5C51B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
418
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase subunit gamma-1
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c51B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c51B02
1VQZA 4OP0A 2ALYA 1QE0A 3HXUA 2EJFA 1G5HA 4YRTA 1ASZA 1N9WA 1YFRA 2ZCEA 2DVEA 4P71C 4UP8A 1WQ7A 2AMCA 2DU7A 2I4LA 1L0WA 4ZTZB 4XEMA 1FYFA 4WF2A 1J5WA 3G1ZA 3PZCA 3QTCA 1USYC 4HWSA 4H2YA 3KFUA 4HWRA 1USYA 2C8MA 4EO4A 4YCWA 4TVWA 5K1XA 1EVKA 4WI1A 1KMNA 4H2WA 1ASYA 4K88A 3W3SA 4E51A 1E22A 4G85A 2AKWA 4CS4A 4YREA 4HWOA 1NJ2A 2ZR3A 3MF1A 3VQWA 3WQZA 1WYDA 1H4QA 2G4CA 1YB3A 1NJ6A 1C0AA 4TVAB 3VQYA 4KR3A 4H2XA 2CJBA 2ALYB 4O2DA 2I4MA 4HA8A 1X54A 3V8JA 4P3PA 4YDQA 1YFSA 3IALA 4TVYA 3TEHA 2ZGWA 1X56A 3RL6A 3NELA 2ZT8A 2DTHA 2E5AA 3NENA 3BJUA 4P73C 2Q5HA 4H2TA 1Z7NA 4BWAA 2ZNJA 1NJ1A 3NEMA 3EFRA 3HXZA 4YRGA 5F5WA 3A7RA 2IY5A 4AH6A 1IL2A 4BW9A 2DXTA 4J15A 1Z7MA 1SERA 2Q7EA 2QHUA 2CGHA 4H2UA 1RIQA 1NJ8A 2DZCA 1BIBA 3DSQA 2DQ3A 3HXVA 1LYLA 4HWPA 4ZIBA 4RMFA 2CIMA 1V95A 1B7YB 4H2SA 2RHQB 2E10A 1WLEA 3M4PA 1NNHA 4XTXA 3REXA 2CJAA 2C7IA 4TQFA 2ARUA 4WJ3M 1PYSA 4HVCA 3OD1A 5ELOA 3IG2A 5KNNA 1EVLA 3HY0A 2ODRD 1X01A 2PMFA 3PCOB 2RHSA 3MF2A 1JJCA 3I7FA 4L87A 2EL9A 4YRIA 1EIYA 2ZTGA 3L4GA 2E65A 3E9IA 3RKYA 2ZT5A 5C53B 2IY5B 1E24A 3R07A 4LNSA 1B70B 4H02A 3ERRA 2XTIA 4Q6GA 3M4QA 4XU2A 4WJ4A 2QHSA 2ARSA 3IKLA 1KOGA 3HXXA 4KR2A 2ZZEA 1SESA 1B8AA 2DZ9A 3L2ZA 1PYSB 1YFTA 1BBWA 1NJ5A 2Q5IA 2ZNIA 2ZZGA 3UGTA 2J3MA 4RDXA 3UFGA 4YRQA 1B76A 5C51B 2EJGA 3VQXA 4RQFA 4K87A 2E1HA 1HC7A 1E1OA 3RUXA 1SETA 4YRRA 3V7RA 4XU1A 4P3NA 1WQWA 4X5OA 3UGQA 2AMCB 1HTTA 2LW7A 4CH4A 1KMMA 3HFZA 3A7AA 3RKWA 1E1TA 4P75C 4XTZA 2DXUA 2DTIA 4TWAA 4P75A 3HTZA 3NETA 1GGMA 4YYEA 1WPYA 2XGTA 4HWTA 5C52B 4YRFA 3LSSA 3HFVA 2EJ9A 3CMQA 2DTOA 3P8YA 4YRMA 2AKWB 3FJPA 2E41A 3A74A 1SRYA 1QF6A 3VBBA 3LC0A 3RKXA 1HXDA 2CJ9A 2Q7GA 4YRNA 2DDZA 4H2XB 1G51A 2DEQA 3A7UA 2DKGA 3RF1A 3HY1A 3EFSA 3TEHB 1EOVA 3QNEA 5E3IA 2P5IA 3RGLA 3TUPA 4XTWA 1G5IA 3HFZB 3E9HA 5K1PA 2ODRC 1X2GA 4K86A 4G84A 4PHCA 4XTUA 1X2HA 3LSQA 4TVAA 3ICAA 4YROA 4EX5A 4Q15A 2ZT7A 3A5ZA 4XU0A 4YPFA 4YRLA 3BFMA 4P71A 4YCVA 3QO8A 1BBUA 3QO7A 4UPAA 3V7CA 4XU3A 4YP0A 4OLFA 1BIAA 4ZTUB 3RACA 1X55A 3P8VA 3HXWA 3V8KA 3TEGA 3VQVA 1NYRA 3HXYA 11ASA 2RHSB 3REUA 1JJCB 2J3LA 2E64A 1EQRA 1YGBA 4UP9A 4UP7A 4DPGA 1EIYB 2EWNA 3L4GB 1B7YA 2RHQA 12ASA 4H2VA 3P8TA 4YRKA 1ATIA 2I4OA 3IKMB 4TQDA 2E3CA 4DQ2A 3QO5A 3A31A 3UH0A 3A5YA 4CH3A 4CS2A 4XTYA 3PCOA 2ARTA 4XTVA 2ZT6A 3V7SA 2QHVA 4RQEA 4PG3A 4XEOA 4YCUA 2DQ0A 4P72C 4P73A 4P72A 1H4SA 4P3OA 2ZR2A 2Q7HA 3RIRA 1W66A 3MEYA 4NCXA 3L1AA 1WNLA 1B70A 2DU5A 2P0LA 1WU7A 5ELNA 1NYQA 2ZIMA 2ZZFA 3V8LA 1H4TA 4YRJA 4CH5A 1ADYA 2PMEA 2I4NA 3HRKA 4P74C 4YRSA 2ZIOA 1EFWA 4YRPA 1ADJA 4CH6A 4P74A 2QHTA 1H4VB 2DJZA 2ZXFA 3HRIA 5HGQA 4YRCA 2EAYA 4TTVA 2HNIA 4CS3A 3A32A 4KQEA 2FYKA 2ZINA
chains in the Genus database with same CATH superfamily
1SIBE 3G8DA 4Z1MD 2HCBA 3M6WA 2C20A 3GUZA 4I9HA 4LPSA 3VX3A 2UYGA 3AI7A 3MWDA 1P8AA 2VXBA 3JS5A 3V4LA 4KPFC 4D2IA 2GTIA 5K03A 4PLYA 1NYLA 1YSCA 2ALYA 1DBIA 3K0FB 3RTGA 1RHJA 3GAFA 3OZTA 3KLNA 4K28A 1K86A 3ANYB 3EHEA 4YRTA 4MRVA 3Q3CA 4P31A 4RGBA 4UTVA 1II9A 2RHWA 1YFRA 4TKMA 4AP9A 4MPPA 3RODA 2WBLC 4UUNA 3WYGA 1B8UA 3A2LA 2CLFB 4FGWA 4IDPA 4PO3X 3Q10A 4QPDA 5E9JA 5I7WA 3AHIA 1DELA 1CG6A 3LBHA 4RHUA 5K0ZA 1B6TA 3I04A 3T7TA 3OOEA 4I9GA 5HIIA 3TQTA 1GRNA 3BSYA 2NO5A 2D5BA 2YRFA 4UASA 4XGNA 3PFGA 5CCBA 1W75A 3V7YA 1IM2A 3PXDA 4UHCA 4I4TB 5I01A 4ZCIA 5A4FS 2ZRLA 5BYBA 1IRXA 3NBXX 4N49A 2W2KA 2HDHA 4UNNA 2PDAA 1OAAA 1V7PC 2HN9A 4ZCMA 4LVMA 1ZUWA 3KSZO 1KU6A 1T6BY 2VA8A 2WKWA 3KHUA 1XCMA 2PKWA 3ZXYA 5DP2A 4E5NA 3RD5A 4W8HA 3M33A 1AMNA 1O95D 1CNFA 1P4SA 1Q0LA 1A5BB 1RQPA 2G9NA 3K9NA 3T6KA 1IATA 1XQVA 1G63A 2FRDC 2KMLA 3HKBB 3K09A 5F52A 3AL2A 3LPLA 2HO4A 1JEEA 4G8JA 2X0EA 5F9MA 2WK1A 2YWFA 4LQCA 3MJ4A 4X92A 1I1QB 2QZZA 2HK6A 2GCPA 2SICE 4JJ8A 4BQEA 3S2SA 1YB2A 1VB5A 1OY1A 4PG7A 3Q7PA 2X19A 3AHCA 4K88A 1DXHA 4BO9A 1LDBA 3EA0A 4GL4A 2DH6A 3WLQA 1E22A 5E1BA 1BGXT 1C0IA 2YCBA 4JZKA 1SD2A 3WMFA 3PWZA 2BEUB 4MR7A 1QGUB 4OQXA 1YB3A 2SCUA 1F8XA 2VF4X 2Z8YA 4NXNB 1G5TA 2HO5A 1Y3FE 3GH3A 3EIEA 4H3HB 1S8FA 4FDAA 2V59A 1M2FA 2Q3LA 4TKZA 3AUYA 5IJZA 2H4JA 4BBPA 1HG1A 2VLBA 2VPWA 2X86A 3LYLA 4WLFA 4EY6A 3AGPA 3NDPA 1E3WB 4CNBA 5JSQA 4ZYXA 5T64A 1QJCA 2ZUDA 1BDBA 1NGSA 1L4UA 3N3AC 3UXHA 3D6NB 5CX1A 5ADHA 2HOQA 4BNFA 3AC0A 1KSJA 2WIBA 3B20A 3ZY3A 4CEIB 4ZAVA 3U44B 4JOQA 4H7HA 4YJ2A 3PT5A 4FHFA 2CNWA 5H4HA 2IT1A 3C7TA 2OCGA 3KBOA 2FN7A 1U3GA 4UKDA 3B6JA 3D2LA 2O05A 1CU1A 3VFDA 3KP1A 1QRTA 5KNBH 4J0FA 4Q1EA 5DBOA 5I7FA 4MCAA 1DL5A 4E1BA 4O4HB 4Y9RA 4KPEC 3TNFA 1I3OA 1RYFA 2J1LA 3KZ1E 4BFWA 5J2TF 4RV9A 1MV8A 1E1QA 2P27A 3MWEA 3KVRA 4UUQA 2IIBA 4NEGA 5B1YA 1RIQA 1P7WA 4EKNB 5IBPA 1YUMA 4MNTA 1RWWA 4D25A 1BIBA 2DBVO 3OTQA 3MT8A 2N42A 2LR0A 3ZHUA 5HJ5A 5CYFA 1IIRA 1RI4A 3AB8A 4MR9B 4DRZA 4EI8A 3KZKA 4Q05A 3V6MA 4CN8A 4HAXA 1QONA 