 4WKNA 4YAWA 4C01A 3LPMA 3UJDA 5KUTA 1N92A 3K0FA 3AUSA 4LA4A 1GTSA 3FPSA 5H9VA 1OXBB 1SXGA 1JU9A 4H2XA 3G8DA 3DZHA 3KPJA 4OSEA 1EQUA 3H3FA 4DBLC 1FF9A 1QOQB 1REQA 2CHFA 2DYKA 1Y6RA 1A7KA 4E5PA 5KTPA 1L1EA 4KNWA 4IEFB 1FFHA 1PFYA 1ECPA 1RAIA 3ZLUA 2DHQA 2GYVA 1TK3A 2Y92A 3OPMA 1P2DA 2JKYA 4M9RA 1Z0SA 1ZA1A 3CKLA 3H5TA 1N4AA 4U2CA 4QZVA 5L3VA 1U1IA 1E1OA 4JMPA 1AS3A 5EJAA 3FWYA 2W4MA 1E2HA 4JB0A 1SPXA 2ZTUA 3DJFA 1JJ7A 3KQQA 4WCFA 1TZJA 5JYCA 1MX5A 4DSAA 1DKQA 5IM4A 3TINA 1Z37A 4DC9A 4XYLA 4RADA 2QN8A 4FNGA 4EW3A 4ZYTA 2YV2A 4DG5A 5KJ1A 3UA3A 3ZGVA 1KDZA 1KI3A 4YJKA 2X9NA 4M1YA 3V2IA 4HAVA 1IHOA 3HZRA 4Y2HA 4YY3B 3I61A 2Z5FA 5D2CA 4DB4A 3RODA 2AC7A 2YWRA 3BDVA 1GTG1 4NCKA 3TLAA 1ZMTA 3NHPA 5FNVB 2JGLA 3WFJA 4F04A 1WCIB 5B57C 5CDUA 1NZJA 2VQDA 2WD9A 4GI7A 4XUCA 1NLFA 4DSNA 2D2VA 1AF4A 1N2HA 1I1OA 1ZJWA 1Y8RA 1MEOA 4FEEA 2OGWA 3IHTA 3QOFA 2GWHA 1MMFB 1J99A 3DO8A 3OTIA 4OHRA 4TLMB 2DQZA 2L42A 4YFVA 1S2MA 4XX1A 2NSHA 2EZTA 2C7OA 3QVUA 5EYPA 4TVSA 3PLAE 1ZGAA 1IN6A 2C9BA 5B6JA 1OZAA 5MDHA 3R7NA 1P2VA 3C39A 4RHTA 1WYDA 5G4LA 3VZPA 2AD1A 1EGMB 2Q49A 1RMQA 4UFPA 5JY6A 2IF0A 1UIMA 3IA2A 2C3YA 3N8IA 1UJ2A 3VYWA 3GV0A 1NC3A 4DR7B 1MAHA 4JITA 1HOTA 1MGOA 2V96A 2HQBA 3LIPA 1ZK1A 4LRWA 4HLCA 3STHA 1QONA 1M0TA 4KMRA 4EKYA 2IP4A 1X7YB 3DVSX 2P2CA 1GVNB 3O8DA 1U3WA 1FFEA 3D1LA 2OKGA 2ZS8A 4JV5B 1Y1QA 1YFZA 4GWLA 4GMKA 2O5EA 4I4IA 3HVKA 3WBJA 2ZBRA 4EUSA 4F5EA 5A6SA 4YQEA 3KLOA 2XIQA 3Q41A 3J80A 2V9PA 5L7YA 3RADC 3WL4A 3ZJUA 3UOWA 1WZEA 1D1PA 3D5TA 1RXEA 2QIPA 1MF7A 2AH5A 4FWTA 5KTTA 4E03A 3Q9LA 5IASA 3FBGA 2B2CA 2VZEA 5SZHB 1FL9A 3A2MA 1IJBA 1RWVA 4R8SA 2QG6A 4C0HA 1OH6A 3UWPA 4H7JA 2OHIA 1NBHA 3AHJA 3PQ6A 4M54A 1O5IA 1BOOA 2DUJA 3R0XA 5JS7A 1SXHA 3LFTA 1H1DA 3HV0A 1TKCA 2X13A 1Q91A 2JEOA 3GCDA 2FPLA 3N28A 5FFNA 2BUCA 2IXTA 4CR6A 2B94A 3DUWA 1TJ3A 3V6MA 2V9CA 5DF1A 2QD4A 3L1VA 4NMMA 2RHLA 1L7VC 4PPGA 3AZOA 2DTDA 2WK1A 3L8ZA 4MLCA 3W06A 5JWRA 1GLGA 1RU3A 1W8IA 1OIVA 2EDCA 2MR6A 2PX0A 3HR7A 3P71T 1T43A 3HWSA 1Z6PA 4MS4A 2B4TO 3VR2A 2AJCA 1CVRA 2P65A 5LOVB 3I83A 4QEZA 4JJEA 1ZQ1A 5JXGA 1CULC 1D2MA 5JFGA 1J0BA 1KDOA 1YOBA 4IGKA 4IHAA 5AJXA 2JKZA 4NZMA 3JPYA 4IAOA 5GJBA 1K9VF 4HQRA 3RVKA 4JGGA 1R9NA 4KGDA 4U7TB 4Q00A 4ZAFA 3PGXA 2O2CA 2QPAA 3IOEA 4MAAA 1QU3A 1WCXA 4MI1A 1IWOA 3E53A 3X1XA 3UAGA 4LISA 5BURA 3VBCA 2GBIA 3PTLA 1BX0A 3ET5A 1HUQA 2I4NA 3C7KA 5B37A 1N5LA 3PPIA 1AGXA 1L5LA 4OHVA 1KP2A 5AMXA 2WZQA 3KT8A 2KLHA 4M83A 3WQRA 3AIOA 3HCAA 3V00A 1MB2A 3ZTWA 4K03A 1JR2A 3FIUA 3PUHA 3EXG1 1PV4A 3DFZA 3RS9A 2QM0A 3VR4A 1GUBA 5FWYA 3HWWA 4C14A 4YAUA 3GB9A 2HM7A 2OAQ1 5CVDA 3D1JA 2VT6A 5DYGA 4AZWA 3KJGA 5TB5A 3DOCA 2PUAA 1NF9A 4NFSA 3VJKA 