5C53B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
385
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGRKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase subunit gamma-1
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 363
sequence length 385
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c53B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c53B02
3MF1A 2CJ9A 2E5AA 1X01A 3V8JA 4HWSA 2G4CA 1BIBA 3L1AA 4P3PA 2ZNJA 1W66A 2DXTA 1B76A 3A32A 2ZTGA 4NCXA 1EFWA 4LNSA 3WQZA 3HY0A 3A5YA 4YRLA 1FYFA 1EOVA 2J3MA 4H2TA 3HFZB 2DVEA 1WQWA 4HWRA 1G5IA 1JJCA 4WF2A 3FJPA 1SERA 4YRFA 3L4GA 1ATIA 3LSSA 1NJ8A 2C8MA 3NETA 3A7RA 1NNHA 3QNEA 4YRRA 2ZZFA 4P71A 1EIYA 4UP8A 4P74C 4XTXA 3V8KA 2ZT5A 1C0AA 4BW9A 3V7RA 4KR3A 4TWAA 1L0WA 5KNNA 1WQ7A 1WYDA 1J5WA 2XTIA 4YREA 1YB3A 4H2XA 2E64A 1PYSA 2LW7A 3BFMA 3V7SA 1EQRA 2AMCA 4UPAA 3VQXA 3PCOA 5ELOA 4E51A 2ZT6A 1HC7A 4K87A 3REXA 1EVLA 1EIYB 12ASA 4EO4A 4CS4A 3REUA 3W3SA 2Q5HA 4XU2A 3HXYA 3UGQA 1H4TA 5K1PA 5C52B 3RF1A 3TEGA 2EJGA 4H2WA 5E3IA 2AMCB 4WJ4A 3OD1A 3RKWA 2DTOA 1X55A 3PCOB 4P75A 1BBWA 4ZIBA 2PMFA 2IY5B 3A7AA 2ARTA 2I4LA 3RACA 4YP0A 5HGQA 4YRGA 1V95A 4H2YA 2DKGA 2ODRD 2ZXFA 4TQFA 3QTCA 4P72A 3A74A 1RIQA 3HFZA 3P8YA 4YRIA 1B8AA 2EWNA 4WJ3M 1ADJA 3M4PA 1SESA 4HA8A 3HTZA 3PZCA 3QO8A 4OP0A 4YPFA 1Z7MA 4RMFA 1N9WA 4WI1A 3HXWA 2ARUA 4YCVA 2RHQB 1SRYA 1LYLA 2J3LA 2ODRC 1USYC 4O2DA 1X2HA 2DU7A 3LSQA 4G84A 4XTYA 4PG3A 3IKMB 2C7IA 4XEOA 4YCWA 2E65A 1KMMA 3A31A 4XTUA 2CJBA 3MF2A 2DTHA 1G51A 1KOGA 4HWPA 1NYQA 3VQWA 2ZZEA 2DDZA 2DZCA 2ARSA 3V8LA 2P5IA 3I7FA 4XTVA 4RQEA 2DJZA 2E1HA 2DTIA 3RL6A 4P74A 3EFSA 2I4MA 1HXDA 1BBUA 2PMEA 4P3OA 1YGBA 4KR2A 1WPYA 3HXXA 2RHSA 2ZT7A 2IY5A 4UP7A 1NJ1A 3LC0A 2ZR3A 4K88A 4DPGA 4HWOA 4XU1A 4DQ2A 2EJ9A 4H2VA 3EFRA 3RUXA 4J15A 4P3NA 1H4QA 3L2ZA 2ZIMA 2ZIOA 4Q6GA 2DQ0A 4P73C 3M4QA 2RHSB 1ADYA 2HNIA 1ASZA 4XTZA 4XU0A 4AH6A 2CGHA 2AKWB 3TUPA 2CIMA 2QHUA 2RHQA 1NYRA 3NEMA 4TVAB 3HFVA 1E1OA 4XTWA 2ZINA 3R07A 4G85A 3NENA 4TTVA 2CJAA 4HWTA 4YRMA 4YRCA 1WNLA 4K86A 3A5ZA 1BIAA 4YRQA 2QHSA 4EX5A 4YRTA 2DXUA 3E9IA 4YRNA 11ASA 3IG2A 1HTTA 5C51B 1EVKA 1QE0A 3HXZA 4HVCA 2QHTA 3IKLA 1ASYA 1E22A 5ELNA 4ZTUB 3HY1A 2E10A 1G5HA 1B70A 2FYKA 3HXVA 3IALA 1YFRA 4RQFA 2Q7EA 4CH5A 1X56A 2ZGWA 4TQDA 2ZZGA 3ICAA 4YRJA 2EL9A 2ZCEA 1NJ2A 1USYA 3V7CA 1IL2A 2ZT8A 1VQZA 3NELA 4CS2A 3HRIA 4TVWA 4CH4A 1B70B 4P71C 1H4SA 2I4OA 3G1ZA 4YCUA 4ZTZB 4H2UA 2DEQA 3E9HA 3RIRA 4L87A 5F5WA 4YRSA 1E1TA 3QO7A 1Z7NA 4YYEA 2P0LA 3HXUA 4PHCA 3RKXA 5C53B 3TEHA 1KMNA 2DU5A 1B7YA 1JJCB 2AKWA 3QO5A 3RKYA 1X54A 4TVYA 4H02A 4UP9A 3L4GB 1WLEA 1GGMA 1SETA 4TVAA 1X2GA 4YDQA 2QHVA 2Q7GA 3KFUA 3UFGA 2EAYA 2Q7HA 2I4NA 2ALYA 4XU3A 1WU7A 3RGLA 2ZNIA 2E3CA 3UH0A 3TEHB 3UGTA 1B7YB 3P8TA 4CS3A 4P75C 5K1XA 4RDXA 2DZ9A 4H2XB 3ERRA 1PYSB 1E24A 4P73A 4YROA 2DQ3A 4X5OA 3A7UA 3P8VA 4KQEA 4CH3A 2Q5IA 2EJFA 3CMQA 1NJ6A 3MEYA 3VQVA 3HRKA 4P72C 2ALYB 3BJUA 4YRPA 1NJ5A 4OLFA 3DSQA 1H4VB 1YFSA 1YFTA 4XEMA 1QF6A 4H2SA 4CH6A 4BWAA 3VBBA 3VQYA 2E41A 4Q15A 2XGTA 2ZR2A 4YRKA