4YS6A 3P9QA 4A2QA 3FMFA 1TECE 3INGA 4IJKA 5KNCH 1UKYA 2WJYA 3MQFA 2FSIA 1AB6A 3PXXA 4JJ6A 2UVPB 5ALGA 1VTKA 3B3QA 4REOA 1QG0A 3LK6A 2H92A 1US8B 4GKBA 1NQUA 1PYSA 2A0UA 2GMWA 2IHKA 4NYIR 2XDQB 4YP5A 4LTDA 4PCVA 1VPVA 5EWJA 1C3OA 2X77A 2W2VA 4KX5A 4WN9A 3WG9A 3D7LA 3CVJA 1I4TD 1WPXA 3W9UA 1PJ4A 2B6NA 3NAGA 3DXZA 4JX9A 5E2IA 5B3JC 3L0CA 1AV7A 2CWWA 1CR6A 3NLLA 5HJ7A 2FPGB 4YAUA 2NYUA 1JMKC 4GQBA 1Y5IA 5EIAA 4YRZA 4H1WA 2ADOA 4AJKA 5BUQA 3VDXA 1KWKA 4U7HA 2YUTA 3FVTA 1VCNA 3H2KA 1R0SA 4MGKR 4LF6B 3C70A 2R8YA 3J7TA 4ITRC 1L5LA 4FFSA 4D4IA 4JBGA 5KJ6A 1Y5MA 2KYRA 1RXVA 1ZD4A 3IERA 4B74A 5AXAA 3OLXA 2GN4A 1KO5A 3OEEA 3FBWA 5E4JA 4ZK2A 2GASA 2I99A 2O0LA 2ZRPA 2JFGA 1MX9A 4M0DA 1PT5A 3VR1A 3JZMA 3PUVA 1IFXA 1R4AA 4DA9A 4CFYA 1YTUA 1V5GA 3NIDB 5CXQA 2DOKA 4BJ1A 3ORYA 1B15A 1E9SA 1GGHA 1WA5A 3FGNA 2N9UA 5A9RA 4GG1A 5JRDS 1DMRA 4OX9B 2QW0X 4PPFA 3ECAA 5KDLA 2J3QA 5F5NA 4O3MA 4RORA 1A7JA 4WZAB 5ITSA 2W5UA 5IU6A 1QDUA 2O3QA 4E5KA 5BNWA 2ZYVX 4RQAA 4TSFA 1QQBA 2YYAA 4DLVA 4UHEA 2JFWA 5H70A 2JFUA 5CURA 2NYRA 4DUYB 5T67A 1SKYE 3FGOA 3Q5GA 2IYZA 2WEKA 3HXKA 4KR2A 1XE3A 1WUTA 3KSUA 4U9HS 5EE5B 1DLJA 1WETA 3G2MA 4MHTA 3SDSA 4BNMA 4IXWA 2OGWA 1NMYA 1U5AA 10MHA 1XT6A 3CNQS 2C4VA 1U0JA 3CLUD 4FGZA 3RYCB 3TR5A 2F3PA 1Y42X 3SJAA 2AR9A 3PWKA 4KE6A 1UK6A 3KAJA 2J3MA 3R6WA 2ON6A 4NICA 4C07A 2ZTLA 1XRQA 1HURA 1XVVA 2EX4A 3ADKA 2XPCA 4I55B 2NUTA 1M1YB 1VXOA 1ISPA 3DQZA 4HXFB 5LB4A 3TRJA 1XZNA 4ARAA 3I4LA 1D1QA 3C8HA 3D3NA 4PV7A 4PXYA 4C4TA 2HLHA 4EK9A 2PZ8A 1PZNA 1V1RA 3MPOA 2H1SA 3AYXB 4FKBA 4RFLA 5DV9A 3W7AA 4YO8A 3WADA 3QNWA 2IPOA 2QLMA 4RH3A 1CUWA 2YQ4A 4JC4A 2P41A 4RDIA 3B78A 3L84A 4JNCA 2CFRA 1U0BB 3BC1A 4ND5A 3FTEA 1S96A 4XSHA 2QTFA 1VCOA 3IMCA 1KMMA 3UCXA 4GMKA 4A8TA 3IMFA 1TMOA 1EEHA 3ZE7A 4DJJA 4US2R 3K70B 4MYDA 3RC1A 4Q9KA 3DHEA 2P5YA 5JWOA 4KO4S 2IH5A 4JI2B 5CFPA 3K0CC 2JLCA 4KDFA 3NW9A 1EBFA 4C0KA 5LDDC 3D8NA 1MF7A 3B9QA 3NOQA 1PGQA 5CT4A 5JZOA 2PV0A 4J1SA 5KKCA 4WK6A 1HETA 2HHLA 5TGTA 2XIQA 2RGGA 3VU3A 4CMBA 1T2UA 1Q2XA 2XE6A 1BS2A 5AI5A 1C1DB 5BSEA 5AHXA 1HDEA 4R8RA 3WJ1A 1ZK4A 3WXMA 2ZIVB 3FY4A 1TADA 4YRFA 3UPDA 4C7BA 4DCNA 2IZ1A 1QRUA 2D7DA 1WD7A 2Q45A 2H08A 3A4VA 2A9OA 2C9MA 3BE8A 3ESXA 3FNEA 1UDXA 3KB6A 3SF8B 1U0SY 3ZDEA 4XFDA 3B5EA 3G3EA 3KQQA 1T2VA 5BQOA 5H8WA 1DQPA 1TVKB 4MGZR 4BFUA 5CDTA 4DMRA 4TMFA 4D9BA 3MXTA 2UXBB 4KMMA 3N70A 3R7SA 2XDAA 4M9ZA 4PINA 4Z4IA 2ZRQA 1FP6A 4KXVA 2FR8C 4A9AA 2C3YA 4BVKA 1S8NA 3RKXA 2PA3A 2X0KA 1CS0A 3WJ7A 2GSWA 2R1TB 3QSGA 1JNXX 4KGXA 1KMIY 4ESEA 4G0QA 4WK2B 1G8MA 1RQNA 5CLGA 1TLTA 1G8JA 4JLMA 5FNVA 2PX0A 3T7JA 3VBEA 5JCZA 1YHYA 2QYSA 1U6IA 1V96A 3JVVA 4LRWA 3JQDA 4X6XA 3NJRA 3VISA 4RKWA 1KJZA 3DWGA 4XD7D 4XYMA 5LLSA 3GWZA 4QNMA 3L7KA 4KV7A 1CT9A 1D4OA 2IU6A 4DJEC 5ITWA 4G5XA 2AZ4A 3AHJA 1W29A 4ZKEA 1JRLA 3FFTA 3RT7A 2PMCA 4OLJA 2C1XA 4FZRA 4Q5IA 1PL0A 1X2GA 1I4LD 4LDZA 1AXGA 1VMEA 1AQNA 2QPLA 4QYSA 3FHCB 3PPYA 1NBHA 4NU6A 4UBLA 2LTAA 3QVXA 4OQLA 1E2JA 5EERA 3JD2A 4BNVA 3TQFA 7MHTA 3DYBA 3QTBA 2GVNA 5E7QA 5WRFA 3SNHA 4I1PA 1X2HA 1Q77A 2I6FA 2PO7A 1F7VA 2HJHA 3T1HB 3F6BX 1SCNE 5LLDA 1QRAA 3VZQA 2XA2A 3N2LA 1LGYA 4QOFA 3NYWA 2D0DA 4RY0A 3HA7A 3JSXA 3NHMA 3PU6A 3CEMA 4UPEA 2ZWIA 4S2UA 3U1TA 5L3VA 2VSYA 5CA1A 4D5GA 1SZPA 4N9WA 4RVSA 1ICEA 5CFQA 1Z18A 2FKNA 1I9GA 5HKKD 3L0IB 5LQUA 4BV9A 2PCJA 2BTOA 4KDCA 1C14A 1Q0TA 1XNGA 4PSKA 3B6EA 4KU4A 2BISA 4B5KA 1X7ZB 4WLVA 4H6VA 1OH8A 1J2RA 1N0IA 1TM5E 1K27A 4BKQA 3N2YA 1E7QA 3ISJA 5EWJB 1XLTC 3SC4A 2OKCA 1ZG3A 4OLFA 1WRBA 1YTLA 2JJQA 3KUDA 4L7QA 1M33A 1GFZA 1MH9A 2V5UA 1DQNA 1XEAA 5IVPA 1DUIA 3NHUA 5CEJA 3PHHA 1DO8A 4E11A 1P2BA 4GGPA 1QE5A 2YIVX 1TO6A 3FOAA 4R84A 5ER9A 3ROEA 5MN5A 4H6PA 2DEUA 2WHPA 3WRYA 2A57A 8ADHA 5I7RA 1LJ8A 5JLJA 4JJ7A 2E4XA 3CUSA 5E3JA 5C4GB 5ES3A 1DPFA 3E0XA 3FWYA 3S55A 5DRTA 1YWGO 3W2FA 1WCIB 3Q8WA 3DEIA 4D4LA 3RIYA 2BL4A 5FWXB 1J9GA 1NY5A 3HVIA 5KAPA 5A3SA 3LUDA 3OEHA 4E7PA 2Z8XA 3MT9A 2LV8A 3Q2KA 4FYKA 3HNOA 4XH9B 1J8YF 4QOIA 3PUIA 2I29A 4PX9A 4WERA 1UINA 5A3RA 4LDRA 5DNUA 1N6LA 3D43A 5KKNB 2ZUEA 4MI1A 1BX1A 4TWRA 5ELMA 3L18A 1ZNQO 3QEOA 3ED1A 4AJLA 2PD6A 1Z08A 4JB0A 1QVRA 1C7FA 4X41A 4BZQA 1NW6A 3AQIA 3RWBA 4PS1A 3CB4A 4MI6A 4LGMA 5FUVA 1OTYA 3ZGZA 3D7RA 1SY7A 3R7DA 4DADA 3GGCA 4IH4A 2GJSA 5GZ1A 1ZMBA 1SURA 4NP6A 4EG5A 2W6ID 1X3SA 1Z17A 2PZJA 3MBOA 2D6FA 4QBGB 3WLFA 1O6ZA 3BDAA 3U7QA 1YFLA 4V24A 4CH3A 1AS2A 1VHTA 4NBSA 2EC5A 5T4HA 2BBWA 3C7AA 3X44A 1U6KA 1Y8ZA 1Q0UA 3B3JA 4HO1X 2OV8A 2DPXA 3SIXA 1SUDA 2FSUA 2ZIAA 3CY6A 3HC7A 3EVNA 3X1XA 4FXPA 2QAGC 4RTQA 3KTFA 1R0LA 1WKCA 2CHUA 1ZK3A 2R6DA 2W2QA 3N75A 4TN1A 2HNKA 1GO2A 1JVBA 4P73A 1BS1A 1GU7A 1WW8A 1QF9A 1Y6JA 2OLKA 3KJHA 1QR6A 3HU2A 4YDHB 4OBXA 4RKQA 4G3XA 1BU5A 2IRWA 1DAOA 3HADA 3MMZA 1UKCA 1WNLA 3MTBA 5IEBA 4MGHA 3V2IA 1XEFA 3O47A 2Q3DA 4EG4A 4R6WA 5JS2A 4EKDA 3GZNB 1BFDA 4IDOA 3E9MA 2H1VA 1IBLB 3L7DA 3U62A 3SKXA 3DVAB 1XO1A 3KL4A 4I5EA 2DFPA 1JLKA 4QX6A 4BO6A 5CG2A 3QLVA 2P62A 5JJKA 2XF8A 4YFVA 3WNZA 4WASA 2I3ZA 3RH0A 2I4NA 4HMPA 3WP1B 1KYZA 4MVJP 