2JGEA 2I6UA 4NICA 3R77A 1BMFD 1IY0A 1FZQA 2RGDA 3CLVA 1TNDA 4JVOA 1BFUA 2KW5A 2ZYUX 4LW8A 4WOPA 1WXFA 1I0ZA 4IHKA 1JQKA 3D3EA 2GEBA 2JGJA 1FUUA 3IR6A 4HXYA 4YJ2F 4Z9YA 2PJUA 3N53A 1TTTA 4AKGA 5B2FA 1MVLA 3V1LA 1PFUA 1TUBA 2JLCA 3Q40A 4O2BB 1W52X 4CRWB 4J15A 2E55A 4UNRA 1EE2A 1B93A 3ICVA 5JNRA 4LTNA 1QVRA 1HZZA 2RIRA 3K53A 4OHKA 1GTJ1 1W4ZA 2FSIA 2O19A 1YVPA 2IXDA 2CVZA 1QCYA 4UVHA 4H1WA 3RC3A 2IU3A 3BFPA 1Q92A 2JFUA 2OPHA 4EHKA 2ZWVA 4IF4A 3CH4B 1TA4A 1K66A 2PLWA 3C98A 1Z6GA 1C1XB 3LGAA 2H4WA 1MO6A 4OB6A 5DPMA 4PGGA 4XFKA 3NHAA 3LF2A 3HMQA 3CEHA 3EWAA 3DW1X 3LHIA 2XT0A 3RIMA 1ILWA 1ZFNA 1E0DA 2C5FA 3G1WA 1U8EA 5A7HA 2H0RA 2I76A 1PQYA 3KLNA 4QJIA 1SZDA 3O93A 2JBAA 5G2OA 2Y66A 4D45A 1M9NA 2C4HA 3D8SA 3E58A 4JQYA 3UMJA 2HEIA 1UXOA 4EYSA 1JVSA 1MAWA 1R0CA 4N65A 4J3NA 5IKMA 3AK4A 3CLUC 5EE3A 3AP1A 3OJCA 1FSZA 3QF4A 1UOPA 1JFRA 2C03A 2W6OA 1T4CA 1EVJA 2DPMA 4NZPA 1OYYA 4P84A 3W4KA 5KYUB 2QRLA 4GDFA 4EY8A 1YJXA 3MJEA 3LG2A 5BN3B 1GAWA 1GITA 4DR1B 4TVWA 3M6LA 5TF4A 1NXQA 4DRXA 1CG6A 4C4XA 1AX9A 2KX7A 3ER9A 4V39A 4IYRA 3ZUGA 2AC2A 2GDJA 3EXEB 2GO7A 3G2KA 5FD8A 2E64A 5J4KA 1YK0A 1S1CA 1G20A 2IUSA 3FSGA 2AEFA 3HGQA 3OIWA 4QQRA 5A05A 4DM3A 4W5NA 3M4NA 4N9WA 2I6QA 1EE9A 2NXEA 1PJ4A 2GPBA 4PG7A 4LOIA 3BJUA 3REUA 2ZIEA 4QXRA 2FK7A 4L3OA 3KAJA 1H1LB 2IPNA 3AW8A 3LECA 3COYA 4LY0A 1E2IA 4LIPD 3TTVA 1Q1QA 3O1LA 5BSVA 4WJ3M 4F86A 5LWQA 2GD0A 3MJ4A 2REXB 5DBOA 1P5JA 3EEOA 2HDNB 7MHTA 3SKYA 3FZNA 1CY7A 4YHBA 4J03A 4GM1A 4N5MA 3KQNA 4ZRDA 3WRWA 1AKEA 4OP3A 4BWGA 4EUKA 4NEQA 2WJIA 3T1HB 3FHTA 2A9KA 4OEHA 2H2DA 1WPQA 4PXAA 5HDBB 5D3KA 1C29B 2J7PA 4WXPA 4BC0A 1ND6A 1V41E 1US8A 2QLTA 3GUHA 3MHPA 5AQEA 1XMSA 2RH5A 2P2ZA 4UDYX 4REOA 3OJFA 3A2KA 1RD4A 2A14A 3AH8A 3IAS6 4QTUB 1JNYA 1J8YF 3QX9A 1E7MA 2YIJA 4PWZA 4XYMA 3Q6MA 5LDGA 3I9FA 4GP9A 1M34A 1CIJA 1J1IA 1M5UA 5KVAA 2MINA 4QUDA 3LDAA 2FWIA 5DTRA 3WL5A 3EG9A 3S8EA 3G0HA 1LV7A 4BLPA 1F0NA 4MB2A 3HY6A 2VTKA 3HFZB 3TMKA 5IKEA 2KE5A 3QLTA 2IEGA 2W71A 1ABBA 3ABIA 2XV1A 4EENA 1SQ6A 2X8LA 3BJZA 3S99A 3GGPA 5D1NA 1G8JA 1W0JA 5CCEA 3PXAA 1S2IA 1RIIA 2FW6A 4F92B 3O94A 4TV9F 1EP9A 3F9CA 4F2PA 3GAFA 3LY9A 4XEMA 1NHGA 4J90A 3RYFB 4CHGA 4QU5A 1AURA 3UHAA 5JNLA 4MVXA 1BBWA 3KEOA 4KXFB 4Z7OB 2PVPA 4IGEA 2OO3A 4ZICA 5JTUA 3KZOA 4NU6A 3WRYC 1SVWA 3PUYA 4HDAA 3RYTC 3KQKA 1NG1A 1GQYA 3QLEA 2PBRA 2H5EA 2JH9A 1K9SA 1TEZA 1DBRA 1P0MA 1QHIA 2ZBFA 3HM9A 1AHHA 2PNJA 1DQRA 2YBEA 3AEQB 4L27A 4YP9A 1S3FA 4Y2JA 3RU9A 3TSCA 4E11A 4TVBA 2XE8A 5AM3A 4OUDA 4LX8A 4OF4A 1DWQA 1R5OA 1QG6A 3I53A 2W2KA 4P73A 5CLFA 1HDYA 2AB0A 2AJBA 3RVJA 1E1DA 4YH1A 4KGXA 2QXTA 3EARA 1IYZA 2C9ZA 2NZ8A 1Y80A 1Q1ZA 3KYIB 3BMNB 1TUIA 3H18A 4HDRB 