chains in the Genus database with same CATH superfamily
2OK7A 2VPPA 1GNVA 2WYOA 3CEJA 2HYIC 2XGJA 3EEQA 3KKKA 5MN5A 2OFOA 4JY7A 1O95A 1Q74A 4RADA 3WG9A 1G9TA 2YWGA 5JYEA 5GM2A 1FW8A 4ZU6X 1KFEB 1QBGA 3WLKX 1THZA 2G4CA 3IVGA 5JS7A 4K81B 2QTAA 2J0QA 1B6SA 2YWBA 3H4TA 2WQZA 3Q7PA 1GKLA 2GNPA 5IXJA 4EW1A 1QP8A 3ZNOA 2WIJA 5HZGA 1N2SA 4QJBA 3T8YA 2AG5A 2XQVA 4B6QA 2YOFA 3KQMA 2G17A 3SG0A 4LZWA 3TW8A 4J0EA 5BYKA 3F8WA 4NG4A 3I12A 1QYDA 3BRCA 1FYFA 1EOVA 3VM6A 3DW1X 1W0KD 2Q7OE 3EXFA 2HCFA 4N3CA 3QP9A 3SNHA 3F4LA 1ISMA 3K8ZA 3INNA 4FFDA 4HNAA 2BZGA 4K9QA 4WHMA 1TOAA 5EMLA 2KSQA 3CKYA 2X0DA 8ABPA 4ZVNA 4HWRA 3T7IA 4DC9A 4YT5A 3KUXA 1KKUA 1GGFA 4V0ME 1R9NA 4KQ1A 4O1HA 1VCNA 3TRFA 4RSHA 5KSYA 1M0TA 4IJ6A 2AXEA 2F3PA 4CQMB 4TRNA 4W8GA 3TOCA 4RHTA 5AH0A 5KTKA 5A4KA 3BWBA 4M7RA 3IUSA 3MG9A 1OWMA 4R40A 4AMYA 1JQEA 1USGA 3OE7D 4YJ3B 7YASA 1P1RA 4QJ5A 4RFLA 1YASA 2NQTA 1O7JA 4N12A 3UWSA 5CFRA 2XR1A 1WL8A 3HCDA 1P39A 5HGJA 3VSCA 2A33A 5EE3A 4WN3A 2YR0A 3Q3EA 4OLHA 1C3XA 3D5EA 1X7WA 2W2NA 3P27A 3EY4A 1IEQA 4J6EA 4NPCA 4YH1A 4BV3A 1R12A 4GI2A 1U7DA 4P22A 2X76A 3MQ2A 5JH7F 4KWEA 2W83A 4BW9A 1YGYA 2GFIA 2I3BA 4Q7KA 2VPWA 4OH1A 2WSSD 1SG9A 3CY6A 3SK0A 4A26A 1HNWB 2X9LA 1PGPA 1OT3A 3O73A 2FPWA 5LQDA 2HSZA 4BNJA 1KI2A 2HLPA 1QHGA 3BMCA 1YZVA 4KIWA 4ADSG 2NXWA 4QT4A 4Q3NA 3MCVA 2RHBA 3L06A 2RGGA 1I9GA 4NZOA 4IXTA 5TDHA 1B4DA 3L3BA 4CXMA 3VOAA 5INTA 3ABZA 1WOMA 2OLKA 1QDEA 2HGSA 3C7CB 2VSOA 2Z57A 3DL0A 4G0ZA 2I76A 1QIFA 2X7XA 4DIEA 1BX3A 1QIIA 4Z49A 1T9GR 1Z6PA 3REXA 4Y6LA 3A4LA 5KQSA 4KNWA 3T15A 5LLTA 4R31A 4Q66C 1G2QA 2V7TA 2WKQA 5I7VA 1YUBA 2B25A 3N59A 3HCAA 4GKVA 2W8BA 5DGIA 5FV7A 5IJAA 2VPQA 4PGGA 1SB9A 3WAGA 3CRW1 3AJEA 3EQ9A 5C4GB 3TOXA 1Q95A 3KZNA 4LA4A 2VNIA 3EF0A 4R69A 4BC0A 1DAIA 3G79A 2YINC 3KUDA 3R7DA 4QBTA 5DP2A 2WA1A 2RIRA 3D2BA 5DZSA 5EMJA 4DDTA 2Q46A 5K6AC 4MQMA 3LGXA 3QBJA 1B1AA 1VJ0A 2FR1A 4I50F 5IVIA 1VDMA 2D62A 3C70A 4GGPA 1NUHA 1NDQA 1DBSA 2OXCA 3ESAA 4TLAA 5AM1A 5J2TA 2G82A 2JHCA 3EZFA 5EQDA 5LYYA 5IAKA 2QJWA 4GM4A 3GFFA 1QFMA 4URWR 3SXUB 3U3ZA 3WOVA 5CT4A 4F1WA 1WKCA 3B3AA 3MJEA 3A0UA 1E3SA 3Q87B 4P7FA 3KSMA 3HBAA 1ODLA 2DCUA 4TKUA 2HHAA 5FUVA 3WZMA 4BCDA 3QVGB 1LB1B 1Y82A 2FI1A 4G5QA 3NHWA 2R1UA 3H4MA 4X45A 1OLUA 1JWAB 4LFBB 1K6MA 4PAWA 4EZIA 3CX7A 3KQPA 4PLHA 1CQJB 2VN8A 1M5UA 2AHOA 2ZAYA 3TQFA 1VYUA 2HBRA 3S1AB 3R4VA 1R0XA 3UJPA 4EPTA 