2EWVA 4HT3B 4TYWA 2OFXA 3CGWA 1BJTA 3TIIA 4V3CA 4QTTB 3TG2A 2QMQA 4OHVA 3L5OA 3EW7A 4X60A 4IV5A 1XWIA 3BCUA 4MR8B 4NCHA 3CF2A 4LIPD 4E09A 5EMKA 4AKTA 4CW7A 2YVKA 4ESOA 4BMXA 1UXHA 2QHTA 3IUQA 4XYEA 1H4VB 4GYWA 1YKGA 3LGAA 4KV9A 1U1FA 2ZE6A 1PGPA 2RKBA 2Y05A 5J2TB 1OIXA 3HRIA 5KPDA 5HK9A 2RJNA 4W9RA 1U98A 1HFJA 1V4VA 2A59A 2CFCA 4PLHA 2JCYA 1SQGA 4KI0A 2Z2YA 3NUGA 3X1MA 2B37A 4RSGA 2JKZA 5EE0A 1X7WB 1TVCA 4OIMA 721PA 1GG5A 4RA6A 2FI1A 2CMFA 3H9QA 3DOEA 4B4DA 1YVUA 5AKXA 1CNEA 3ZW9A 1QE0A 4EMBA 4I1VA 1RC8A 3V9AA 3IR6A 4OHBA 5KYXB 3HCRA 3AWIA 1G5HA 3DJYA 4GP6A 4DWVA 2H59A 4QYWA 2XNHA 2G5TA 2D2XA 4EWLA 3C5VA 3EUAA 4PQFA 4UTZA 5DM60 1N36B 1HEUA 3LZCA 2M6KA 4J07A 5SZHB 5B5SA 3B60A 1CK4A 4JUDX 1OH5A 3KOUA 4YBZA 4OXRA 3B6KA 4AQYB 4L3WA 4HAUA 4UUBA 4E5YA 4CDNA 4Z49A 2MYUA 2RIRA 4BZZA 4IJMA 4QDKA 3GLHE 3I8OA 3SX2A 1H8EA 1P2FA 3UWKA 3CRMA 5ALOA 4ZDWA 5B58T 3ZVRA 1SVWA 1U9YA 2NO1A 3K1ZA 1F14A 1RJFA 2J59A 1E9EA 4DOMA 4FFVA 4AWBA 2FMTA 1HZZA 3NGLA 2ZIWB 1NFFA 3O7MA 1DRVA 1GKKA 1Q3KA 4GWKA 5B55A 3C6XA 1OPXA 1GPLA 2GBPA 3L5KA 1W2GA 4LKOA 1S2MA 3EVFA 4IFEA 2NU9B 3JR7A 4EELA 3IFSA 1F2UA 3GFVA 3LBIA 3OAAA 1W59A 4JKIA 4KQ9A 2WF8A 1UDBA 3P1JA 1FSGA 4RD3A 3V8RA 4KAAA 4BKUA 3CGGA 5FFNA 2DCMA 4TYQA 4NV3A 4DCGA 1PBNA 1I4WA 4WI1A 4WJLA 4RD1A 1LKZA 1V11A 2FE4A 1GZ4A 1KS9A 1L5ZA 1KQPA 1L5OA 2NXCA 4TXHA 4Y6OA 3W8RA 2HMSA 4A3SA 1EK0A 4EARA 3F4LA 3A9RA 4R2LA 3WK4A 5CD9A 3CU5A 1CUXA 5KJEA 3B89A 5LOVA 1ZJJA 1R6DA 2B8NA 2D74A 2FSFA 4MUAA 1QGED 2XCTB 1ZEJA 3P0JA 3KAKA 1ODCA 1T4BA 4N47A 2JEZA 4MV7A 4RHEA 4TVBA 4KWCA 1H9CA 1CF9A 4I2VA 4TVAB 2O8CA 4NCKA 5E7MA 3ODGA 2OXTA 3VR5H 4W9NC 4BWGA 3V3KA 2FG6C 3WGJA 3ZN2A 2XUKA 1NSYA 1WZUA 1E3QA 1QO0A 2P5TB 3EQ7A 3QU4A 3S70A 5HUQA 1OH6A 1VYUA 4J1TA 221PA 3TNYA 5LJLA 4CM9A 4FNAA 4ZVPA 4AJ1A 2IZ0A 2PLFA 2M1XA 5KNBD 4NDNE 1DXOA 3D8SA 1Z0JA 3GMTA 3PQ5A 4FEGA 4EABA 1E8DA 4KR0A 5HFAA 4CT0A 4LG1A 4NZPA 4LWZA 5K05A 1P2GA 2VXCA 3OPQA 4I08A 4U6NA 1TUGA 2I7VA 2AMYA 4LNUB 3EEFA 2FG5A 3LCJA 3GNLA 1KGSA 2NV2B 2Q8PA 3DMTC 2DXTA 3F97A 1O08A 3DR3A 1JJ7A 5ED4A 2QD3A 5CT6A 4LY9A 4YUWA 2OBNA 2P6NA 1JWAB 5JLAA 4FTWA 2BHNA 4QFMA 4XCVA 3TUIC 3SU8A 2DF8A 3UMVA 1V26A 4K8OA 4Q3EA 3E9DA 4GZ3A 4P58A 5COQA 2Y1LA 2QL6A 2QXUA 3QOXA 4ABYA 2G0AA 4XUEA 5JRJA 3FHJA 2VJAA 2AOVA 3K3PA 4BQNA 2ZJ8A 3WICA 2IGTA 1HTBA 3DHVA 4LXQA 4U3JB 3S5UA 1H2WA 3KFXA 3OMWA 4GICA 3L7BA 5KOHA 3CVXA 1HWYA 2AXQA 2XNCA 3CKYA 3KZOA 3W90A 1EJ2A 1ZO8A 3DOIA 3JQFC 3PNSA 4N3CA 1NNHA 3N39C 4P83A 4Q3CA 1SXJE 5FX2A 1CEEA 1YRWA 1OH7A 5JADA 3BXFA 1VSUA 4N7RA 5KJFA 1A8PA 1L1RA 2P77A 2V7XA 1SK8A 5EJ5A 5K0BA 2QRVA 1I30A 2A1UA 4GZLA 1BQ4A 2EFEB 3GYGA 2O2EA 2BC9A 3IV9A 2FYTA 3QITA 1Y7HA 1U02A 3CRNA 5CNJA 3MMPA 4KAJA 3W4JA 4CVNA 5JSHA 2GDZA 3K35A 3CVYA 1XYVA 2C3MA 4G2TA 3TDKA 3KJQA 3ER8A 4PYLA 1V8BA 3R0VA 4HUQA 3L7NA 3T9AA 1A5TA 1R74A 4UPVA 3QWBA 4L87A 1Y1RA 3WRWA 3PIRA 4CU5A 5DNCA 2A1IA 2ZTGA 1YC2A 2G1AA 2QK4A 2OWEA 4RK1A 1T8PA 4OH1A 4B4KA 3RW9A 3H4IA 4XGRA 3WBBA 1PE0A 2VNKA 2AQHA 2J6HA 3B82A 2P5UA 2IUFA 2QTVA 1VI6A 2C5GA 3C6MA 3HE3A 2WHQA 3KEGA 1VP3A 3QVJA 4MEAA 4YA6A 4MHSA 5FNVF 1A2BA 3RRXA 4CIDA 4JBWA 2O48X 2Q9BA 4Q7KA 4KVAA 1L2TA 3JD4A 3EPLA 2EWWA 1UXJA 3ZXIA 1RI1A 1PT9A 3GU3A 1W25A 2JIRA 3JAWB 3KXDA 2C3OA 1E5TA 2W6PA 3LL7A 4A0GA 4EMSA 1Z63A 1OT3A 4RVCA 2P7HA 4B7CA 4BBZA 2FB9A 5LQNA 1E1YA 4QZVA 3E53A 3FPJA 1IDOA 1FSPA 2QQ5A 3ROXA 3KELA 4CL0A 1CZOA 4GC9A 1TTHA 3F5DA 4KLZA 4DGQA 4LJYA 2ID8A 3KOOA 4IUDS 1TT7A 3QVGA 4ND1A 2OG1A 5IFLA 4MWOA 1JR4A 2V7PA 2C7OA 3DXXA 3D54D 4M86A 2C4UA 3G8AA 3TO5A 2W98A 3A6EA 3AG6A 2PX5A 1DE0A 5I7AA 1MP0A 5A3VA 4B3SB 1A76A 3Q9LA 2O2GA 3DBRB 4F4JA 5F2NA 2QEQA 2V6IA 3FLMA 4G1VA 4GEKA 1P1FA 1B8AA 5JH7A 5KQSA 4IDDA 4OAPA 4QBFA 4WFIA 3K8YA 1A2OA 1BFKA 3FWKA 4OJMX 2AFRA 2IW3A 1JEQA 2WDZA 1ISIA 4ZDJA 5BY2A 5CA1F 1AQIA 1ODLA 1DKMA 1D03A 2PXCA 3M6FA 3EC2A 5K3SA 5T3UA 3KDAA 2H54A 2RGYA 2FAXA 4KQFA 2ZVPX 3SFVA 1KSGA 1PYOA 1SHUX 3JQGB 1CY8A 3OE5A 2CXTA 1YBAA 3PIIA 5I7HA 5DLQC 1BKSB 2W0MA 3ZK9A 4L9RA 3MWDB 4K1XA 1T4GA 3ICPA 4B47A 2YRWA 5EXDA 4DWOA 3VH2A 5K0GA 1ZIYA 1OLSA 1IH8A 1OB2A 1V4BA 5HFNA 4DDTA 5BN4B 2ZGVA 2IP4A 4I3GA 2QLBA 2XUHA 3ZWYA 1CRLA 1QH8B 2IEDA 2C2WA 4GLFA 4F9FA 4XU1A 1GAWA 4PLGA 4AFNA 4DGSA 3RSFA 1U2GA 2NO0A 4HZUA 2WWVD 4IIFA 2AR0A 3S1SA 3P2EA 4KMOA 4KWHA 2AXPA 5JCPA 2VAPA 3LYUA 2A7XA 4GX0A 1KO1A 4Z4HA 4HI0E 5KYWB 3A7AA 4OMDA 2VF2A 2WJ3A 4AZ3A 5CH5A 1NW4A 2ZATA 2CXOA 2ZRHA 4R1MA 1U7XA 5K8CA 4X3OA 1J0DA 3TXXA 1QFJA 1JLRA 3HTZA 2W2KB 3CPJB 3IMGA 4GPD1 4JBXA 4BJ3A 2A1TR 4YP1A 1ZP6A 4TYMA 1C4WA 3T95A 1G2QA 4HBZA 3RS4A 1SIOA 4OBEA 4AJ9A 1H85A 2BKVA 5JZ9A 4WT7A 2VUHB 1PNVA 3HJCA 1LCIA 2PQ0A 4M54A 1SBQA 1TZKA 4RJIA 4EFKA 3WLOA 5C52B 1WLYA 3ZE8A 4HGYA 1LRKA 5JNUA 4Y6SA 1LPOA 1L4MA 1MTZA 2CCJA 3DAFA 4HPWA 4IJUA 4LZNA 1KHTA 3NVKI 2G63A 2GZ2A 3EZLA 4LSMA 4JR0A 3CE6A 4ZEOA 4MUKA 4OP2A 2UZIR 3T0GA 3GK3A 4YRMA 3AV0B 3Q9UA 5BRJA 1V3VA 1NXVA 2PGDA 3ORFA 1W36D 1CUYA 2BJHA 3ROKA 3PGLA 5A7HA 5LP6C 2JBHA 3JXEA 2GEKA 3VPHA 2HW8A 2V0NA 3VBBA 2SCUB 