5F5WA 1PR9A 4MHOA 3EYWA 5E2AA 4QFBA 4N7BA 4AULA 3L8GA 1BE8A 1E2GA 3SWWA 3N2NA 1EG2A 5J43A 2BEWB 3VU1A 3D4LA 3CR7A 4TVYA 4REQA 3AETB 3E2MA 5BQXA 1NFFA 4OHOA 3GEPA 5EWMB 2G9NA 2WZDA 4R9VA 2C84A 4FI3C 4WY2A 4AKEA 1G18A 1NXSA 2FK8A 2J6CA 4GWKA 4KK3A 4Y3UA 5ECDA 1G7CA 1DS6A 5TQ0B 2XBLA 3VTFA 2X4GA 3UANA 2E3JA 3AF0A 4D1YA 2NUAB 3RF6A 3OZUA 4CMAA 2R3SA 4MB0A 5TY0A 4HLUA 1O95D 3U9LA 1H8HA 2UVQA 3MGCA 3QP9A 4M0LA 1QFMA 1GY8A 1GNPA 1MRNA 3DYVA 1CUCA 4PC2A 5BSFA 3WE7A 3RS7A 1STOA 2FOIA 3Q9UA 5FPKA 4IH4A 5E9WA 4BWVA 3GGSA 2CXUA 3HZZA 4G41A 3H1GA 3TG8A 4MMXB 1MC8A 4C4TA 1KERA 4MTLA 1E9VA 3VI4B 1U7DA 2IQ5A 5JDCA 5K03A 4H1TA 2IYTA 3H84A 4A2QA 4PX2A 4NEGA 2VOEA 4ZN6A 3CZAA 2WFLB 3QXSA 2XNDA 2AN1A 4RIEA 3S7ZA 2HMAA 3IMCA 2FMXA 4LYFA 3TBKA 1Z2CA 1I32A 2GAFA 3H42B 2XMCA 1OVMA 4PXSA 4V38A 4XOUA 4G8CA 2W58A 2XW6A 1QFXA 2AKAB 3MSXA 3CBGA 3OMWA 1M1NB 4XIYA 3B9QA 2EL9A 4G1EB 2Z2YA 3LH5A 1G291 3B3GA 4HQLA 3OLXA 2VDPB 3E15A 3N0WA 3VSCA 1GSHA 2A9VA 1FFGA 3F49S 4OO3A 2VT3A 5TPWB 3AHHA 1ZD9A 2O7QA 1PZHA 3TB6A 3ZWVA 4C4RA 5KNCA 4BQSA 4HDOB 3U13A 4FXOA 3IDFA 2BTQA 1SHTX 4F0JA 1XFDA 4CEHB 2CBZA 1H2BA 3TW4A 2EBFX 2PGAA 3HDTA 2HLHA 2P75A 2DKFA 4KHPB 1OB2A 1NBAA 2ZB8A 5REQA 2PRSA 3TFOA 5FX2A 4JUDX 4NEHB 1XTPA 7ADHA 1P9OA 2JCGA 4M0DA 2XQKA 1Z6QA 1JJFA 1SHKA 1SXJE 4H2YA 1NVGA 1UC9A 1QHYA 1C5KA 1N5IA 1NF2A 1CF2O 2SNIE 1CB7A 4U6NA 5TQ2A 1XQ9A 1E0AA 4Q03A 3PDWA 1XVTA 3FYCA 3DMPA 1DE0A 1AK1A 1GPH1 1Z25A 1YSCA 2WEKA 1USYC 3FWPA 4HQFA 1CUYA 4WBNF 1IZ0A 1T2AA 4E2XA 1ZXLA 1SXQA 2IH5A 3L7YA 3QYJA 3V1MA 1UKBA 4M38A 4YA6A 4MS1A 4L57A 4MW9A 2X76A 3L7DA 1JJBA 4U2BA 3WYCA 4KFUA 4JLOA 5ELOA 2Y0PA 2ICAA 1CQJB 4TTSA 5ESWA 2LZ0A 2VJBA 4OCZA 5ITWA 3HLKA 4TYMA 2YWFA 4MNTA 3ST7A 4W5QA 5ELLA 1XJWA 4C04A 1AY0A 2WJGA 5D3MA 1GHTA 1YZVA 3QELA 5LMNB 4HN4B 4BEWA 2YUTA 4LDQA 1P7CA 5DULA 4DV7B 4KHZA 1KDYA 4XLZA 4Z1OA 2JCSA 1E1RA 5LBIA 5EFZA 3WC4A 2CB9A 2PBFA 3LUAA 4RTOA 4Z4GA 4URWR 4LAFA 3WWEA 1FNSA 3NASA 4CQNA 3S8MA 1QQTA 5KEIA 4GUDA 5ICCA 1LVHA 4RBNA 2X1HA 3FRJA 3P19A 1A9OA 1V1JA 5AK5A 4MYSA 3KAQA 4MPPA 1JXAA 3L7AA 4Y2VA 1XJ5A 5LWHA 3JQRA 5TGTA 4P3YA 2ECOA 1XN4A 3C3JA 4W9MC 1E3LA 2NNLD 2E4AA 3ENQA 3LT2A 1I4OA 1P4RA 2P77A 1HFJA 3SFVA 4KOAA 1Y4SA 2GF0A 4F3RA 1FUKA 1P6UA 1Z2OX 2NSYA 4DKXA 4XWOA 2WWTA 1EFTA 2VHQA 4JJGA 4MB6A 2RB5A 1YJAA 4AD8A 1XL0A 1ZVQA 2ZR2A 3HB7A 7REQB 1Q19A 3AIIA 5JQGF 4X97A 3PC6A 1NIJA 2D1RA 1USGA 3ZGXA 5IVPA 5EA2A 1DO8A 4W8HA 1PFKA 2ZT8A 1JDBC 1F8GA 3FHOA 3ISJA 4IWYA 4RGBA 4RVCA 1BW9B 5LP6B 1T8PA 5F1OA 2YWDA 4P82A 5ENZA 1YR3A 3HYRA 4IH1A 4O4JB 2FN8A 4LECA 1GFZA 4B75A 2VKTA 4DBLE 1UJ5A 2Z1MA 4EFMA 1ZM7A 4RM2A 2JASA 2REBA 1BVRA 1QZXA 3JW8A 3ZGNA 4D3YA 