3R7FA 1L7PA 3E84A 2C20A 4BLWA 5BV8A 3WRXA 2WMNB 2DEUA 3HFZA 5F5NA 1GPLA 1G60A 3USZA 1QAQA 4DV6B 3OZTA 3IQEA 5D7BA 1PV4A 1VB3A 3EE6A 1E64A 2YN4A 1T9DA 1HTWA 1P5FA 3AHGA 1O8CA 1XQWA 2AZTA 2MYNA 1AE1A 3MWYW 1DKOA 2HRCA 1TNDA 3V1NA 2QTVA 2GDZA 4RSGA 5AO9A 1PG5A 2QG9A 2WFAA 4E1VA 1ZO8A 3L0ZA 3WL8A 2DFVA 4MB2A 4CL8A 1E6LA 2CYBA 1XOIA 3LHSA 3E2IA 2GD6A 2VPXA 1N8NA 3RH0A 1IVSA 1RHRA 4I1VA 1N36B 1CJSA 3QFHA 1WS6A 4MYRA 1KI9A 4YAFA 5IARA 3RIXA 1T9CA 3CG4A 2QG6A 4BP3A 3B9PA 2Q3MA 3GVCA 4YJFA 1H5QA 4RXUA 3QPDA 4HQ6A 1A5TA 1FCJA 3GCZA 4PR3A 5TNXA 2CXRA 4EPVA 4DG8A 3U17A 5TR9A 3SE7A 1YA4A 2CL0X 2YJNA 3DPIA 4MUYA 3P2EA 3UNXA 4B40A 5AFSA 5JYBA 2J0SA 1MJGA 3U4CA 4XOUA 1G5TA 2B83A 1Z6TA 2I22A 2XWBF 2WSLA 2EC5A 3P32A 5K1ZA 1COZA 2HWYA 1NKVA 5FXMA 1UKVY 1W4RA 1E8DA 1SRQA 4RTLA 5U9CA 3FH0A 4L5BA 3AYZB 5FIUA 1ZH8A 2R65A 3MTAA 5K3FA 3SC4A 4MCJA 4DBZA 5L4NA 4ASUA 2NUBA 3WYGA 1PT9A 1QIMA 1REQB 3U56A 1R0ZA 1RPAA 3ZYCA 3OPYB 2ORIA 4CF5A 2FJPA 5F64A 5HP4A 1AUOA 3NEYA 5F1KA 4EB6B 1IAQA 4JUDX 4K6OA 4KR9A 3VR2D 1GU1A 3WYDA 2GF0A 1FQKA 2OHGA 3FDXA 3HBMA 3B2QA 4PZYA 3ZE0B 3C8UA 4GGOA 3ZX4A 3NAQA 3RRXA 4PXYA 3U1TA 2E1HA 4JBLA 3ZDQA 1Y1LA 3BWYA 4TMKA 1SKAA 2J7KA 4K6KA 3RYIB 1QS0B 2J0EA 4IIGA 1A5BB 2IHJA 1M0SA 1ULAA 3ZXYA 3T7RA 1OZHA 2IJGX 4EJ2A 2O8BA 3P0JA 4F2PA 1E2BA 1ZY2A 1FVOA 3ZOZA 4RKWA 5AOVA 4FONA 1A72A 4ENVA 1RC1A 2FN7A 4EI9A 3FNBA 5LOVB 3OZIA 1WHTA 3G7NA 4WJKB 4PZCA 2KM1A 4HRVA 4WIAA 4OHVA 4TT3A 4HATA 1NOIA 3S27A 4OGWA 3ZBQA 2ZR3A 1JPUA 2NV0A 4UBLA 3QJGA 4KACA 3MWLA 4B47A 1QH1B 4ZOLF 5AOBA 1E1CB 3WK7A 4ZPXA 1OHHD 2OXTA 4A73A 1TF7A 4XJSA 1RIFA 1ZM2A 1OCEA 3O1IC 2ZUWA 3G8AA 3DYIA 4D4IA 2HJGA 1OUMA 2QN8A 3VDMA 5HRAA 1MZPA 1MB4A 1O2DA 1OXBB 1PDVA 2VBGA 3Q85A 3E48A 2YKGA 2FZVA 1RRKA 4AZ0A 2MSEB 1SXJE 5KREA 3ZC3A 1P4RA 3WLNA 1MABB 1XRNA 2PUHA 1UPFA 3QVXA 1PJ2A 4ENSA 5K0FA 1SZPA 4EX7A 2QPAA 1YR2A 2ZVJA 1W25A 3AI1A 3EFOA 3I83A 3M6XA 5I4KA 4RFSA 4Y2SA 1T0UA 3OBIA 4RF5A 4A10A 2YUTA 2H85A 4UEOA 3VR5H 2JVKA 5A5GA 4DYHA 2WD7B 2ZZKA 4DDVA 1CC1S 2HNIA 4IDFA 4IIUA 1JNXX 1AKNA 1RE1A 2Q29A 4PAQA 1D6NA 4ZN6A 3ZIAD 3VR6A 4WK6A 3NAMA 4LJLA 1FSFA 5ALTA 2ACVA 4E14A 1S6YA 1VIDA 5C9ZA 3AVWA 1HX7A 5M5BA 2RHQA 1AGXA 1IULA 2FWRA 4BWVA 1MN6A 3HCWA 3E5NA 3FLMA 3L7YA 4FSDA 4RVNA 4YAUA 2E4YA 4TN5A 5EWLB 4JITA 4PGHA 2YC2C 1SXPA 3G0HA 2EATA 1V5GA 1X0VA 2Z2IA 5JAZA 2XITA 4U9UA 4Y30A 4AZ3A 3GO4A 4DSZA 2HWKA 1N3BA 3CLHA 4PQYA 2PS0A 1C14A 2R2AA 5JEDA 2UXDB 5BOVA 3FN4A 4IX9A 3RPEA 5REQA 3T4PA 3BIOA 5EMKA 2O3SA 3E7XA 3OLWA 3GT7A 1EXMA 3MBKA 3NIFB 1HTTA 3O31A 5EOVA 4ZCPA 5DF1A 1ZH0A 1BYUA 1DC7A 4L5YA 4KX3A 4QXAA 4UVIA 5JVDB 4UUMA 4A8JA 4AP9A 1FBNA 5HFAA 2JC3A 5JROA 2Y9PB 2D6FA 5LUAA 4MYSA 3OOWA 2P3LA 4B71A 1TYBE 5CITA 1FYDA 