4JU9A 1L4LA 5K0SA 5DSXA 3ZBUA 2ENWA 1F7UA 4BASA 1YR6A 1I6KA 5H7XA 4YMLA 3FFAA 2XHZA 5CFOA 4ZOAA 1AKEA 1NVXQ 4F97A 5LXTA 3OETA 3EFSA 1O94C 3U49A 1EOVA 2TMDA 4RGQA 4LXTA 2PTHA 1UWKA 3K0EA 1N92A 3DL7A 4M8IA 2HREA 5LQSA 3GLHA 3RJZA 3V7FA 3JWIA 2JLAA 1FS6A 1R0WA 3EARA 3QX7A 1UAGA 4KIUA 5CX1B 1RAGA 2XWSA 5KAMA 1E7YA 3RT1A 5IC4A 3FWPA 2ZFUA 3F2VA 3IX7A 4MV5A 5DZSA 1JU3A 3LQ1A 1VE1A 1L7NA 1NQXA 5F3WB 2PKQO 3T5DA 1Z5VA 2J4CA 4YJ2B 3N8DA 1SOUA 2R2GA 4Y6GB 1N6RA 1YO6A 2Z4RA 2QJOA 4PANA 3B1JA 2VO1A 4QOJA 2PUCA 1CUHA 4I6JA 1U3UA 1T2FA 1KIAA 4E70A 4TV8A 4G26A 4ES6A 1J00A 3B9RA 3DO5A 3T34A 2QTTA 4NCIA 2Q07A 2OD2A 3T94A 4PPQA 4KVFA 4MINA 2KLBA 1W44A 3ZKWA 2QIPA 3T5TA 3LO8A 4URXR 1GADO 4NIMA 3C7DB 3MWEB 1Z0KA 2VDPB 3OCZA 4UAVA 1P73A 1T9KA 3AKYA 5JO0A 3KC2A 3AFIA 1H5NA 3A5ZA 3H13A 4B7UA 4IH1A 4D6PA 1SQ6A 2CB0A 4H1HA 3WLIA 3N0XA 3PK0A 1XKLA 3PEUA 3OCVA 4KNYA 5CG1A 5K99A 2EVWX 1KPGA 3AUUA 1ELOA 2C5FA 1KFKB 3U26A 4ZRNA 3GPDG 4BMVA 3TEMA 4M1SA 2EF1A 2B34A 2IZ5A 1B41A 2X8LA 3FI9A 3RSHA 3VPFA 4A8PA 5BYAA 1U8TA 4WEOA 3EY9A 1C3OB 4IIXA 3HB9A 4WN9B 4RF4A 3W34A 1H69A 4L6IA 4M8KA 4K0RA 3DKPA 3ZC3A 3WRXA 4HAYA 4OUDB 3TOCA 3HVHA 1QB8A 2QA5A 2BGRA 1UANA 2EFHB 2PMDA 4IIJF 1U7DA 3VOBA 4DF3A 4MQ4A 11ASA 5ALNA 5FT9A 4F5DA 1FW6A 5D6OA 4HYYA 2SKDA 4PFQA 2VN8A 4ETNA 3IUPA 3QPDA 3RU9A 2VXYA 3ND6A 6CHYA 2OECA 3GELA 1G7SA 2QAIA 1XZBA 2XZDA 5GVSA 1E2EA 5CRIA 1YRBA 4MWCA 2ZE7A 4CIYA 2VDJA 2YV1A 3AFOA 1CFZA 4LY6A 3UB2A 3VBCA 3RF7A 3AG5A 3BCRA 1OYVA 1KBQA 2IYOA 3CEPB 5IF3A 1EWQA 2GN8A 4G81A 4TZ6A 2CDRA 4JYCA 4MMZB 4CL2A 1FZQA 1NNLA 1LV7A 3F6RA 1Q74A 2PK3A 1QKIA 4YMWA 4OK5A 1C3JA 3U4QB 4TZ0A 1FFGA 3QXXA 3HFGA 2O52A 4FK8A 4PG5A 1DG9A 3T7SA 3Q98A 1YB1A 4E2WA 4KXNA 3UHJA 5C5EA 3PNMA 3R5JA 4ZALA 3WR5A 1QHNA 1JSZA 5LOVF 2GFHA 2JJMA 4K6MA 5B4TA 1K8YB 3W7VA 4EH1A 3RV4A 4YO7A 4BNKA 2AH5A 2ASEA 4WBSA 4CG3A 1C0LA 5HP4A 4FT2A 1SU7A 3KBBA 1RPZA 2O8BA 2CXQA 5DW3A 3H84A 1SXJA 4IF4A 3BG5A 1A7AA 1S4MA 2QHVA 1W2WB 2ZR7A 1BVUA 2OZPA 3WFIA 4DJFC 3IEPA 5KWSA 2Q6TA 2IYAA 3HN6A 1P9LA 1Z06A 4GP7A 4I2NA 1OROA 2IDMA 4LWPA 5AVKA 4QPZA 2VP4A 1EFUA 4EW6A 3L1AA 1FJHA 1GR0A 1D2MA 2OMKA 1BVYF 1M1XB 2Q5FA 1EM8A 3A6LA 3D0OA 3I6ZA 3U3JA 4EA6A 1AJEA 1RXSA 2IYXA 3PNOA 5A2QA 3T3NA 3STVA 2HSGA 2NUTB 2AG8A 3THWA 4DLKA 1XNJA 1ZITA 1BIFA 2PGLA 4JOCA 1P4AA 1MG0A 2EFJA 3REGA 1F12A 1ZDMA 4GR4A 5T4EA 5D3MA 3AHHA 4AO6A 1VE6A 4FFLA 3C3XA 3O6VA 3OOHA 1J7JA 3IB3A 3HB5X 1TAHA 5E8RA 3WB9A 5T4FA 1EFWA 2V3WA 1GGKA 4BU1A 1DKUA 1U3VA 3H6HA 2AC4A 4MV8A 1X77A 1FXWA 3HJRA 4OTZA 1EJ0A 1OXKB 3ND7A 1K6EA 1HYHA 4BLVA 5AUPB 3OPNA 2ZTUA 4PAQA 2FFJA 4K9RA 2Q0SA 4BL5A 4CPDA 2IEIA 1GCIA 3NFRA 3R3WA 4Y2TA 5IZCC 2G17A 2D4AA 3JQ9C 4G4SO 1R4MA 3FTQA 3FZYA 4TRRA 4UNQA 1XMJA 4R2XA 4JB8A 2A84A 4LEIA 4C5AA 2VL7A 3QWIA 1MAUA 2ZB3A 3UK0A 1JDSA 1MJGM 1MQAA 1Z0ZA 2DAPA 5C5DA 2BRUA 4OFWA 4LQDA 3H2SA 4QSMA 4ARZA 4K5QA 3K16A 2QMOA 3BWYA 3D3QA 1N2CE 2DTEA 4ER0A 1QUEA 2PRJA 2QTAA 4U1RA 4YI3A 2XCRB 1ZI8A 2VNAA 1CEQA 2F43A 2GCOA 2R7KA 4ITVA 3SSMA 1JSCA 1NNUA 2NO9A 3RJ9A 3TNLA 1WQ7A 3DV9A 1S2IA 4EP1A 3H87A 5TV2A 1CNMA 3DLPX 4G0WA 1N2EA 1NF2A 2H29A 1HLGA 1QHEA 4TL9A 4YONB 5E1OA 1NI5A 5LQMA 2YNMA 4ZTZB 1K66A 1J5WA 4KVGA 1RQRA 3E3LA 4B3IA 3K5PA 4AX8A 3D6TB 4MWTA 4DLLA 1RZRA 5HBGA 3TAUA 4KUGA 3TTYA 3TB6A 1MB9A 1QLJA 1CS0B 4JJ4A 2Q8NA 3ORHA 2X4DA 1LDYA 1A9RA 1ZN8A 3L3BA 3N6RA 4KDEA 1KI4A 3ZDFA 3OTGA 2W4QA 1GUAA 1GTVA 3ZJYA 2YUIA 1T13A 3C8ZA 4I1YA 3UV3A 5LMZA 1C9JA 1KJYA 5I8PA 3L6RA 5ALZA 1XZLA 2C8MA 5T8KC 5FNVB 3MAJA 3DUFB 1DBSA 2WAXA 3PL5A 3OIGA 3HM9A 1IBMB 2C92A 1O6FA 3RVPA 1T2EA 1SC6A 5ILOA 2BN4A 4D3ZA 1D2NA 3KJGA 4BLUA 3MUNA 4LNAA 3LC7O 4KP7A 3OMLA 4RDHA 4NE2A 1KI3A 1OXMA 2QG9A 2WFLA 3OY7A 1JIVA 4RETA 3KKOA 4W82A 4Q7QA 1JXAA 3W3SA 1F6DA 2HRZA 3ONNA 4QVGA 4KQ6A 3GFRA 3SQDA 2VCEA 1GNTA 3WIOA 5KTNA 4BLSA 2FV8A 3MW8A 3U4CA 4HWOA 1Z8FA 3V4FA 4PC3A 4ANFA 3EFOB 2ZIZA 4PXAA 3DDSA 1PNRA 2DFTA 4MAFA 1U5CA 4KKVA 3VQYA 3KV3O 5IS2A 5EI5A 4QHSA 3VKVA 1RAHA 3KV1A 4TS9A 4YASA 1FNCA 1VDMA 4L4UA 5K3CA 3TTWA 3ZGYA 4H7FA 1N6NA 2ORVA 1WCWA 2Y0DA 2CNWD 1EG2A 3WY9A 2ZR9A 3AK4A 2GZSA 2RHJA 1ULHA 5AI6A 5KTMA 3ID6C 3DDNA 4DJDC 1U9JA 1YACA 1AKYA 2HWXA 2ZROA 3CNOA 1VKNA 1MD9A 2QQ0A 2O5CA 1AY0A 3C5EA 5FRDA 3K6RA 3ITEA 3J7AC 1GILA 5L6LB 1N5RA 3RS0A 1E1QD 1H2FA 2HWKA 3I2JA 5KX5A 3R5TA 1KZYC 1I33A 2VAWA 4M1EA 1OZGA 4RIIA 5C8XA 4YCDA 1BDJA 1VI5A 3IQEA 3HUTA 3BRCA 1YU6A 3A7RA 3KQWA 2DC1A 1KR2A 1YBHA 3I45A 2XECA 1KIFA 4TLEA 1R0CA 4BNDA 4DIFA 3GRRA 3CLTC 1JFFA 4Q3AA 4WMLA 2WMYA 4CMJA 1WSDA 1NAIA 5ILGA 2GKSA 5JNSA 2ESRA 1KXJA 2WHPB 3GRCA 4C7OA 5CA0B 4L51A 2OA0A 3B7PA 5DMXA 1N1GA 4TLBA 3NCTA 2WTNA 3H3JA 4YDSA 1RJDA 5JWRA 4PZ9A 3VOAA 1TUIA 4UBJA 4HWPA 4PNEA 3ISTA 4MQFA 4P33A 4INPA 4B81A 3VR4D 3MGCA 4YCAA 1MOZA 2HK9A 4L74A 5J40A 1ETUA 4E4YA 1SU8A 1Z88A 3P9RA 4HX5A 3RNLA 2VOJA 3A25A 4OXKA 1FQOA 3BE5A 1RM4A 5FEUA 2EP8A 1SULA 4WJKB 1T15A 4AX4A 2WLTA 1P91A 3L0OA 2R1ZA 2G0TA 4L75A 5FXMA 5BRNA 5DLDA 1WHTB 3WI7A 4RULA 2J3JA 2IH4A 1Z6PA 1QMGA 4HGRA 3H97A 3AR7A 4B46A 