5JSYA 2JJQA 5DTIA 1SZCA 4WXHA 2ZRFA 3GRAA 4M0MA 1IFXA 4QBHA 5EWLB 2ZR3A 5BOSB 3OZEA 3STUA 2JLWA 2GYWA 2RHSA 1C3EA 1LLDA 1G9SA 3VC2A 3KQUA 4QAJA 5THKA 3FUVA 3L82B 1FMTA 3W0LB 3W9UA 4ZPXA 4AZ3A 5DW0A 3VNVA 1JHUA 2IDMA 4C43A 1DBWA 5DZSA 1VKHA 2VPXA 1ZA2A 1KU6A 4OD0A 3RWBA 4LGMA 4EEZA 1ISRA 3F4BA 5CCBA 4TL9A 121PA 4HWKA 4IDFA 3PNQA 4G24A 1HWYA 1KDPA 4PBSA 3EXAA 4PSKA 4JBYA 2X8WA 3RRXA 4OB7A 5MN5A 3AJ8A 1ZI8A 2QR3A 3O2NA 1T2NA 1XF9A 1BU8A 1DAEA 3EA5A 3FPJA 1AZWA 1R2QA 2H7XA 3VR6D 5B2ZA 2Y27A 1E2NA 3FCAA 4YAGA 3LX5A 4H7KA 4PTZA 1ULTA 3K9QO 2WD7A 2AS0A 2AR0A 5KSOA 4GOXA 1Y5NA 2RHTA 3BK1A 5AR1A 5FWNA 5BSKA 3JSXA 5JATA 4D79A 1E58A 1L0BA 3E81A 1SU6A 1CK4A 3UJPA 1KI6A 4F1JA 3V97A 2AJ8A 1Z29A 2FPIA 3DBLB 2PQ2A 4LOLA 4ARIA 2I6TA 3ZY5A 5BW8A 1EUDB 1GU7A 1UPTA 1Y9DA 3BD9A 3EEBA 2XYGA 3BIOA 3O3MB 2IYAA 1ZJ4A 4PYLA 4QO7A 1UK6A 2GCNA 2PRZA 2X0NA 1GA1A 4KYTA 4ETMA 4EK9A 3BOSA 3T4PA 2BFFA 3RS8A 4KRFA 4L5YA 3AVUA 1P19A 2G71A 3H5IA 5HKKD 2IYRA 4C7VA 1Y1KE 2Z83A 4Y1RB 6Q21A 1U1GA 2JF0A 2PZJA 1J5WA 1JQDA 4WESB 4XGKA 1WKCA 3OWOA 4YT8A 2DH5A 2QOEA 1PFGA 1HDEA 2BFCB 4JAVC 1A2BA 4C5BA 5FTMA 5H68A 2QGNA 5J2TF 5J40A 4J9VA 2HU8A 3B6JA 1GG9A 4ZYYA 5FAXA 3JR3A 4WKCA 4D97A 3U4MA 1N5KA 4BPRA 3KKEA 2QTTA 3TLCA 4MUBA 2CMKA 3O8RA 1EFVA 3ZWPA 3M3DA 2H85A 2G6TA 1JG3A 2OZEA 4PZDA 3A8TA 5I7FA 3B1KA 4DANA 5IFKA 4KZPA 2Y1FA 3RIYA 4YCSA 2CWDA 3GZNB 3N2EA 4BXOA 1RBYA 3ONNA 1FYFA 1WWKA 2X1VA 3IEPA 3N76A 1LH0A 5BYAA 1NSTA 3ZS9A 1F4LA 4G5FA 3WV5A 4Q9IA 1C8VB 4HUTA 4ZK2A 2ZZMA 1L9KA 3KEQA 2RBKA 1AHIA 2ZANA 4JJ6A 2PSJA 3RKWA 4GBMA 2APJA 3VVBA 3ZVNA 1YTLA 1KI2A 4G5YA 3WGNA 1DC7A 2YFQA 4WPGA 3INRA 3K0HA 3V8RA 5F35A 1XK6A 1U1EA 2GZ1A 2IJGX 3AINA 2QXYA 1Y3FE 4NK4A 1GG2A 1XK7A 5K8CA 4CM8A 3PHLA 3P94A 1AE1A 3H11A 3H5RA 2YKGA 1T5IA 2HSEA 4DUZB 4FT2A 3F71A 4Y2YA 1EVKA 3UC9A 1V37A 4DMGA 5I9NA 5CR9A 2WIBA 1E9CA 4TX1A 4EA9A 4JT4A 1PQ4A 1VKNA 3ABRB 4ASUA 2J5BA 5I7RA 1E79D 4IHJA 3AOEC 4W5OA 3COJA 3FF4A 2HRQA 3EXHB 2EKBA 5HNKA 3PITA 3S2FA 2HC9A 3HQ4O 3Q87B 3IX7A 3TIFA 4JLBA 2CXNA 4S2UA 1P62B 1PJCA 2ZRGA 4UUMA 4XRRA 1KQPA 4Z4CA 1Q16A 1AUPA 1KO7A 5DV9A 1DEHA 2D4HA 1U2DA 3WOVA 4ND6A 3QPCA 3EIQA 3CR3C 3LCRA 3DDHA 1ZEJA 2PL9A 3D5QA 1KK0A 3N2LA 3MQ4A 4BMDA 1WU7A 4HYTA 2OWDA 5TS2A 4AWBA 5JJ5A 1IN8A 1SVOA 3UZUA 3EUEA 5HCUA 3R6WA 4ZRNA 3HCWA 4QJ3A 3G5AA 4GECA 2IPXA 2Q8PA 5E2BA 3VR3A 2DB3A 3QHQA 3R40A 1T5OA 2IOFA 5GM2A 5IW8A 1FU4A 4ON9A 5CDYA 4P4SA 2RK6A 2SBTA 5ED4A 5DLYA 3FPHA 2ONKA 2DHRA 1H4SA 2JNWA 3MMSA 4LTMA 4Q4DA 3DP9A 5F4BA 2RH9B 4KTTE 3RBAA 4QM7A 1GZ4A 3CW8X 4D8VA 3SJBA 2OZPA 1PT6A 3O2JA 1TU0A 2G1JA 4UTZA 1YA8A 2HK8A 2FX3A 2B7CA 3WXBA 1XYYA 2I2AA 2NSDA 4DIEA 2YJZA 1Q1AA 2BEVB 