3S5JA 1PQUA 3KT3A 3OSUA 4TOIA 4ER6A 4MV8A 4A2CA 5IT9A 2GAAA 2HZ7A 3ILXA 4Z0HO 2VNHA 1WD5A 4DDHA 4LMBA 3OKFA 3HA5A 4RD1A 3H6KA 4TMWA 5FNVA 5JANA 1BYIA 1T2DA 3CUWA 4L9WA 3OM1A 4NLLA 5BQPA 3C7AA 1UAAA 1EXNA 3IHTA 1QYXA 1X13A 3FYCA 1B70A 3HXVA 1A7UA 3ETLA 4ND4A 1DC6A 4C0KA 3E8XA 1Q7GA 3PQCA 4H1TA 4C7XA 3VH4A 2CF5A 2G83A 4URUR 4BKQA 1FFCA 1M74A 1U9CA 2EKLA 4RF4A 2ZGWA 2WNSA 3USES 1F0YA 3GPDG 5JC8A 2H08A 1UXGA 3LZ6A 4L8YA 4QLOA 4F9TA 2ZCEA 3M2PA 1HFKA 5TC4A 5GWXA 2YJ6A 2QN6A 1P2FA 4IKEA 4OB7A 4YIKA 1K1EA 4CFZA 1YI0A 4D3YA 2C7PA 2GPTA 4BFLA 5LQNA 3QLVA 1PSZA 3PUHA 1EGAA 1BCRA 4JLJA 1KJNA 3HRIA 5A5DA 3WB9A 1UDAA 3ZKWB 4C5CA 8MHTA 4WKPA 4HDMA 5EJGA 1N5DA 1YAHA 2WUFA 4UREA 5FHRA 3NNSA 3UAGA 1TEVA 1OX5A 3FWNA 2DC1A 5IAGA 3EMBA 2JJ2A 1TJ3A 3H0KA 3GRYA 5E2BA 1L0BA 1SCNE 4J8PA 3O75A 6REQA 1T29A 2Q5JA 4MAAA 2P9HA 1MF7A 1SCIA 3KQUA 3DKVA 4PLZA 5AVSA 1NG9A 2JGIA 1PEAA 1SUCA 1FC0A 3AY7A 4YO7A 5ILQA 3UH1A 4B3IA 4BO8A 2IW1A 4MGEA 4F9GA 1CEYA 3D9QX 3ROXA 3BWCA 1UBFA 5GONB 4E07A 2ZWOA 4LSWA 1UJMA 4KV7A 1I5EA 1QFJA 4UHJA 5AKKA 3WQQA 4CL3A 4EY7A 2XF8A 5AYVA 5FV4A 2DXIA 3G0IA 3BQMB 1P8JA 4IICA 4UMEA 3UMRA 5JOQA 4I81A 4IQ0A 4AYTA 5CEEA 5K8TA 2BGWA 1ZIXA 1N8TA 3IIIA 3D6UA 5I4CA 5AVTA 3PDHA 3VUEA 4B17A 4C7OB 1B7YA 1A69A 2ZXUA 2HKIA 1I0ZA 5HM8A 3MAGA 3KJXA 3I64A 4MV6A 2VHTA 3REQB 5F1OA 1A4XA 4GXNA 3URMA 3JASB 5ALEA 2N47A 5ES4B 3ESYA 4H02A 3M3DA 2IU3A 3H2YA 1QU3A 3LL4A 3HJCA 2NP6A 1W5AA 3P45A 1E7QA 1I7LA 2AS0A 2MOKA 1VYTA 5ICSA 4L5IA 5BXYA 4EI7A 2IYYA 1XN4A 3L18A 1VLQA 3LF1A 2IH5A 4FEGA 3GH3A 2VH2A 5KOIA 2PDAA 4BE9A 2QHXA 4NR0A 1GZ3A 2PYDA 3P8ZA 3T52A 4RDIA 2GKGA 4GMKA 3KFUA 1BFKA 5AKEA 2VSYA 4PZUA 3A9CA 4PFQA 3ECAA 3VTAA 1Y6GA 2ZR8A 1S3SA 4Z9FA 2OFPA 1ZNXA 2W6CX 1BCSA 3NVAA 3K9LA 2GWRA 2AVDA 2MIIA 1ZRMA 2OHHA 3TRJA 4JI0B 1AIPA 2A0YA 1JHDA 1NF8A 4R4JA 4F2GA 2O8DA 4YAOA 3TXXA 3EZ6A 3OZEA 3WIBA 1NNEA 2Q4RA 2ZEJA 3ZZ1A 2RHGB 2FP4B 3TN7A 1KORA 2AQKA 2P65A 4OAOA 3UMSA 1DG3A 2R1VA 4MPDA 4CF4A 4KFCA 5CIQA 3W7VA 1M1NA 1XZJA 2B5OA 5KTNA 1W5TA 1ZK0A 4OHFA 1F0KA 3MC1A 3TL2A 4AJ4A 1XUOA 1ZISA 4Y1FA 2EJFA 1UMDA 3AGQA 4Q7EA 3RUFA 2QOEA 1JDBB 1N92A 5CK4A 1TKAA 3BXXA 4PHGA 4LZOA 1PTKA 4MUGA 4OSPA 5ERGB 4E2ZA 2O5CA 4YRPA 3N6VA 1R0BA 3BIXA 1TJNA 1XQVA 3I6MA 1PNQA 2V7VA 2C4HA 3FE2A 2AT1A 2IITA 3LVFO 3DSQA 4RVGA 5FWXB 4UM9D 3MTJA 1SEPA 1WHSA 3WE7A 3EHDA 3Q8LA 1V3UA 3BTVA 2Y3IA 1U2RA 4RIIA 2O8NA 3EMVA 4WINA 3MGKA 1NRXA 1IBCA 1K5DA 2QZSA 1NN1A 2ZBQA 4CH6A 4IEFB 2J9XB 4C20A 3FWHA 2GAJA 4NKRA 3WIEA 1EIZA 2QL9A 3CW2A 3P4UA 3S1LA 1CQXA 2JJMA 2QM0A 5TEWA 5BXQC 3SYRA 3GEPA 4OGFA 1UQTA 2JB9A 2XZPA 3ZVKA 3R8CA 3AF4A 4P35A 5DOVA 1K6JA 2PD4A 3CLVA 5FFNA 1Y4AE 4XTRA 2LRHA 1KRXA 3LQRA 2EHJA 4OBBA 1D4AA 4ID9A 3PKJA 