4B2LA 4PQEA 1XZKA 1KFJB 1NZJA 3MG9A 3DMPA 3WK6A 3U7QB 2XE8A 2ODRD 2BBTA 1QTRA 2P9ZA 2PT6A 2O5VA 1F8FA 1MX3A 1JR3E 2C2OA 3I01M 3K72B 1OFUX 4G65A 5GONA 1NXPA 5D7NA 4NESA 4FSXA 4D9CA 3FTFA 2GAAA 1FFSA 2E2WA 1ULZA 3HHEA 2CKMA 2C96A 4WOCA 5AK6A 4ZU1X 4CIVA 1RQ7A 4C2TA 1XAIA 4HEJA 2PZKA 1P75A 4X7RA 5DGIA 1HT2E 2ZJZA 1C8KA 1SCKA 2IXFA 3QVUA 4NFLA 3LUCA 2OHHA 3C3AA 4KQJA 4PNZA 4WCFC 5LR6A 5JYEA 2K6GA 1HBJA 2AS0A 1EGHA 2UVDA 3H04A 4IGFA 1PDWA 4NDZA 5HRUA 2ZAMA 1DJLA 2GPNA 3B1ZA 3H1GA 3LIIA 3S28A 4BV8A 1DBPA 3WKDA 5ERXA 3DFIA 1AKVA 4XQEA 1KP2A 2DPGA 2YXLA 4Z6KA 1ZLXA 2VRWA 1X7XB 4XW2A 5EAIA 1P80A 4QYXA 1YE8A 3GYBA 1AQYA 1KPIA 1XVUA 2D3TA 3O2NA 3UGKA 3VXKA 3S99A 1YZYA 1GZ6A 4TV8F 3FOZA 2A0YA 3RVLA 1KI6A 3UMJA 5EP2A 1TC2A 3OBBA 1I2DA 3TH5A 2AFHE 1G3IA 4ND7A 2H4XA 3VZRA 2JJ1A 4PG8A 4X97A 1OC2A 3BFKA 1W48A 3GI1A 2RGCA 5HKBA 3RKSA 5ICSA 3U17A 2P2DA 4AKIA 2YBEA 3DA8A 2XNSA 3A4YA 3Q3EA 3OURA 5TJHA 4BYMA 4CMIB 5EYPB 2VWGA 4BEVA 3GFPA 1KJQA 4MVJG 5IDQA 2PRKA 2ZBQA 1SUEA 1NN0A 1UEXC 1UKEA 1J4AA 1GRQA 1F48A 2LUOA 1F0NA 1KQFA 2V6GA 4RA6B 4TT3A 2AI3A 1EK2A 1WV1A 1SKYB 1ZQ9A 2BLLA 2JIBA 2VWHA 3C4VA 3DOFA 3KUXA 3PWSA 3TKLA 1A77A 1WEHA 2ZCUA 1NZFA 3HCFA 5I7UA 3EF1A 3W4KA 1Y1TA 3KPYA 4N5MA 3CVVA 1T34A 4YAKA 4RABA 2AKAB 4RX1A 3D3WA 4P3NA 4B80A 1CF4A 2GYWA 4PYNA 4FDUA 1Z4OA 2HEGA 4NZYA 4W99A 1QAOA 4R1NA 1ISMA 2QV0A 3OQPA 4ZYUA 1FNDA 4V0QA 1Y4UA 3OE4A 5LC1A 4HH1A 5FHRA 2WUDA 3M6AA 4IGAA 3E7XA 3TECE 3DLHA 3HFZA 3QUTA 2F1OA 4XDGA 1M6VB 3WKAA 3F7NA 5DNEA 1PLLA 2QP3A 3Q8MA 2Q4DA 3NALA 1BCRA 1G8PA 1ZZGA 3RROA 3VYVA 3OUZA 3AKZA 3SZ3A 3KR2A 3QKWA 4C4OA 4J2OA 4JJGA 3CNHA 2P3LA 3ANMA 4EKEA 3PX2A 4LZWA 3EWNA 1RT9A 3PVZA 4RXUA 3K4PA 4F6CA 2DFDA 3V8BA 1F2UB 1HNNA 4NFSA 5ITZB 2HLDA 2HCFA 3LVFO 1X92A 4NH4A 4IDCA 1YB5A 3NH9A 4N7BA 2IZOA 2E48A 3M2TA 1QV7A 3HFVA 1UMCA 1WBJB 3IUYA 3OJFA 1V11B 4XFKA 2PU7A 3OEWA 4I9UA 1M2OB 5I9BA 1Z28A 3KB1A 3SE0A 1CE8A 1Q1ZA 3LKDA 3AF4A 1X86B 2GBGA 3KJNA 5FI0B 1OJ7A 3FAZA 2QTGA 1M9NA 1C7ZA 5LOVB 3AMVA 1N9GB 5HK8A 1VL2A 5H5JA 3UFXA 5KWVA 4D26A 3R6GA 4HLNA 4HQKA 4BGEA 3QIAA 1N57A 1QAQA 2PBLA 1NVTA 2EFCB 3E9CA 4ZT3A 5AUNB 1T9CA 1F2VA 1N2CA 2A9JA 2JDIA 4DLPA 2HA0A 3GVXA 3LVBA 4IAOA 5ERGB 5HM6A 3UOGA 4WPGA 2H1CA 3RF1A 2R5NA 5SZIA 5K6RA 2IHUA 3O2JA 1VMIA 2WP0A 4K0KB 2GGSA 1TJ5A 4EDFA 4TS1A 1KL7A 3OE1A 2HU2A 4TYNA 1EGMB 3R7BA 5E3IA 4K6HA 1XTUA 4XJXA 4N0MA 5H16A 4E08A 1EGQA 1FRNA 3VPSA 3D5EA 5TQJA 3CQ9A 2JK1A 2KB0A 4DIUA 1YT5A 3E5NA 4KDRA 5E7IA 4IKEA 4LRSB 1UKVY 1O3YA 3W2TA 1OX6A 1MAVA 1T2AA 4ZJYA 5G0UA 4B33A 1KZGB 4GMXA 3R0ZA 1R8YA 1M83A 5EKUA 4IIYA 4N0QA 1FXWF 5HJEA 1LTHR 4AKGA 1V6SA 1DX4A 2AZDA 2VWPA 1ZU5A 4G6ZA 2AZTA 3I2IA 3NM4A 1QZXA 4CCSA 3Q8LA 3SQNA 4E0BA 2OGTA 3LUPA 5A0FA 3WGZA 1IN5A 4NG4A 5TARA 3HBLA 2B5WA 2OILA 1P3Y1 4LBYA 4RS3A 5EIFA 1EFDN 4V03A 4WUTA 1W85B 2B94A 1ZUIA 1CUCA 1M2WA 1KY2A 2E82A 2F1RA 4FKMA 5LLTA 3D7NA 5AVOA 4GVXA 4NBTA 2NU7A 4LTNA 3E22A 1YCFA 2WZBA 2I1LA 2DTXA 4DV3B 2R1VA 2I7XA 3RVMA 1QQAA 2A9FA 3KWLA 5KOHB 3F0TA 4HMQA 4NNJA 3AJ9A 1ZR2A 4RPJA 3HUEA 3V32A 1Z6ZA 1QYIA 4OYYA 1ZCFA 5TPZD 2IYUA 5EMMA 1G7TA 3JV7A 1J2EA 3JYOA 4K6KA 3TBKA 1JFVA 3BJMA 3MGBA 4I4CA 1N5LA 3CJRA 2A1UB 1YGYA 5HRCA 2C5AA 5B2EA 2XB8A 3BQ9A 2BY4A 3PFWO 4GVPA 4IP0A 4UAUA 1MC5A 2H2HA 3OEHD 3WGVA 1DUSA 4MUMA 5K8IA 1TPZA 4RTOA 1WG8A 4BP1A 1QQTA 3LPCA 1EWYA 3PRYA 1PK9A 1EAMA 4HDSA 5H1YA 3K71B 4AYTA 4MP3A 3WLRA 1L7MA 4FMPA 5AOVA 3AY7A 4DCUA 5J4VA 3LT5A 1F60A 1G2PA 2H1HA 4FYVA 4UXIA 4B73A 4QEKA 1MOSA 2G9ZA 4HUQB 2FA9A 3SYKA 3ZD6A 1CQPA 5TQ0A 1NXXA 2F4VB 5KTRA 4UOZA 4F92B 1JJFA 1UBRS 3GX1A 3UJAA 3UHOA 1QBKC 1CUFA 1D7AA 2QTVB 4H1TA 4BB5A 1E2UA 3TS1A 1UBTS 4QDTA 3WSWA 1Z7EA 5FPQA 3QHQA 4G1FA 3O7WA 3T1TA 4XPZA 2PQMA 1KDYA 1ZD9A 3SS8A 3FGPA 2DSTA 1YDWA 4HEA6 4PG6A 2I4OA 3D2CA 1U8AA 3L46A 3BIXA 4RADA 2XEXA 3A3OA 2I2AA 1EFVA 4BNXA 5L40A 4EHDA 1FLDA 2A30A 3M83A 2FFAA 1TM4E 1KDVA 1A50B 2C98A 2GZHA 4ZYZA 3GZTB 1V8OA 3A31A 4QU5A 2EJTA 3EN0A 2NT4A 3R2JA 1MA0A 1BKDR 1TK9A 2CHQA 3YASA 4DSNA 1OYYA 3BGSA 1AMUA 2C7QA 2X3FA 1P5RA 2Y92A 3TDNA 3TIFA 5JZBA 2GEJA 2DETA 4P72C 3A9TA 4FHZA 4UNSA 5A5VA 3V7UA 3G79A 3AP1A 2XUGA 1SQ5A 2ICAA 2Q5LA 3EFBA 4DMUB 5JH7B 3AU8A 4NCJA 1QIDA 2PUAA 3IEVA 1IPEA 2BCJQ 2O8FA 1HE3A 1NW5A 1UJMA 1ZVJA 2XUIA 2I22A 1EZ1A 3GGOA 1HRKA 1E6MA 4EAAA 3OIDA 1NPYA 2C2HA 2SKEA 3DO6A 2B0CA 4GO1A 3T9FA 4V0OA 5AVVA 3R7AA 1XLUA 4MWEA 1JR3A 5DGXA 4K9QA 5TDHA 4C4RA 4ZOQI 5HZGA 1A9ZA 2PR2A 5ALFA 4NE9A 1GLVA 4FONA 1JQEA 4DDUA 1X14A 2BFBA 4WFJA 2EOAA 2I55A 4GRAA 1H4TA 1OLSB 2O7SA 2BHTA 2FMFA 2NZVG 2QN1A 4OJKA 3PGJA 4CTNA 1W88B 3AKCA 4X3PA 4C88A 1Z6YA 2HCRA 1XTQA 3H11A 3AJRA 1MW8X 3R5FA 2V7QA 2ZVDA 1EUYA 2I6XA 1OA0A 1D6JA 4JODA 4CKEA 3FN4A 3L49A 4HZUB 3V2GA 3KQVA 4C3ZA 1P1HA 2VPTA 3CEAA 2BYTA 2ZXFA 2AUMA 2HBQA 1DP4A 1XA0A 4AWAA 4UE2A 3Q3VA 3P9YA 2A0WA 2IUUA 3HJNA 5CDUA 4AZ3B 2KE5A 3KIPA 3NBQA 1NHGA 3BIJA 3D0RA 4E22A 1MHPA 5AJYA 4ECAA 5CIYA 5EZQA 2BPOA 3DKKA 2ZZKA 1VQ1A 2WQ6A 1O6GA 3KXPA 1NXQA 1Y3HA 2O7VA 2QTMA 1K98A 2ZB8A 1XTPA 1CDZA 3QQ5A 