2KQUA 2OE2A 4A0QA 1DBPA 4DFDA 4MR8B 4OP0A 1T34A 1FNCA 1Z4QA 1T5SA 2ODNA 2UYGA 3G2IA 3G2NA 3MQZA 1CF4A 5JISA 2WVAA 1KZ9A 2JG3A 1O0BA 5F3WB 1RM3A 1VPVA 1YUMA 3WHIA 3WKDA 4ADSG 2GPSA 2R00C 4MIKA 1N6HA 2Q6IA 3BSWA 3H9EO 2NS6A 3LE8A 4ZU1X 2H7CA 3TOVA 1EX1A 5KHOC 1W1IA 3E5RA 2B69A 1CU1A 4FP9A 2MJLA 5T4EA 2IOYA 5T7BA 1Y3IA 4H2XB 3DEJA 1G1AA 1D8TA 3EPRA 2ZXFA 1P3Y1 2VWHA 3B53X 3FCCA 3UJ7A 4E33A 5KQPA 3MS7A 1SNYA 3F3KA 3HU3A 4W6ZA 5ALXA 5GZ3A 4MV7A 4NOKA 5MF6A 2FE4A 4KQJA 1XQ6A 2IHTA 2P9JA 3E0QA 2GJSA 1NI3A 1OT5A 2FZWA 3HEMA 4GG1A 5KU7A 3CMQA 2VYQA 3HJTA 2YYYA 3MGAA 4AY5A 4MVJP 4J8PA 1AA9A 1ZQ9A 2GLXA 2R4QA 5BSGA 1QAOA 2YZMA 1M2HA 3C0KA 5DBEX 5DN6D 1A9XA 3LHDA 4Z86A 3ZQ6A 4C07A 2PUDA 1RCTE 2VNHA 4WCFB 2FFAA 1RAGA 1E9AA 1XCPA 1M1YE 3CRNA 4JB8A 1GYRA 1PE0A 1SERA 1G8FA 2LWIA 4KLCA 5H16A 2HIGA 1EGVB 3DDZX 3EA0A 4OXRA 1JIIA 1JKXA 4KIWA 1LY1A 4E5MA 1FBTA 1WF3A 3VR0A 4IXDA 1SXJA 4I6JA 4MVCA 5CH8A 2VSOA 4XB6B 4TSRA 3B6MA 1UBJS 3L7BA 5JSUA 2X19A 1MORA 4V0KA 3TLMA 1OLOA 3MEQA 5CB0A 1NT2A 2REQA 5DOVA 2CDNA 2AXQA 5FI1B 3X1WA 1KNQA 3K8YA 4H31A 4DXDA 4O5AA 3UUWA 1R6TA 3DCYA 3K0BA 5E3IA 3O38A 4BFLA 1EWQA 1IXSB 1GU1A 4AS3A 3RVPA 1M66A 1IK4A 1DQSA 4EYEA 1J07A 5IWCA 5B3KA 1BH6A 1A9ZA 3NEJA 2WICA 5CNJA 4FYWA 3RS0A 1QTRA 1DDGA 2HCBA 1NHWA 4J0CA 3C41J 4LVUA 3TZCA 1VTKA 4BLQA 2B4AA 4C9BA 3DO6A 1P4GA 3NS7A 4GHWA 4XTCS 5EYPB 1E32A 4BMNA 1APBA 2RD2A 4PG5A 5ALWA 1GQRA 1AC5A 2O1WA 4UVEA 5IJ9A 2C2HA 3LHSA 1DX9A 2G5TA 5IJXA 3GLRA 4P1ZA 4QE3A 3JQDA 3QVGB 5ALKA 2K7FA 2VQEB 4PU0A 1LBTA 3H8SA 2NXNA 1ZD8A 4INPA 2YHIA 4D4LA 3UPDA 4NQZA 3U19A 1W8DA 2DPYA 2QI9F 3K9GA 5KYVA 3AVXA 2AEEA 1L2TA 3DC7A 3L7LA 1CQWA 1KI1A 3P8ZA 4WY5A 1QGED 1GLNA 4LCJA 3UT5B 4I5IA 4ZQIA 5CLIA 1F17A 2Y1XA 4ND1A 1BS9A 2AUMA 4TQDA 1NW4A 5JNTA 1PL6A 3ZVRA 3MWDB 2E1RA 3KEMA 4ZZ0A 3AJRA 3N1UA 2J5QA 4JP1A 1OC2A 4KUHA 4S1VA 4V3BA 4WLUA 5D86A 2FCRA 4LN1A 3IAEA 5EHNA 3KXIA 1KIFA 2DE0X 1XLWA 3QJ5A 1NQUA 2GN2A 3EFOA 4Z2YA 4JI1B 1ILEA 5LC1A 3E7XA 3HBNA 4DV0B 1J0CA 5J2UA 4RA9A 2RARA 4R0VA 2PPVA 4HNSA 1HLDA 4J0FA 2QHXA 4MGZR 4O4HF 4PLTA 4A2WA 5KTMA 4KFCA 2FY8A 2IXGA 2KBEA 3H16A 4WOKA 3WGVA 1VBFA 1GXSA 5T57A 4D8WA 1JA0A 4GLJA 1BXGA 1PR5A 2ERYA 1IATA 3WRXA 3FOFC 2QKYA 4PBTA 5KWSA 3JAMA 5CK4A 3NTXA 2O6LA 2WY2D 1T8YA 1LV8A 3MMZA 3ZVMA 1QH0A 3L8HA 4IDEA 3LT0A 1X13A 1YOVA 2DBQA 3HZHA 3W6PA 3V8KA 5DWQA 5E7MA 5KMGB 5CVTA 2AOXA 4W9RA 3D1VA 3NHFA 3NIBA 4I7EA 4CGZA 1EG7A 1T2CA 2P4QA 1BDMA 3DXYA 3H0KA 3ICOA 3OZCA 1N2ZA 1TXGA 3EMBA 4YRCA 3GLSA 4IBOA 3UWKA 3Q4GA 4LZZA 2O48X 4FW9A 3RFFA 3WK6A 5IT0A 1G21E 3ANYB 2C04A 3QBVA 4FVTA 3WL6A 2O1XA 3A1NA 2GBGA 4ID3A 3P8TA 1EGQA 4CQMD 1VE3A 1YZTA 4B5KA 2PS9A 1WA5A 3RE1A 