4O4LB 2A5YB 3LY7A 4E3ZA 1R4MA 3RRFA 4RA9B 1BN6A 4EPYA 3O84A 1X80A 4BO3A 1G64A 3SHOA 1GP2A 1M8JA 3OT4A 3RU2A 3H3FA 2OYCA 4P5EA 1G4UR 3FMOB 4U8HA 4COKA 2VF5X 4NNJA 1SCUB 4ZAWA 4JELA 4O4IA 2YCLA 1JHPA 2YY5A 3NV7A 4ILEA 1YMQA 4CUKA 4Q37A 1P1HA 2XOKA 4Q18A 2E7ZA 3W7AA 1QTNA 5E1MA 5GJVC 4YHHB 2G77B 2R6HA 3B13B 3RUPA 2AW3A 5T3YA 3OQ1A 3ZCSA 3D4IA 4C6SA 2NT3A 4BNTA 4AULA 5SYAA 5BYAA 1U0HC 2C29D 3UM9A 3OESA 3FVQA 4FYKA 2OV6A 5AK0A 2QU7A 4ZRMA 4I5DA 4WCFA 4EQZA 1QRUA 1MIHA 1GT91 2ZFUA 4NEQA 5EJFA 1U80A 5CDUA 5FA6A 3JPWA 3FNHA 4HQ0A 1U8TA 4BLOA 4CF7A 3TEJA 1ZU5A 1XHFA 3L0PA 4Z4GA 2BM8A 3TD9A 1IEWA 1K8XB 2C8MA 5CA0A 2J9FB 3U3OA 1L4MA 5BUCA 3H2GA 2B7LA 5F3RA 1E6MA 4O08A 2C9OA 1K9SA 2ZIUB 1Y3DE 4NCHA 5HWSA 4XWYA 2XQIA 3CRQA 3D3NA 1P9RA 2G9QA 4CMHA 2VWGA 4EB3A 5AVQA 3R5XA 3U6BA 1KBZA 2CE7A 4PLTA 3KALA 4QUBA 3QFFA 2IIBA 3KHKA 2PQMA 4FN4A 4ENQA 4AN4A 2AYZA 1U2DA 3RI3A 4BMXA 4QBGB 1JKJB 3H9UA 3TNFA 3BMNA 1BH2A 5AVJA 4TWAA 3I6IA 1IHOA 3MFQA 5J40A 4ZI2A 1N2ZA 1SHKA 1ST3A 3BOSA 3TUJC 4P80A 3WWZA 2HQRA 1P4AA 1PYSA 5JSFA 2V54A 3ND6A 3NFYA 2FDXA 2JJ8A 1N9GB 3C6ZA 3JRNA 4BAUA 1V26A 4EAAA 1USIA 3ZD8A 1CY7A 1X1RA 1TM5E 3ILYA 1HSZA 1I1QB 2I1QA 4BLRA 1ISIA 1PL0A 3VDRA 3Q7QA 4S1NA 3EGVA 5LKAA 2HMTA 1EA7A 5NLLA 1Y6FA 1AXRA 4LNUB 4X6YA 5CW2A 2UU9B 3IOBA 1RZRD 1ZW1A 1URPA 4H7DA 2OXEA 2H0AA 2GZAA 3R3WA 3HP1A 1J97A 5IT4A 2FEKA 2ZRDA 4RHXA 2ZKLA 1U8CB 4DWVA 3GFSA 5EZYF 1WBBA 3LSYA 3N8DA 5DSZA 5KX5A 1G2PA 2VF7A 4OKNA 4CWAA 1ZVVA 4NOKA 5M29A 1DIOB 3BFJA 1XMQB 3KT8A 5KINB 1E9BA 1HORA 5ALGA 3IAS6 4K9RA 2ZITA 1KHHA 1K06A 2ZRLA 2EU8A 2AMCB 2D2XA 1BDIA 3PDIB 2GN1A 2I67A 4BMOB 3THWA 3K9CA 1OWOA 2HRRA 2DTOA 3BWXA 4XB1A 5L3RA 3L0SA 2IXGA 3B9RA 3K0BA 4FE4A 3J7AC 2CBZA 1B16A 4KFUA 2C88A 1Z47A 1OKKD 5D6NA 2I4LA 3SHTA 4BWFB 4RJTA 1CEXA 2OORC 2IGBA 1DVRA 2MYPA 4PLPA 2DHDA 5G4LA 2RGUA 2Q3LA 3WRWA 5L3SA 1CXZA 1KZGB 2BF7A 2A5GA 4RD4A 5DHAA 1CRWG 1EBBA 4LGMA 4BRUA 1RXIA 2QJOA 4FZJA 4CQLA 3FNQA 2YUIA 1EG2A 2HHLA 4D96A 1CRLA 4NYMQ 1JJBA 1HMPA 3IB3A 4GRAA 1E1KA 2CJWA 2XAAA 3B85A 1GZ4A 1R0RE 1SBTA 1Z2DA 2FRDC 3CBGA 3MCAA 4JBXA 5H82A 1PR1A 4HEHA 2BBWA 2Z5LA 4LRQA 2BV3A 3RSOA 3SF8B 4OJTA 1JE0A 3I37X 4F0JA 1KFJB 2XVMA 3RTDA 3PF9A 1UOOA 1Z4MA 1M6VA 3HN7A 4TL9A 3A1DA 4M22A 4P53A 2ZI5A 2OZEA 3W5CA 3ZU3A 4IZ6A 3T3OA 3M4PA 2AN4A 2GHRA 2WIAA 4H59A 3NTVA 1UJ5A 3OQMA 4GMXA 3PFHA 4Z53A 2JIRA 3I2JA 3OWHA 4RVUA 4IOLA 4R2WA 3DMRA 3C85A 4ZD6A 2OSVA 4NMXB 3W1WA 4OP0A 3WB1A 2HDWA 3R3JA 4B43A 2RH9B 2IZ1A 4GI3A 4I55B 5BYJA 3A4IA 3W6NA 4YUYA 2BISA 4ESEA 5BVHA 2C96A 2W2PA 5D1NA 4EW6A 4BO9A 5TS2A 1SVLA 3EG5A 3FROA 1T4CB 3WQBA 4EJSA 2P6NA 4BP1A 5F12A 2BE9A 2DBYA 4RM2A 3ML1A 5DP1A 2QE7A 1CCWA 3GELA 1FXSA 1VIVA 3ZY5A 4YASA 3SVLA 1NVMB 