2PV7A 4M21A 2QMUA 4GXRA 3MTEA 4PSAA 2NNLD 4DDVA 4A23A 3DMFA 1BDIA 5A0VA 5JJLA 3KHTA 4ARIA 2AFHA 2H17A 4KFUA 3EBLA 5IG2A 1H8ED 4FR2A 3DVSX 4KFTA 1P5FA 1ZL2A 4DIOA 1GCGA 2AOUA 4L85A 5TMPA 4CFZA 3ZJ5A 4HYTA 1ZMXA 2E1PA 4H59A 5FLXA 4AMBA 1OWMA 3QSYA 1S9HA 1U0EA 3E2IA 3QF4A 1L0WA 1UEIA 1EXNA 3EJWA 3HQ4O 4Z9BA 1OIVA 3LWBA 3N05A 5CVUA 3RFXA 3LUKA 4C06A 3M34A 2H2AA 5ER6A 3NTLA 3OAAD 5DN6A 5EJAA 4ZO7A 5LUBA 3KDSE 1HDZA 5IJWA 1DCTA 3AZQA 5HDQA 2FMKA 3ROFA 3VSDA 1KA9H 4N7MA 4D98A 1E1CA 5JXJA 4P2BA 1IY8A 1NBOA 2W71A 3UC5A 1PNQA 1UZNA 3V8NA 1QPZA 3EDYA 4HWSA 1LFAA 4KRXA 2A0XA 4RE5A 3PUYA 3W2EA 2F3UA 3K1JA 5SICE 5LXTB 1XK6A 4G4GA 1MUUA 5BR4A 3ZX5A 3WGYA 1HL7A 1PZHA 1QB7A 3GJ4A 1SVMA 5EUQB 3JAKA 3UMCA 1L5VA 3G2KA 5TE9A 3ZWNA 4ZHSA 3GLHB 3M6LA 4MV0A 1OKKA 1ZGAA 3WKEA 4NRDA 4TZTA 3AIIA 3CXUA 2XV1A 3Q0TA 5C1IA 3PUXA 2GK6A 2WIKA 4I99A 1V16B 4UUOA 1RYDA 1YDGA 1KMHA 3ZDDA 3DPSA 5HZKA 3U19A 2VSFA 1N5DA 2BHSA 4LWQA 1GVHA 4AJNA 2I5PO 4KNVA 1NBWB 2RHLA 4CM9D 2FMXA 1F38A 1G3RA 2IEAA 3LUGA 3D8TA 3ZTYA 2MR6A 1GNQA 3K73O 4FIDA 4M7WA 2XBMA 4WADA 1Q0QA 4PXSA 3KAQA 1CHNA 3MB5A 3ZKWB 5EMNA 3I9V1 1QHSA 2CLKB 1GIAA 4YMSA 5DEOA 5HF5A 4G1CA 3IALA 1VKRA 1K3UB 3NONA 4RCZA 1X2BA 4UBIA 1B6RA 3ZQKA 2JLQA 4Z0HO 1E1NA 4LS3A 3U7JA 2YOGA 4ZJZA 2AQ8A 2E5AA 1H8HA 1YXMA 2ZI7A 5HIJA 5EWMA 1BVRA 1RYBA 4YMVA 4ZZ0A 3MCZA 3RASA 1UP4A 2F2TA 1ODIA 3I73A 4NY1A 4QQKA 2Z5LA 2ZJ7A 1FLNA 3OJEA 1YHNA 3P5SA 3LCCA 1O0BA 1FTNA 1W8IA 2YY5A 3EFRA 4IRUB 2QD4A 3TRIA 4XVCA 3GMIA 3UANA 3K0BA 3NATA 3NHLA 1CRZA 3A9CA 3P97A 1PQYA 2QT1A 3TK1A 4CCYB 4UXJA 2ERCA 1QDEA 3GN1A 1AKTA 2NPIA 1XQYA 121PA 3WGGA 4QOGA 4PCLA 5FPSA 3RJ5A 5KDDA 1Y1PA 5HVNA 4IF6A 4X62B 4G5RA 1EB8A 4H7EA 2EQBA 3A9VA 4H16A 4KYTA 2A9PA 3BMQA 3EGDA 4G1UC 4NYIQ 3ASYA 3V97A 4LHEA 1W0JD 3N8HA 3WYDA 4ZT5A 4EHAA 5B3AA 1IB0A 2W2XA 4NAVA 3ZTTA 4Q9HA 1PR6A 3GJYA 4JLOA 3TBFA 3DWIA 2Z3VA 4ZVMA 4C0LA 3MT7A 4UHJA 3TDMA 3ZE1B 2ZREA 5JQGA 1DTWA 1GL3A 1NASA 3EUEA 5FLYA 4F85A 2CFOA 3BREA 2P68A 3NHYA 1PI3A 1XZPA 2VK4A 3WWOA 1JLSA 2CE2X 3WNQA 4HVCA 1YQUA 1CP2A 4L0CA 4YEDA 4JI5B 2YXEA 1AS3A 1KF0A 3DTVA 3OZUA 3ESZA 4DNQA 4H7PA 3RS7A 2J07A 3CO5A 5ALUA 2VUUA 5ALVA 3PC3A 2YCLA 3EQ6A 3FCCA 5EA2A 2D1SA 3G9XA 1U0FA 1YAHA 3G5MA 1YJBA 3GT7A 3L6DA 4OQNA 3O4FA 4XDYA 2ZYIA 3UAWA 4ZV7A 3WTCA 1QZUA 3M3PA 4OGFA 2RHSA 3C1UA 3IP5A 4R3WA 4YUVA 1BOFA 2O8BB 3JQ8B 4M1OA 4BVEA 1SXJB 3U80A 3DZGA 4KTTE 2V54A 2WKSA 3ROTA 1FEZA 3JZFA 1XAJA 2QMZA 1VL5A 5ANRB 4C89A 3DBLA 5JVDB 2MSCB 4TRMA 4IX9A 8OHMA 3HSSA 1LSOA 2AGVA 4BZWA 3HR8A 3DMHA 4INAA 4KYVA 2YHAA 3U5TA 5EHZA 3LP5A 2IY5B 1EM8B 5I9NA 1JMYA 1D7OA 3F71A 5AKGA 2FX2A 1K92A 1RYZA 3R44A 4B9EA 5DLPA 1H6AA 5KC9A 4L15A 2JFQA 4EY7A 1PUXA 3BF8A 3THWB 4YAWA 3UJNA 1PYDA 3DYVA 2QXTA 4JL8A 4O4JA 1N8NA 2FTKE 2HWUA 2NZ8A 2VJPA 4WA8A 5D5HA 1O5IA 5H68A 3RM3A 1AKMA 4JYBA 5D3MB 2RGNA 3ADOA 4QUDA 4DM3A 3DLBA 3EBPA 5DHTA 1PJAA 1ZQ1A 3HU5A 4J0CA 5I4KA 2H7VA 1R2QA 1ORIA 4MQUA 3DZ8A 4BNIA 3QLEA 1SJ9A 3R3ZA 4EQZA 3WMXA 1G66A 1XK7A 3GJ7A 1NJSA 2EJUA 4J7AA 4RKRA 1SBNE 3LC1O 2E4AA 5PGMA 4BBJA 2AX3A 1UXOA 2IV7A 2OKGA 1EK5A 3NBMA 1RWOA 1WUKS 2JFFA 3C74A 4MQLA 4OH7A 4LDPA 1JKFA 2O6LA 2OVFA 3PHGA 2GOYA 2X23A 1Z0SA 3IE1A 4OYHA 2XTJA 5K51A 3T7KA 1C9DB 4FLMA 2O2HA 4G0YA 3C5CA 2W4IA 1B76A 1J8QA 2AJLI 2OBFA 2EHJA 3D6MA 3JYPA 4L2IA 1GUZA 3WNCA 3ES9A 3RLIA 3AUJB 4AN4A 4DHWA 1DS6A 2C3UA 3BEDA 4ARZB 5AK5A 2R4TA 2E1HA 2WP8J 3W1EA 4FDLA 2C31A 5HGXA 1YDMA 1MORA 3B36A 3TVDA 3EZ7A 3E05A 4GSYA 3GFSA 5DNYB 1LPMA 2GCOB 4OVKA 3WLAA 2E55A 3HBNA 3QOFA 4DLYA 1SBTA 1JB1A 4KBFA 4LXIA 5EY5B 4G0MA 3DO8A 3Q7EA 1GZDA 2FWMX 3Q12A 4ZVSA 3OF3A 2VH1A 2ISSD 3LXRA 4PZPA 2WTXA 2JVKA 1JAHA 1P9RA 4Q47A 2PT9A 1I2CA 5AP9A 1UQTA 1S2LA 2A58A 2GPAA 4IHKA 3HA2A 4X1YA 1Z5UA 1LF0A 3UOAB 2O2ZA 4JLDA 3K96A 5IXYA 1M73E 2JAXA 1E61A 1RRGA 3VYTB 3DDOA 4X7PA 3E5HA 3PQDA 1UM8A 1KMQA 1QIHA 1GZUA 2D1RA 2J41A 2EQAA 2Q4OA 2XR1A 2OQIA 3AEZA 3L07A 3ZQ6A 1O4VA 5EN4A 3ORRA 1XV5A 3X43A 1J8DA 5JAPA 4ZQBA 3X0DA 5AQEA 5KSYA 4DV0B 1P1KA 4DT1A 2FG7C 4TWJA 1X1SA 4EX6A 3BHIA 3ZQ4A 3FCAA 1GPBA 2RHMA 1CJBA 2G5CA 2PRSA 2Q9AA 2CSXA 1PV2A 5JCJA 2Q3FA 2UYYA 2J7PD 4NVRA 2WFLB 3WL6A 3MLBA 3BF7A 1BH2A 3T1QA 1MCZA 2LWIA 3TQRA 3EDQA 1KKUA 3THXB 1KYTA 3IBTA 1TA0A 3RIXA 5BR8B 1OXBB 1JQLB 5BYKA 4N8SA 4IZHA 3R1IA 4YMIA 1NIJA 2BFEA 5A5EA 2G9VA 5BSTA 2QUKA 4CR6A 1KDTA 3F6PA 5KMGA 1J9ZA 3NDRA 1EUDB 4GMHA 1JAIA 3O8LA 4D46A 1N2JA 1F6WA 1TW3A 2HJSA 3A7UA 1A27A 2G6BA 2RAFA 2V7BA 3OPXA 1JPUA 4QT0A 2XYRA 3VVCA 3BBPA 5K09A 2IPXA 4UDNA 4R5MA 1GQRA 3SJCA 1NVUQ 2G7ZA 1MVLA 4FGKA 4ME6A 3FYHA 5LA6A 1VPWA 2CUNA 2QZPA 5AUOB 1RSZA 1ZJ4A 4MPDA 4ER6A 2BGNA 1ZVVA 4D74A 2DBZA 1UFKA 4XAQA 3R0QA 5HE8A 2HA7A 2AQKA 2F3QA 3T3MB 4KFCA 3HCEA 3F49S 2ZYDA 5KZMB 3WFZA 1WMEA 4QJ3A 2LVBA 2GA8A 1LPPA 3MUEA 3IPRA 3OBIA 1O87A 4LMRA 3CN7A 2W2PA 4C05A 4D0SA 4Y2GA 3W9BA 5KX5B 2OT3B 3KG2A 3BSSA 2IEGA 1MC4A 1M6WA 4FYJA 3C39A 4G56A 4K6FA 3EPHA 3TNJA 2VUIB 1VPTA 2JKVA 4YV0A 1NW3A 5EEGA 4MVJM 5JAUA 4I5FA 3SMVA 1F1JA 4BNDB 2VJDA 3JWEA 5ESDA 4WA7A 