1LEHA 1T36B 1ZI9A 3PPWA 1JAIA 3GGOA 4OSPA 3U81A 5B3AA 2P9YA 1TIKA 4KH0A 4NLLA 1SBYA 2E0IA 4YRDA 1DPFA 3QWFA 4BVFA 3B2NA 4BCBA 1ZR4A 4N40A 3NAMA 4HJXA 2IEDA 4QDTA 1QQAA 4X1YA 4GGPA 4EO4A 1XZBA 1W1WA 4AECA 1NW3A 2N1BA 5HGQA 1G8GA 4YCMA 2P40A 1IXYA 1XJQA 2WZBA 1Q0ZA 3IDSA 3ZEAA 4K46A 1V71A 1NGSA 4D41A 5FUQA 4OGKA 1K7XB 2GCIA 3I3SR 1SO8A 4KBFA 5A4DA 2CDBA 5AD1A 3WLOA 3AXTA 1W47A 2JANA 5FKJA 4IJUA 3QEMA 1EFHA 3WYDA 2XHEA 4LMAA 1RKBA 5DHRA 4Q9LA 4IR7A 3EH2A 2IITA 4YACA 2FFJA 4XD7A 1NONA 5AW5A 3ANSA 2IV3A 3SIWA 4FXPA 2SKCA 3ZHQA 4ILKA 1N6PA 5BW4A 4DR6B 1TUGA 5LZ8A 3OIGA 2YHAA 3TSOA 1HDCA 1QRTA 3VAZA 4IOLA 3UK1A 4LNUA 4BMOB 4EB8A 1XXHE 1B0PA 1ORIA 2WF9A 5C53B 2PSHA 3CZQA 1HM5A 3H9CA 2I33A 3WKBA 4C6TA 4MKZA 4CR8A 3ZE9A 4QD3A 2H1OA 4RZXA 5ALLA 3FOZA 4X64B 1XNHA 1NWCA 4YJDA 4HVLA 3W2FA 5FBHA 3D3KA 3SZ3A 1VCMA 1VIYA 4K9QA 4XGRA 2WWHA 3D7NA 1L5QA 3QBDA 1UT8A 2BVNA 1JVNA 4WJKB 5HBGA 3UYKA 3LZDA 2HBYA 2X3FA 1VI5A 2WQ7A 3RIXA 1K88A 1XCMA 1VKOA 2WU4A 1CQZA 4IIFA 4PYOA 3RF7A 3GI1A 1JLKA 4Q37A 5IAAA 1PT9A 3WO0A 4KR7A 3CKKA 4XA8A 1VBNA 2R5WA 2IKSA 2JJ1A 2QSJA 3K2QA 4YMWA 4GEKA 4UNIA 1KJWA 2NW6A 4Q3DA 5HYVA 1IXRC 1CKEA 3V7CA 2V7EA 4G25A 2EJUA 2I6FA 1KQNA 1U0JA 2BEJA 2Q1YA 4QU8A 1GO2A 5FOWA 3RFVA 3A32A 1A72A 2QN7A 4TLBA 1R74A 4ZVLA 1Y4ZA 2EZ8A 3GFPA 1RRMA 5CH3A 4BAUA 2ZAYA 4DMKA 4QFDA 5BUZA 4Y9TA 1ZM4A 4UUBA 2JBAB 4PINA 2VTEA 4PANA 3NENA 1B8OA 3B38A 1CRLA 3D8TA 4KK4A 4BKQA 3F73A 2IH2A 5HTKA 3NNNA 5C32A 3SR4A 3K20A 1FRVA 4LVLA 4LNSA 3BCUA 3KOUA 1GRRA 1ZIOA 4XWTA 2ZNIA 4ISCA 4DRXB 3WMGA 2P1DA 3U1VA 4PPNA 1RQLA 2DTHA 4NK5A 4QYXA 2HRRA 2ZIMA 3BGDA 4ZT4A 3CPEA 5FTWA 1QR2A 1U0SY 3PGKA 1ONBA 1Z4PX 3DAPA 3QUAA 2B99A 5D00A 2NUTB 2ST1A 3ZY6A 1SUWA 3BBLA 2G6BA 1QVVA 2PSSA 4C06A 3DP7A 3N70A 1OX4B 4IQFA 1X77A 3W7VA 2YXDA 3PXUA 4BO3A 5LQDA 1PDVA 2J46A 3PE4A 2UUBB 2C07A 5DNCA 4DUGA 1SPBS 2HJRA 2BLNA 4YO7A 5EJ6A 1T9BA 1KI7A 1AN0A 3NEYA 5FPSA 4BB6A 3DNMA 4QTYA 4BQQA 4RJTA 5GVSA 2I1VB 2IDKA 4QXMA 2OESA 1GT91 3HJAA 5C1IA 2E6KA 1D6SA 4M1SA 3ESYA 4UU7A 3VPSA 1QRUA 2GM4A 4TQAA 3MTAA 2HCJB 3DQPA 1IY9A 1OLXA 1QWOA 1AUXA 1US8B 5ALYA 5I8WA 2PM8A 3GPLA 3PQCA 2VJMB 1Z13A 2VP6A 2QUHA 2ZITA 3CE9A 3F4KA 4LF7B 3I6IA 3FY4A 3MGGA 3IIMA 3U49A 4N5NA 3U4GA 2D13A 4TRRA 3QO8A 5E4FA 4LVCA 3C3PA 3Q7QA 4RMNA 2HLDD 3M4PA 1M34B 1II8A 2ZRIA 1QKKA 4JA0A 5HX7A 5JAHA 4P4UA 4NXNB 1QSGA 1DUIA 4ARCA 4IS2A 2X41A 2NSJA 3OUTA 5I9IA 1EK2A 3UAXA 5BORA 5L7WA 3MM4A 4FFBA 5H4HA 3BGSA 2E65A 1QHGA 2A7QA 1SCIA 4JJ8A 3UHFA 4B3FX 4DJJA 5BSEA 2IS1A 4DRYA 2X1MA 3F3SA 3LWBA 4EG3A 3B51X 4I19A 3KHUA 4TN5A 3S1LA 1B8PA 4ZCMA 4DG9A 2RG1A 5CA1B 3CVYA 1FZTA 2OORC 3H2ZA 1VGQA 3M7IA 4EYGA 3VU8A 3NOQA 2XB4A 