1UJNA 1GYRA 5FA8A 5ED0A 4J4TA 4L4RA 1AT1A 1DUIA 1F3OA 4OD0A 2OKGA 1RRMA 4FYJA 1W93A 1DXQA 3IJEB 3SR0A 3ULKA 1IQRA 1LBTA 1U1CA 3WLHA 1ZCJA 4OMUA 2D5LA 4HDAA 3HDTA 1NIJA 1XVLA 1UC4B 3E9DA 4JUCA 1Z2CA 2I1VB 2O3RA 4JU9A 2G04A 3F96A 3Q12A 9MHTA 1CP2A 1WBJB 3PPIA 4K9NA 4MNTA 3G0DA 1NMYA 2IUYA 2G9NA 1QKKA 2B61A 1AB5A 3LUBA 4WOBA 1XZMA 3DOHA 5CLHA 4EEXA 1CVIA 2OBBA 3MINA 3DSRA 3TLKA 4M55A 1Z83A 4D4JA 1ZJ6A 2O0HA 3EFBA 1G5PA 3DBLB 2DDZA 3MERA 3ONVA 4AMVA 5DNCA 4GIBA 4DIMA 3MT9A 4DDKA 4R1UA 1K3TA 1VLJA 4QHTA 1Z88A 4NYJR 1KI1A 1V8ZA 4XQCA 3LXXA 2GK3A 3F6RA 4KZKA 1MAAA 3WMXA 4YJ2B 3R77A 4HDNA 5KVAA 1HE2A 1NNSA 1TRHA 2B94A 3F1LA 2IE0A 3GZNB 2IELA 2ZI7A 3KZOA 3AM4A 2I6TA 3C3DA 4P74A 5EIEA 1T8WA 2M6RA 4D3DA 4CLDA 4XYBA 2HRQA 1PEKE 2DQYA 3RREA 1ZAKA 3WMGA 1Y5RA 4MHOA 4PWZA 4TYYA 1VKRA 2QNBA 4O2LA 3CCBA 1QQ7A 1WPYA 1KGSA 1SKQA 4IS2A 1VIAA 4KVFA 4PRZA 1J1IA 1U3FA 3EEYA 4L9AA 4KRFA 2QSYA 5JNSA 3LPAA 3OCYA 5CCBA 4B4OA 1LEHA 2R4TA 2V7WA 4RPKA 3ZDRA 4AW9A 1PJ4A 4E2FA 1H94A 3OTQA 4GC5A 5LP6A 2XE8A 3RTAA 4BFVA 3ZWXA 3ND5A 4YBZA 1WLYA 1ZSVA 1ORRA 1TCCA 2Z04A 3GGGA 3HCPA 4R1NA 4XIFA 4NPAA 2ZUTA 2XNDA 1YV9A 3R7WB 1UOPA 2P2SA 3A25A 1IPEA 1B6RA 2QDXA 3F46A 3JZIA 4YIHA 4REQA 4BC1A 4AP6A 1G7SA 2VNAA 3TECE 1CLEA 1Q50A 5AD1A 2DPXA 3DDZX 1ONBA 3EFRA 3SR4A 3U13A 2AN9A 1F38A 1Z75A 4UM5A 1WWKA 1KTIA 2PEYA 3LDFA 1UFQA 3FTDA 1J23A 1Z2AA 3EGEA 4URFA 3ZCXA 4KQWA 4DIUA 4MQFA 5AM2A 2ZQYA 1N0VC 2E0IA 1JI3A 2IPOA 2QRUA 1A5SB 4O29A 1AS2A 521PA 3R9IA 1P74A 4NH4A 1I3NA 3DFFA 2GXSA 5A3SA 2ZSUA 5FJIA 2IPLA 1AK9A 1E1YA 4FYWA 2Z2XA 5FRDA 2VP2A 4BB6A 3D6MA 1X8JA 2XKBA 2ZG6A 4OREX 1PLLA 1LF5A 2QSZA 1P73A 5IUKC 2ZWPA 3ZGVA 1KK1A 2GQ0A 3BF8A 3GL9A 1XTKA 2WVGA 3O4JA 1CQWA 1YZUA 2JBAA 4I6EA 1UQUA 2CNOA 4MQLA 2O8FA 2ASVA 2GFQA 2KYRA 2OCGA 2YMPA 1VSBA 5DOZA 5IKOA 2V7XA 4HMQA 3G89A 2J5XA 4FSHA 1FJ2A 1P3JA 5EZQA 3OU6A 5CBKA 4DFDA 3FCCA 4PONA 4ARVA 4A15A 1PGJA 5M7EA 3D7KA 1ISRA 1H8ED 1C8LA 5HQ3A 3A1NA 4HNQA 4FFBA 1EUCA 3ROZA 4X9XA 3L0OA 1QZTA 2YXBA 1QVRA 1P0IA 3H5LA 4QEKA 2UZ0A 4NZPA 5CFNA 1ATZA 1PNVA 4FR5A 2DXUA 2ZJZA 3HN6A 1ZXBA 4BLTA 8GPBA 1KMCA 2IHUA 2PUJA 1U5CA 2NVWA 3F6BX 3U9TA 3LTNC 1LI7A 1XTBA 3KKMA 2C0QA 4XYGA 5DBGA 3C7KA 3KIPA 4I4TA 4EUNA 3KTDA 1P1FA 3A9RA 3CZAA 4J4BA 3ZWKA 4D9KA 3ZJUA 1NBHA 1SIUA 4K26A 4WOKA 2GNAA 4CJXA 4NZYA 2ZJ0A 5K4AA 1MV8A 1W35A 1SVOA 2BFBB 3I2YX 3GJ5A 2ES4A 5L40A 5I8ZA 1HWYA 2WF6A 1R00A 1FDIA 2Y1GA 4RHUA 1L8XA 3A6JA 3D43A 1MUUA 3EK2A 3F74A 3KOZA 2DJIA 4FU0A 5FBLB 1DUVG 2VATA 1VMEA 2H63A 1T3ZA 3QFTA 3ZIUA 1MJFA 3F9IA 2R60A 4HN9A 1WXQA 3FJYA 3DOFA 3EIWA 4WUTA 4YMSA 4AJIA 2C07A 1S01A 1ZM3A 2V96A 1XJ5A 3PVCA 4QDJA 5JSYA 2E9SA 2FPKA 4G0UA 4ER0A 1L4LA 2OESA 1SHZA 1BH6A 2YNMC 4L5CA 2Q6KA 5JH7B 