4BRUA 4B31A 3KVOA 1XSEA 4YTEA 3QE2A 1KAGA 4RGYA 2CYBA 2LNDA 2DHQA 3LPAA 3PHIA 4S04A 4C7OB 1QORA 3ABZA 3B5IA 2W11A 4N18A 2WD9A 1GQOA 1T8SA 2P4HX 4OGWA 1N3LA 3HYCA 1THGA 4YJHA 3GFQA 3NTQA 3BFMA 4B4OA 5K0JA 2A5GA 1PEKE 4QUGA 4WD3A 5I4BA 3WAGA 1JDNA 2EEPA 5G1OA 3RQSA 5JI2E 3UWOA 3EG5A 3BYZA 5AVYA 4PC1A 1DEXA 4B4VA 3ROMA 3GLIE 3U7IA 4GWGA 2UZ3A 1IU9A 2HIAA 3ZI4A 2WWHA 1OE0A 2GHQA 3K94A 3FG9A 1Y6FA 4NOMA 4FFNA 2HDWA 3G5AA 5LMCA 2JGLA 5TX7A 4B4WA 1I36A 3J81k 2ZRBA 3P8VA 1LB1B 2WTBA 4W63A 1WOYA 3RF6A 2EFGA 2WJHA 4WEQA 4R8MA 5FIUA 1WB4A 4YWHA 3IP8A 4DLXA 1L5MA 2VP2A 3QU7A 2QM7A 4QXQA 4JX8A 2Q9CA 4WY8A 3WRYC 5KOYA 1E3TA 3SYNA 3HXYA 4F2HA 2BWJA 5GONB 2N0SA 4OK3A 4U00A 5K7SA 3ABSB 2A78A 2J3LA 4MGEA 2Y8EA 1L1EA 2IKSA 4XIIA 3OLVA 4B3XA 5KJCA 4JV5B 3CJQA 3GUHA 1CEXA 1OTXA 1R50A 2WNHA 1YCGA 4JROA 3VUEA 4R41A 5JV5A 5ISMA 3AF2A 1HOXA 2J45A 4MH0R 4ND4A 1A1SA 5JARA 3F98A 1EX9A 1HNXB 2ZXUA 1RYNA 5KHLB 3JSAA 3DVQX 4XTRA 3NASA 4X1OA 1E20A 4AN1A 1G20B 4PBSA 2XGSA 3NTOA 3OQIA 2JCGA 1DLIA 1IVNA 1SXJD 4KGDA 1GTG1 3S2YA 3I5XA 2FPXA 5FBRB 1NQAO 3L7JA 3LW7A 4M2LA 4D3FA 2CHGA 3ZQUA 2EKLA 2P65A 1Q7CA 1QFMA 2EW8A 2LP4Y 2E3CA 1X1AA 2HF9A 4CKCA 2C7RA 3Q1LA 4CEJA 1UZMA 1YBMA 3WLHA 4JIMA 1OOEA 3NNNA 1FUUA 1ABFA 2B9VA 4MCIA 2JEOA 5LWHA 1SG0A 1RU3A 3CSUA 3PA6A 1AU9A 3LP6A 2EKDA 1KI6B 3HBFA 5C1OA 2COUA 5CDYA 1XPUA 1C50A 1EFAA 3GOQA 4XEOA 1E4YA 2E9SA 4BLTA 1XYYA 1D09A 2XLCA 3OIWA 4PGAA 3ZCUA 3C14C 4Y8VA 1USWA 2BJWA 2HWYA 4QYTA 4NFHA 4W5NA 5JHHB 3VNVA 1U0HC 1H4SA 1A2KC 1Z2EA 1EJBA 4MROA 1JSXA 4ND3A 1GNVA 4DMGA 2CLSA 4L57A 4QATA 1E1RD 4UEQA 3AYZB 2VHVA 3X2SA 3LTNC 4Y1FA 3M4XA 4GAEA 5BOSA 3M6IA 3B48A 5CH3A 1XRLA 5AVUA 5JAQA 1Z7WA 4MWBA 2PMBA 4NBKA 3VV3A 3OPYB 1I0LA 1M54A 3QLVC 4L5BA 1EQ2A 2ZIXA 3G2QA 3DMGA 4XWTA 5TB5A 4Q4LA 4BB6A 3N28A 3EUFA 4FNOA 1TGYA 2PMEA 1FX1A 4M0EA 4MB0A 1MJHA 2Q46A 4TWIA 5BNFA 4C4YA 1JEYA 5D7BA 5IJ9A 4NJMB 4A16A 4JKYA 4C4XA 2Q0QA 3KOMA 2Y1XA 2F1IA 4K05A 2GPSA 4P74A 2D54A 3D3KA 1EP2B 3HN7A 2BEVB 4JBYA 4QGFA 2QVCA 2CSUA 1I2AA 1N1EA 2A0KA 3AJEA 1ZOIA 2W6CX 1XRRA 3PFKA 2IDJA 4IDGA 2GEDA 3IQXA 3L02A 1GEEA 3KSDO 2GI4A 2J3EA 3EA4A 4YI5A 4O2BB 5IAGA 2H9IA 4BRSA 2HXSA 3V80A 2FVXA 1AA9A 4C4SA 2AB0A 5FOQA 5MN4A 4GM1A 4H0CA 5FCDA 3TW0A 3EJ6A 4KQEA 1P31A 1BCRB 2OQ2A 1FLAA 4HNQA 1PW7A 2QRKA 4RMHA 1R6UA 2VP3A 5FLKA 4G0NA 5F2KA 5ALHA 4ZVOA 1EXVA 4DSTA 1K7FB 3HXPA 3M5PA 5JQGF 3ZHVA 5GIOE 5D3KA 1CVLA 4FZ5A 5KVAA 2YJNA 2Z6AA 3UMBA 3FDIA 2HMWA 2J9GA 5GZ6A 3DXFA 1PEYA 4JBNA 1DAMA 2QAJA 3EYAA 5B3JA 1RZRD 4YB8A 3AVTA 2PH1A 2O54A 1F0KA 1IHXA 5HOEA 4QG7A 1HTWA 3OT1A 4IFBA 1SUAA 1CE8B 3ECCA 2ST1A 3EC1A 4G0OA 3WK8A 2X2EA 1RPAA 4XEMA 3A04A 4R9SA 3UFXB 4WF2A 4EDHA 3H5NA 4LVJA 3ADPA 5IFKA 4NARA 2AL7A 1X8JA 2QSJA 2PM8A 2ZRKA 4G8DA 4ISCA 4L6AA 1HZZC 5B58C 2YJGA 3ITNA 4XLZA 3ENZA 1Z3CA 3RKUA 1N2CB 4LC0A 1X2EA 1Q17A 4WXMA 3C3KA 4BX0A 5J4LA 4BMDA 4J94A 3T8YA 4WKOA 3DT8A 4RQTA 1RQ2A 3IAAA 5G3YA 4IJWA 5KYUA 4YAJA 2EX0A 1JR2A 2JGFA 2PIDA 4RTLA 5BSVA 1JIUA 1H0KA 1QGOA 3HZRA 5TT1A 4EVRA 3BDIA 3HVUA 3NTVA 4P92A 2VZ8A 4HVAA 4WOBA 3F1KA 1ZGHA 4BB0A 5CFZA 1NPTO 3A2MA 1JKMA 2DR2A 1KEVA 2PXHA 1N25A 4O4JF 1KMNA 1KYXA 1R0RE 4HFMA 1D9ZA 3A4TA 3DV0A 5BQFA 3HEMA 4DV6B 3GEPA 3OJOA 3I72A 4PQGA 4Q93A 2H5LA 4UULA 1D0IA 3KPWA 3KO8A 3WIVA 3IHTA 5A4AA 2AUTA 4QA9A 1NYTA 2HTEA 4UDXX 4GMDA 1LS1A 3OA0A 4GUAA 2VLIA 1QDLB 4YREA 4LHXA 5G53C 2HMVA 4IDBA 5BYJA 5ITVA 3EX7C 4QQRA 3P26A 1RADA 2FETA 2B1GA 4YECA 1YVPA 3D1LA 5HYVA 4HX9A 1NJ6A 3T7CA 1KBZA 2C03A 4EYQA 3TI7A 4DSAA 1I80A 2VRBA 5IMBA 3C3YA 4AQ7A 2IS6A 4GYKA 3L4JA 5CM8B 4AF8A 2ASVA 4P5EA 2VZLA 4RKEA 3PQ3A 1GN8A 4HAOA 4LXYA 3I2FA 4CLOA 4ARBA 2B7LA 2W90A 3ED5A 2AMJA 4L02A 3WMRA 3TLZA 3KKLA 5A4JA 1NU8A 5DI9A 4PVCA 4XEHA 3ICWA 4N12A 4KQ2A 5B4VA 421PA 1W6RA 4O4LA 1P2TA 2NU7B 2WT9A 2GXQA 3E22B 2H1RA 3O8NA 3N76A 3Q6MA 4UM5A 2R1VB 5AKIA 4D9KA 3WLJA 3BH0A 3KYBA 4O2AA 4WDQA 4L76A 2P2SA 3L8EA 1QANA 2K2QB 1FNSA 1EIZA 2B2NA 3LU1A 3O31A 2HJRA 3ZWBA 4XM1A 1RR6A 1AA6A 2ZNJA 2ZYAA 5IAJA 3T0IA 1BCSA 1RM3A 4JFAA 2C2MA 4U2BA 2IV3A 4G5FA 4YRGA 3H4TA 3OPYI 4FILA 2GA9A 3OT4A 4KREA 1NDQA 3EPJA 2J48A 3K0CA 5HR5A 1SUCA 3CRQA 5TPWA 1Z7MA 4ILKA 1HFEL 3EXEA 1IY2A 1RZVA 1TTPB 1HYEA 1VHQA 2C9DA 1KEZA 2V0CA 1Y8AA 1X38A 2Z98A 4LOLA 4U9IS 4DB2A 2PBZA 1ZJ6A 2QG4A 3CX8A 3GCDA 5CYGA 2OAEA 1JA1A 3D0QA 5TQ0B 2D0OB 3HN2A 5MDHA 4WHMA 2VHTA 4ZIBA 4G23A 3GP8A 2AJBA 2ZB4A 5C35A 1WCXA 4H2SA 4Q82A 1IEWA 2IZZA 1ZONA 5A6VA 1SEPA 1NXTA 2BFMA 3DEHA 5BQPA 4EYOA 2MJLA 3R4CA 2VYVA 1XZGA 1J24A 4HGZA 4KIGA 3FXAA 4CKBA 3PYMA 4BMPB 4CCWA 5EJ7A 3HDGA 2PLRA 1U31A 1PVVA 3NWPA 3ONVA 3VC1A 4B48A 1N4DA 4G36A 4KIWA 2FR8A 1X7GA 3IKTA 2JAQA 4CF5A 4UUPA 5CBPA 3P9SA 3V4ZA 1VPEA 4A1OA 1EFLA 3OZCA 3EMBA 1EFVB 1Y4SA 4RY8A 5DU2A 1P9NA 3BTOA 3BX1A 1K2VN 1TQHA 3F7MA 3H8VA 1G9XA 3O0TA 1QTNA 3A9WA 1XEWX 4RAQA 4UZFA 4JVMA 2OV3A 2XOXA 4D57A 3GLGE 4B4UA 1EWRA 1R5NA 1Z0AA 4DWJA 4JSTA 3KVVA 5HTOA 1CVIA 1NE7A 3SJ7A 2P9GA 4WCDA 1H22A 2MSEB 5DYNA 1ZMOA 4D4MA 3TL3A 3CUYA 1GCUA 3HCAA 1V7QA 1EIYA 3PPWA 