3SYMA 3DTTA 3S2SA 2AL7A 4HAYA 2PA3A 5EEHA 4TWIA 1C50A 2H5JA 3N3BC 3LW7A 4DA0A 1UOOA 2QSZA 1OSNA 1FC0A 1SUBA 2V0NA 4C4AA 4J7UA 1SB8A 2IZZA 1OXUA 5CLGA 2GUWA 1ZMOA 3KQSA 3V2UA 3QKRB 1ZW6A 3MTIA 3JVVA 4NJEA 4QDOA 2ZJ7A 4N5LA 2DKNA 1UKCA 3L8EA 4KPFC 2GB4A 2W2KB 4IX1A 2GN8A 4ZANA 2OXIA 2AGVA 1M1YA 3DZCA 5KREA 5B64A 1O4WA 1UXHA 5A4MS 2Q8NA 3OTGA 2B6NA 3QLJA 4LJ8A 1COZA 1J1ZA 1ASZA 5JMWA 5K8TA 1RHMA 2B4RO 3M3PA 1JG6A 1MXFA 3IT3A 4GU5A 4Q4HA 3RC8A 1EU1A 5JC8A 3CO0S 4REQB 4ZEOA 4BRSA 1X94A 3H4MA 4TL8A 5K3FB 4QTXA 2FW0A 3IOBA 4F46A 1XNRB 4HN9A 1VYHA 4N9QA 1G9TA 1YZHA 2GKOA 3C7TA 4MSUA 3DEAA 2YV5A 4PLWA 5LBTA 4YR7A 4H35A 2LP4Y 1ADCA 1FTYA 2Q3BA 4BFYA 1T91A 5CPFA 4POAA 5ALTA 1QVAA 3OY2A 4HVTA 4XSGA 3T9BA 5K8IA 1VPEA 3BA6A 3Q0TA 3CZPA 1SOAA 2Q4BA 3IELA 3RAJA 4AT1A 3OM8A 2JLQA 2O2ZA 2Z56A 4LC1A 1G3MA 2NIPA 1E9RA 3T3DA 4WDQA 4ETWA 3WGIA 2ZJBA 1TYCA 1H5QA 3KU4A 3R3XA 4HH0A 2P6MA 1G8YA 4L2IB 2G63A 3TQSA 4CBVA 4LMPA 2C4NA 5AVVA 2XWSA 2V55B 5DNAA 3FTNA 4KQ2A 5E3JA 5LXTA 3L2ZA 3INYA 4AJ4A 1QB8A 2IODA 3RSCA 1WS6A 4FK8A 4Q1EA 3O0DA 4TV8F 5IJZA 1AZLA 2EZ9A 4H6PA 3GCGA 4Y6RA 3ZIAD 2IF2A 4JS0A 1GZVA 2NM0A 2W8BA 2ZSJA 3D4IA 1NBEA 1QGYA 3JRNA 3NEPX 5KPJA 3LSSA 4XB2A 3IVCA 1ZY2A 3DNFA 4KIJA 1XZDA 3C5HA 3BPSA 1M0EA 3ADCA 3MQ2A 1KAGA 1QRSA 4Z4IA 2CLLB 2WF7A 4GI1A 2ZUWA 3U5ZB 3CR8A 1PWYE 1SU4A 4Y2QA 2A78A 3QMWA 1F14A 1D04A 4U1RA 5AXAA 3W3AA 4GYJA 2UU9B 1GUYA 3G02A 1NBME 1D9XA 2BRUC 2MT9A 3P9YA 1CQIA 1JDNA 1GQFA 2QT9A 5FUVA 4BX0A 3JALA 3COWA 1U0GA 3O8NA 5CIWA 4JASB 4I99A 4AY4A 4H3VA 3DE3X 3SOPA 3WISA 2ZIGA 4CDRA 1UBLS 3GA5A 3GF4A 4DTCA 4LSGA 2QMEA 3IP9A 4W7HA 5KOJA 1TGVA 2QX6A 1IPHA 4JLWA 4YRNA 4ZT5A 1WXHA 1JLRA 2C4MA 2YVAA 2HRZA 1YQ9A 3TAUA 1XEWY 1ULBA 2AHRA 1N7IA 2WR8A 3G49A 3N0XA 2ZZNA 2VSNA 2DCMA 4UEWA 2X5OA 2R1VA 4DARA 3I2YX 5TQ2B 3V7YA 1W59A 5ED0A 1YB6A 1ZL2A 3A1CA 1DAKA 3OZBA 3V4ZA 3AB3A 3RREA 1E96A 1CR6A 5TJHA 3SEFA 5JZOA 5K05A 2IHJA 1R0WA 2WIKA 5F78A 3WRYA 2IDZA 3KB1A 1HR0B 2X9LA 5DX8A 1KDRA 4BNGA 2CW5A 2VVTA 2D4AA 1P33A 3AY7A 3HS3A 4WRRA 3AONB 2A4MA 1G21A 1UPBA 2ZDHA 4MS1B 3QXXA 4OGGA 3A4IA 4AJPA 6CHYA 4XYEA 5EKUA 1ZW1A 3ILSA 3IEUA 4DADA 2PU5A 1JHOA 2IUEA 4CMHA 5IPFA 4PSUA 1O3YA 4LPKA 4FZJA 1DKMA 3K5PA 5AM4A 4U39A 1CT9A 1QF7A 4G9EA 4H27A 4YASA 2GS9A 1S7CA 5D3MB 4JEHA 3AOGA 2G9UA 1Z34A 1KJIA 3GJ5A 2PMWB 1UKYA 3P4XA 1T5DX 4X60A 5LYJA 2OV6A 1BHQ1 3TYXA 2XLBA 4EKIA 1FFXA 1LDBA 2A0WA 4MW1A 1R8YA 3OWXA 1NN3A 2FX2A 3TKLA 2FQQA 4RY9A 4QWMA 2P9BA 5LVAA 4Q7LA 2PUCA 4ALNA 1V5WA 3QPAA 3H2IA 4L4SA 4FFNA 1AQNA 1W4LA 5CGZA 3B2EA 2FJ0A 1MIOB 3BKWA 3L5KA 4ZVRA 3HSYA 3OMXA 4RTSA 4IIXA 4XCVA 3EZ9A 4XH9B 5GONB 4ZVVA 1Z7YA 3UHJA 2VF5X 3FMIA 5A4KA 3HBJA 