2CY0A 2WAXA 4E4YA 1GR0A 4TQDA 1KQOA 3L7KA 3V8BA 3ZCVA 3MQFA 3HRHA 4A0QA 4CQJA 1V1MB 2OD9A 2W2QA 3GU3A 5A3RA 5CNJA 5IWAB 1J20A 5JZMA 3FSJX 4UKDA 1HK7A 2VKQA 4DA0A 1IL2A 2WJAA 2M6SA 2Q9UA 1D2HA 1QG0A 1RLUA 2ZSAA 2QLTA 2ZYWX 3A04A 3I6ZA 3RKUA 3T7DA 4CI0B 3G68A 4GKJB 4DGSA 3QUTA 1KVRA 1Q1EA 4XDYA 4F9EA 2GCOA 3GZJA 4HPWA 5JFOA 2Z8YM 3KTAB 5T67A 4X00A 2XCRB 3CVWA 3UW1A 4G56A 1C7RA 1E7MA 1MDFA 1N6NA 3IEXA 1K63A 3Q8KA 1KSFX 4MW0A 4EIWA 4LK2A 2ZUFA 1BMFA 1E7YA 3A10A 1D5WA 1Q20A 3NC1C 2J09A 3QYAA 3OCWA 1V7QA 3HDJA 3SXPA 1XJCA 1KPGA 3W3AA 1V7ZA 5HQJA 4BTVA 3V1TC 1W34A 4NDAA 3E7FA 4IZHA 1BC5A 4DEYA 1E4EB 1TQ6A 4I1PA 2NU9B 3N2ZB 1LGYA 1SU7A 3PZRA 1SCDA 1E1TA 1GGHA 5IBPA 4O1MA 2B2NA 2C2OA 2IEAA 4YYEA 4GF5A 4MP8A 3QU5A 5KHAA 4C7VA 2P0LA 1MEJA 4OXNA 4PYMA 4UZFA 1EWYA 1AK1A 4ZEVA 1ZGGA 3TNYA 2BL4A 3D2LA 1RWKA 3CX8A 3RUCA 3V6LA 1ND5A 5CLGA 5YASA 3K6JA 1W1IA 4DJ5X 1GQSA 2PYZA 2QVLA 4UOZA 3LP6A 1AQJA 3UJNA 3L4GB 2FX3A 1KU6A 1MPTA 2NACA 3A6GA 3DS8A 3KEQA 1SETA 1E2JA 5ECGC 5TEVA 3AQIA 2OCBA 1DT3A 3BSFA 3H97A 4GKAA 3ZXXA 4NCAA 1I7DA 1VCIA 1ZD5A 2PX2A 1KFKB 1O87A 2VDLB 3E27A 1MC5A 3FDJA 3O4RA 3P9RA 5EPUA 2A6PA 3RVQA 5LNK1 1G1AA 3QHAA 4NOJA 3QU7A 1NKTA 1UC8A 3C43A 3FSEA 1IOLA 1V2HE 2HSEA 4QG3A 4RVDA 1G7CA 1S1MA 4BMZA 4GUAA 1YCDA 1KJQA 2COKA 4IIJB 4AUMA 1FIUA 5C4MA 2G5GX 2GXQA 1R7RA 2QQ0A 5HZMA 3OEEA 2RH5A 5LZ8A 4LF7B 1N0IA 4Z4CA 3SQOA 3KWMA 4DC1A 1FLAA 2MSCB 2DZ9A 1L7QA 1IY2A 3H6HA 3IRUA 3ERRA 2I2WA 3NHKA 4IOKA 4O4HF 4EG0A 5KCZA 5HTOA 4MPRA 1R9MA 2O1WA 5AKLA 2Z09A 3GLGE 3FI9A 1WSWA 2PH1A 2PHZA 4FFPA 4V2IA 4HQRA 2V0GA 1MX3A 4Y6SA 5CM8B 3VC7A 2A4KA 3AVYA 1BXGA 1A2OA 1G7RA 3DYBA 1Z4QA 4OO3A 4R9RA 5EN4A 1GL7A 4X20A 1FYVA 1VOTA 2P41A 3TLMA 4F38A 2A30A 1E2PA 3T7EA 5BSGA 4LVIA 2ORED 4JP3A 5ICGA 2WYHA 2H31A 3FVRA 4PIMA 1GFZA 5K3DA 4TSFD 3RWMB 2P0EA 4K40A 4IXMA 1UP6A 1PWZA 1J7KA 3NGMA 5HMMA 4BVEA 3HXMA 4TMFA 5G0TA 5F98A 2K7FA 3D31A 1DTEA 1H0KA 3ID6C 1Z15A 2QI9F 4BS9A 1AKYA 1L8OA 1YB6A 3V3KA 4QJ3A 5A9RA 4KOAA 5JZVA 3LHKA 3EF3A 3WP1B 4GBMA 2JFZA 1Z0UA 1G5FA 4V0QA 2CMGA 4CODB 3IAFA 1Q19A 3AH8A 3EDRA 1PK9A 3LT2A 3TR6A 2P90A 3NONA 3ACCA 2AYXA 1LBSA 1U3UA 3F97A 5FWDA 1SWWA 2AIRA 3CNEA 4JUBA 4Q6WA 3HV0A 4DV4B 1HRDA 2H1LA 3K0KA 3OP1A 3G2JA 1JIQA 2NQ2C 1YSCA 3OZSA 3QXHA 4V24A 4JBGA 3W5IA 2AUTA 2V65A 5ABPA 5DX0A 5A3QA 2QT0A 1NQ5A 1SXHA 4L7VA 3ECSA 3HZOA 1QWSA 1YTLA 3PPXA 3ZI0A 1XMVA 3BFXA 3WLLA 3L1HA 1RWPA 1KEEB 3A05A 3IP6A 3JRWA 3DL4A 4YC7A 3DTNA 5A9SB 4IGEA 3GPLA 3M49A 1B76A 1SVNA 3CFYA 3O03A 5AT1A 3B53X 1EFWA 3PKIA 1FP6A 1ECGA 3AETA 3OM9A 2EJCA 2WSMA 4GOJA 3VSEA 1E2LA 1ACLA 2FB9A 3I8OA 1BVUA 4WL0A 1CB7A 4NOMA 3M5DA 5EG5A 1XTIA 4BFZA 3OX1A 2J3MA 2O0LA 4J07A 3VNBA 721PA 4NXMB 2O2YA 3VSDA 3NLLA 