4I0WB 2DKOA 1E32A 1X9HA 1J6UA 4RZUA 1P39A 2JHCA 3FJ1A 3ZWXA 4GPBA 2QVGA 4EATA 2ZJOA 3GG2A 5EJ9A 3EVZA 5LA6F 3QUSA 3COJA 1J5XA 3NUQA 4LE0A 4BFCA 1G3UA 4GXQA 4QUAA 1D6SA 3D1JA 3I09A 3PE3A 4LWOA 2P91A 2GZMA 3EXHC 3GN2A 1KYIA 5J3JA 1E24A 1XQXA 1L7DA 5AWFC 2N1BA 3P0RA 4G4IA 4D9EA 2GZ1A 3HM2A 4FU0A 4YMGA 1M1ZA 2BFBB 5ECGC 5EFOA 3HL4A 4MO9A 3T99A 1N8SA 4K9DA 2ZDHA 3EA5A 1B74A 5B7QA 1KYVA 1OREA 2KS6A 3OPMA 4KK4A 5CW2A 1GZHB 3UWPA 2AE1A 3RRJA 3H11B 3D6JA 2PD4A 4FCWA 2VHJA 2IF2A 4M4SA 4HF7A 4BO0A 4G41A 2VQ6A 2I1WA 3D4PA 3G1UA 3N0VA 3HUFA 4RF5A 4WFKA 4Y1EA 4MUFA 3PQ2A 3ZWWA 1C9NA 1A0OA 2HT1A 4NS4A 4ZVKA 5CDSA 1E5VA 3DTYA 4TT3D 1ULTA 2PX2A 4J2HA 3TSZA 1TO1E 2EKBA 3FVVA 3ONFA 1JPNA 2RK3A 4QUHA 1D04A 1CRPA 4FJ2A 4QTZA 3TX6A 2R44A 3PFFA 2PKXA 2ZAYA 2V7GA 5JSFA 3VDQA 4EW3A 1P0IA 3DJFA 4V1CA 3RC9A 5BSHA 3FTDA 4WXRA 3DEAA 5GGXA 1JAXA 4K03A 5D00A 3S7ZA 1WDKA 1U8UA 1UPBA 3FVWA 4YJKA 3NPMA 4QUEA 1WPRA 2A7QA 1C9MA 4PLFA 5HA5A 4HATA 2GT1A 2H9YA 3K1AA 4MA0A 2AFHB 4KE8A 1P1BA 3V1UA 1I32A 2PX3A 3IP3A 4OFBA 5LZ5A 1NTRA 3CLHA 1ZN9A 3EZ6A 3FRIA 3MCTA 1BN7A 4UVIA 2YWBA 3O9MA 5DM4A 5EP4A 4AYWA 1U2GC 4IY1A 3ADCA 1M6NA 3ESYA 4UOQA 3ILXA 2GYYA 2FW8A 1WV0A 5JPCA 4Z3OA 1TRKA 1PJSA 2C7VA 3I6BA 1F8YA 1JTVA 2IXEA 2WUEA 4DJAA 3GOHA 4YV1A 1B93A 3LYAA 1CKEA 2HLDD 2JVIA 5CITA 1GOTA 4RF2A 5ALIA 3UPUA 4PWZA 2DXUA 3PEYA 4ARUA 1G291 2JJ8A 3HKEA 4ZMBA 1H2EA 1USKA 2FW1A 2JIMA 3LDAA 1IJKA 4Q3LA 4RBNA 5L3QA 3TCXB 3DF9A 3W9SA 1AC5A 1PJLA 4LJLA 1U28A 4RLFA 1GU1A 1WPYA 1UXGA 1VSVA 2KHZA 4GECA 4QLOA 5KEIA 1IC6A 1JDBB 5EL0A 1SQ0A 4URUR 2XD4A 1V2HE 3ONDA 1KEEA 1PLKA 1MJGA 4G09A 3VGJA 1MOQA 1U2ZA 1IE3A 1EHYA 2X7HA 4OA8A 1UP6A 3EZFA 2F90A 2VDMB 3QI2A 4QEDA 5HCIA 3ZE0B 1NN5A 4D82A 2IP2A 2QAGA 3AVWA 1AV6A 2DQYA 1I7QB 5IDWA 3IOEA 2ZR8A 1VE3A 2WSMA 5JDIA 3CMQA 4ZI3A 1DHTA 1KMHB 3SKVA 3VU0A 2NGRA 2R0QC 2Z1MA 3L41A 4WIAA 1HLPA 1EX7A 4YMTA 5LIPA 2EZUA 3O8QA 3UYLA 4GI7A 3WFJA 4GBED 2MYNA 3A74A 4OYRA 3OFVA 1MENA 3IV6A 4IBOA 1JI3A 2CJ9A 1QHXA 3HDHA 5E8JA 5KKAA 3RS3A 1FTWA 1Z8NA 2HBZA 4U7WA 3PB3A 1A8UA 3TRKA 3IVCA 2B30A 5AKZA 3PGVA 5G41A 2R7MA 2DKGA 3FZNA 3OE7A 4U7JA 4EJ6A 1A1VA 3MMNA 4DY6A 3EEQA 4MQEA 4OHWA 3F90A 1ITZA 4KUEA 1REQA 1BQEA 2PO5A 1RKBA 3LUHA 4GSLA 2XVXA 2BHRA 2I4IA 4PQYA 4PYQA 1WSBA 4CKWA 3F3SA 3WK7A 4FMBB 2ZJAA 4DSZA 1Z6XA 1VKJA 2CEKA 2OFOA 4IMIB 5EKDA 4N9QA 4KR9A 3HLYA 3S2FA 3BHMA 1NG1A 1H2RS 3KZCA 4CMAA 5EWMB 3VKFA 3DFUA 2Q4RA 2Y0BA 1JQBA 1JYEA 1M0TA 3NNSA 1AOXA 1FFHA 2W22A 3JCZA 2NWQA 2QE7A 4ZCPA 2JH8A 2P2LA 2VTEA 4YLGA 4DB4A 3OJLA 2YJ6A 1GV1A 3H5IA 3KZMA 3WAKA 2RB5A 1YMQA 4FCTA 2Q4BA 4KITB 4KJXA 4BVAA 4JP8A 2MR5A 3Q3HA 2W4MA 2JCBA 3H1EA 4GP9A 3A8TA 2H4WA 1GT6A 1JHVA 4J3NA 1G8HA 1NF3A 2UUAB 3AQ4A 1PZMA 4BGUA 4AIIA 4MGIR 1Q1NA 5FPYA 2WI8A 3LC2O 1I0IA 1DWPA 1HE2A 4X93A 2OC4A 1YZHA 1U80A 3GGDA 3JWJA 1UMDA 4GU5A 3I23A 2IA5A 2PNJA 3I2HA 1AVTA 5EXSA 2Y6VA 3ICCA 2W9XA 3CZ4A 3PUJA 4FD2A 3BMQB 4D92A 5AD1A 3HY6A 4XB6B 4X61A 2G8NA 3TRFA 3HK2A 1XL0A 1VSQA 2ALJA 4AY4A 4HQOA 4EGQA 4ZEVA 5A9SA 2BR4A 2RAPA 3CT4A 4PHGA 1JV2B 1IK6A 1J70A 1NBIA 3RYIB 4IQFA 5JFGA 4N41A 3EXFA 2WYUA 2GM4A 3FZGA 5HRAA 4KPYA 5F12A 3QO7A 3DZIA 1XROA 4J1NA 3DL2A 2B78A 1ZH4A 3VJMA 3W6OA 2WYIA 5A06A 3HP4A 1IN6A 3K4HA 4Z7JA 2VDWB 1YRAA 4BIMA 2OCBA 5C8YA 1SG6A 3NBUA 3EZNA 4YY3B 4LJ7A 5HIAA 3GCGA 4ALLA 4TVKA 3K2IA 5IUKC 3N7TA 3MHTA 1KPHA 5FJJA 3LT4A 1ABEA 2Q2WA 3DTVB 1KFEB 1KJWA 4WW0A 4CTKA 2WTMA 5IABA 4UTNA 1RHUA 1WOMA 1S89A 4LF8B 1N6KA 2LXNA 4HEQA 4HSEA 4EZIA 3VR3A 2YHIB 3OQOA 1ML4A 2RHSB 1PCXA 1GNLA 2O0JA 3LDUA 1MDFA 2AFIE 3UJPA 1LPBB 2VNJA 4Q21A 2WSBA 3N8KA 2JLBA 1ISHA 2JFBA 5H3HA 3IIEA 5FF9A 3DBLB 1NI4A 1TLFA 3L6BA 1N0WA 3Q41A 3FCSB 2BE9A 4WTOA 1UM9A 1HGXA 1SELA 5KTSA 4JLSA 2MTBA 4TX1A 1GN9A 1NPDA 3JARA 4XB2A 5HPYB 1Y1SA 3KCNA 4N0EA 4HGPA 1GD1O 4R1SA 3A2KA 2VQDA 2JLXA 1IAVA 2ZJ2A 5DNVA 5DNDA 5ICGA 4GPTA 2VK2A 5KYTA 1ZSYA 3R3YA 3ONEA 4LXUA 3PQCA 4LRXA 2HGSA 3ETEA 4O4JB 2EW2A 1L7EA 3C43A 1NOIA 3SC6A 4CETA 4QPCA 4FLFA 1E6EA 2YJ3A 4NZOA 3I2GA 2PKCA 5KDOA 1N5IA 1Z5GA 3P5BA 5DM2A 2ARTA 4XTVA 2Z2KA 1KP3A 3QVTA 4Q03A 1N32B 5ELLA 2O20A 1G8AA 3SEAA 4FYWA 1JR3D 2Z3WA 1S7GA 4JU8A 3FPBA 4AJJA 1RCFA 1JEJA 4A6DA 2F9FA 2C2XA 2FPLA 1QWOA 3I01A 4Y30A 2GN6A 3NAMA 4QULA 1Y7LA 1ZMTA 3UVEA 2JFPA 5EESA 3W1VA 4MGYR 3O1IC 5IUJC 3A05A 3F5QA 1VL6A 4R1PA 3R0JA 4HJRA 2V7QD 1BSVA 3GLGA 4PZYA 1B70A 2DU5A 3IBGA 4OGGA 4OHYA 1WU7A 1LQ2A 1GKUB 3DMTA 3ICVA 3KL2A 4O2AF 2Z1DA 1RLOA 2POQX 3LBNA 1SKUA 4HTFB 2XB2A 1POXA 3G2HA 3PFBA 4L2IB 4S3MA 1H5QA 3U7GA 2RE8A 4X1IB 2ZIMA 4JEUA 3QELA 4P93A 4CH5A 3WBKA 1NBME 3B5JA 3BD9A 1Q6YA 2IWRA 5KWEA 3FI0A 1OAOA 1YS6A 5HTKA 1F4VA 4BMCA 3FUTA 5F2OA 4R05A 3AR3A 2CT8A 5JTUA 2NUAA 1EAYA 4RDCA 2OSVA 4CZ2A 2AZXA 1KY3A 3H4MA 3K1YA 1QP7A 1OZAA 3GEHA 4PCAA 1SOVA 5F51A 3OY2A 1NVAA 3W77A 1KERA 3HDJA 4QELA 1H2ZA 2EKZA 1IZ9A 1YZTA 2MMCA 4X1YB 4X71A 5AKEA 5A02A 1KR5A 4F1JA 4OY3A 3L1JA 3VQWA 3QNEA 2ZINA 1SVKA 1C8LA 1ZRMA 2CKDA 3AEXA 5G0TA 4IOMA 2BRUC 1GAEO 1RI5A 2OTCA 4H4DA 4JS0A 2XXAA 4DPLA 2NVUA