4M98A 2QRGA 3RNOA 3N2GA 4M36A 4TVAB 1YA4A 2PH3A 2ZETA 1ZSNA 2WWIA 3I42A 5INTA 1JHQA 2QZ4A 4IG9A 4P3PA 1C0KA 1XXHA 2OXRA 2P0YA 3A6LA 3PG5A 5JJCA 2I65A 3GG2A 2V3VA 1L1RA 3C3WA 4JLDA 4ND3A 3RHSA 2G1KA 4I5FA 1M2KA 1OH7A 1CEYA 1V0JA 2JI7A 3WBKA 4YAFA 3LV8A 4JX8A 2EVWX 4QOIA 3BWYA 4OL9A 3PCXA 1JWLA 3ZR4B 3AM4A 2PH7A 3DMYA 2V6IA 2KB0A 4RANA 1KZYC 1MB0A 3OQOA 2AYZA 2VDUE 4GGOA 1L4FA 3IVAA 2C4UA 3Q8XB 2F9MA 2JIDA 4X7RA 4GIBA 1L0WA 4KN6A 2DBRA 5KOYA 3KLBA 1G59A 4JYMA 2D6FA 2G17A 3KZKA 1QGAA 1OGYA 1WSAA 1Z4IA 3UENA 4GD3Q 1C3XA 3D8BA 2C42A 3LHFA 5JZSA 2O7VA 2BMJA 4GPAA 3VR6H 3URMA 3IB3A 2IXAA 5AHRA 2ZULA 3CLTD 5ELMA 3DTVA 1LDMA 1X8KA 1MQSA 2KI5A 2P35A 2Q5JA 5CJJA 1J06A 2WG2A 4CI9A 5L51A 1RWQA 1HYHA 3V9AA 5KHAA 2FLWA 4IJQA 1ZP6A 1ESCA 3NI2A 1MXHA 1Z0IA 2E4ZA 3L4GA 5JOQA 3ZLJA 4JLNA 3MUEA 5H4GA 3W6NA 1NU8A 3T4XA 4B3HA 1L5SA 1L9XA 1E4YA 2YTZA 4PZYA 3QI7A 2YJ5A 4E22A 1R3DA 2J87A 1BIAA 1RLIA 3LL4A 2BR5A 3ODGA 5JNWA 5KNLA 2HPHA 3BXFA 5CUQA 3KB2A 3KKKA 4INAA 4QRIA 4XDHA 1I3KA 1KTIA 3WMFA 2AMYA 3OIVA 5ADHA 4G1MB 3L0CA 1VLMA 2W2LA 2VAWA 3EZFA 2F62A 5ILQA 3WGQA 1AO3A 4S0XA 2X6TA 3L3BA 3M1IA 4GQIA 3DDCA 2WD7B 4H16A 4R2KA 4RZSA 4CR7A 1USYA 1VECA 1T5TA 4ITUA 4G0OA 3H5NA 3VZCA 4MKFA 3R24A 4HC4A 1IG0A 2W2MA 3D7LA 2XCQA 3PXDA 2P8SA 2CXOA 3TLZA 2CFSA 1H8EA 1U5CA 3A7AA 2FPIB 2H0AA 2PK3A 3IE2A 5I9BA 5KNCD 1JDVA 1QIKA 3HUFA 4L02A 1XQXA 1P0PA 1Z2NX 1I80A 2EJBA 3F5DA 3Q1LA 1LTHR 1SU7A 3OFVA 4MPRA 5ALQA 4B0OA 5M04A 1KF0A 2WAMA 1DQPA 1WZUA 4YUZA 5AI6A 4Z0HO 4DLAA 1X80A 2JCYA 1QGUA 4XU0A 2P2SA 3DLCA 3IPRA 2DMRA 5LZ5A 3EW7A 3CMCO 2IHUA 2Z3WA 2IPAB 2W4IA 4C7XA 4JN6B 3RG2A 2C8KA 4HEA6 2VP4A 1HTBA 2RG7A 2VAMA 4LHWA 3O4HA 4NZZA 1KHTA 1VXOA 5IBQA 5KIAA 2RGYA 3UT5A 1IHXA 3WJ2A 3G2MA 4DMUB 2I66A 1MABA 2C7RA 1V7PC 1RLJA 2VJCA 5L3RA 4ITRC 4RIGA 3GLIE 1H3EA 3DR3A 1DC3A 1G19A 3L2OB 1TZKA 4YECA 5JSZA 1NKVA 1EFVB 1OYWA 2GPWA 3HDVA 4OI0A 3JWIA 1ABEA 1UKZA 1EA7A 3OG9A 3UYLA 4B3DA 3U1BA 3HCOA 2FI1A 4ZEWA 2RI6A 4RH3A 5GZ1A 2QMQA 1EK1A 3CN7A 4XM2A 5KYTA 1KORA 3QEKA 5CXSA 3WLTA 3AGPA 1PJRA 1J8FA 3R0JA 4R68A 4RJIA 3ETCA 3NWOA 1DINA 2RDMA 4EHLA 2BKVA 3S81A 1P4HA 5EQDA 3V1KA 4NBVA 4I9GA 4JODA 2HUNA 1CS0A 2F43B 2UZ3A 3JQFC 3OT1B 4KB5A 4Q3EA 3QLVA 2FJPA 3ABOB 4RJ2A 1RYZA 5BWBA 2QRUA 3Q0IA 2NO6A 3E9EA 3GK3A 4KX5A 3AFNA 1BSVA 1OIXA 2ETXA 4CM8B 1I4DD 1QLHA 2BC9A 2IY7A 2LCIA 3NHWA 1NC1A 2JCBA 3H11B 4YO8A 3TKAA 3UB4A 4CCAA 4EFNA 3LBAA 2W43A 1DXHA 2A8YA 4OXQA 1TT7A 1J33A 3K9NA 3KCQA 5K6RA 2Z8XA 3ZZTA 1XTJA 1G3IA 1MO4A 3LC0A 1U90A 2Y1CA 4TL7A 4DILA 4HXFB 1KSGA 4ZCPA 4D5GA 2QM8A 4G5SA 4GZ6A 4J7CA 4QU0A 4BIIA 2CMFA 2JBWA 1DDIA 5KJCA 2K4MA 3DBVO 4PVCA 4DA6A 4PCVA 5HRUA 2NO4A 2PN1A