3B70A 4MI1A 2FPPB 3QELA 2Z8ZA 1FDTA 3HYNA 2X14A 3HB4X 2GETA 2CVOA 2WUWE 1G6KA 2POCA 3PX2A 4AJOA 1NRJB 3D4NA 2XZDA 1RM3A 3QKSB 1MO4A 3H8WA 2WJYA 2YY6A 1ZOSA 1VZ3A 2V1XA 3OQPA 5SV2A 2EW1A 2H1RA 3FRIA 4AMGA 4BVLA 4LHVA 4CLEA 1ISPA 3BJEA 3MBIA 1IQ0A 1HDYA 3S81A 4QGSA 2NV2B 3JZFA 2A0KA 1FFSA 2E55A 1FFAA 1QHHA 2J9RA 3INGA 2KW5A 3TQRA 3GUYA 2FF5A 3R23A 3ZCUA 4F6RB 2AD5A 1QSGA 1EH5A 1JJVA 1EIYA 2D1QA 2GEDA 3ELDA 4I3FA 3FWZA 2NZ8A 5DK4A 3R0QA 3UENA 3VVBA 3S8EA 1RYBA 1XT6A 4BXOA 1SC1A 3IP5A 3EGDB 2V03A 5JCOA 3E58A 1FDSA 3GP3A 5ECWA 4DJFC 4DYDA 3GHYA 1ACJA 3SHQA 4EH1A 3EYWA 3H84A 2Q1WA 2YXPX 3DDCA 1R8QA 1SCKA 3PDWA 1X39A 4H2XA 4IV0A 4YP6A 3PWKA 4DCGA 5F76A 4XRRA 2WEKA 4C88A 2AXPA 1E9EA 3KD2A 1EM8B 5G3YA 4L0MA 5H1YA 2K4MA 3B1JA 3TH5A 1NW6A 1X74A 1HV8A 2C4TA 3DUFA 1CQIB 2YCBA 1NM5A 2GZ1A 4RJ2A 1N2JA 4WEQA 5FNVF 4D6XA 4AD8A 2C31A 5KDDA 1M8KA 3TXYA 1B41A 4LI0A 1FQWA 2AMJA 1I30A 2BY4A 4C87A 1P7VA 5KNDH 1OLOA 4TLDA 1SH7A 4KSBA 4Q1VA 2EIHA 4X1IA 1KI6A 2OBFA 3U4IA 2JGDB 4ZT6A 2FPGA 1XE3A 4X97A 4P3KA 5CX1A 4AF7A 1XTPA 1AG9A 3PB3A 5KNLA 1JLHA 2BRUA 2QRVB 3QVWA 3NHJA 1T1JA 4DBLC 3HXYA 4F60A 2PX5A 3UGQA 4OQEA 3CV3A 1GLGA 3MRVA 4MW5A 4TM8A 3ZHTA 4YMHA 1K9VF 3NKLA 3ISVA 5MF6A 3G5AA 4DIFA 1VMIA 4D9HA 9ABPA 3TLYA 4PPNA 1I32A 1OW3B 1YQGA 3K0SA 5FI1B 3OE7A 4RQUA 3RW9A 3PBKA 4AK9A 4CGZA 4HPJB 3OD1A 3RKWA 2BBOA 2C54A 3MAAC 4LDAA 4TUYA 2W2KB 4Y6GB 3SZRA 4HGRA 1T25A 4UAVA 2I1LA 1SUWA 4MWCA 3GGPA 3THRA 3Q5EA 4W7SA 4IJMA 4XUEA 1PNRA 5IJZA 5LFAA 1Q16A 4YLEA 1GU7A 2IY9A 2BHNA 4MQBA 5B6JA 5C7IO 2JIBA 1PS8A 4L3VA 2C77A 5FWYA 5FTLA 2VJQA 4PLVA 4TXMA 3BERA 2WSSA 3LVBA 3WWPA 5HGQA 2XUOA 3H05A 2IEGA 3OPVA 2X2EA 1H2EA 3WWCA 2Q99A 3QNWA 2D2IA 4WNYA 4NULA 4DGQA 4J7XA 2YDYA 4F5DA 1JDNA 4R71A 5F7OA 4CLRA 1K8QA 4GP6A 4CPDA 2YJZA 5DISB 4CEIB 2FW8A 5HXAA 4RD2A 4XASA 1SU4A 2C94A 4WLUA 2QAJA 4RHFA 1EVZA 4D8WA 4X92A 2ANBA 3ZV7A 3A2MA 2PMKA 3OKPA 3AKZA 3OFKA 2EWWA 3KPWA 3UWMA 2WIGA 4BO7A 4LN1A 4DN6A 1NXSA 1MKYA 2G28A 4QPNA 3DLTA 4P5DA 1CNMA 1CY4A 4BX2A 1WTCA 2WB4A 3TBHA 2PUWA 2OMKA 4YAJA 1WTAA 1ORTA 4CKXA 3RC3A 1NT2A 3DE2X 4RLQA 1RZVA 3GEGA 1OGYA 3OIUA 2VZ8A 4LC9A 5TXGA 4C6HA 1H1LA 2RHOA 5EIWA 1Z7MA 1XKLA 3T1QA 5B2FA 3TDKA 3FOWA 4YCVA 4FLMA 4NV1A 4KIUA 4C3VA 2DFNA 1L1EA 3W8DA 1XVVA 1CUSA 4YPVA 5JECA 1DIRA 2RI1A 3GGJA 1H65A 1IG3A 1DC5A 1ZD8A 2FQ1A 3ZD9A 5FBVB 5LR6A 1E5TA 3UQZA 3DAOA 4Z51A 1GVHA 2OL4A 2PRYA 2VSFA 3GGSA 1UBLS 4PF1A 4XQ0A 3FHOA 1BXZA 1SAYA 1NLUA 2ODTX 4R7GA 5IEJA 4RKRA 3K6SA 4Q01A 1W44A 1W0JA 4GP9A 3S28A 4LOLA 3VYSB 2PA0A 1L1QA 1CVLA 4FGWA 4S05A 3TX2A 1BKDR 1IRIA 1WNTA 1ZUNA 2QR3A 4M8NE 3E23A 3ORHA 3RROA 3IEIA 3JZMA 5CU7A 4L5AA 2JANA 4G86A 2OFWA 3ZEAA 1T6ZA 1YKFA 1G98A 3QKTA 1G18A 3HVKA 1BVYF 4QUEA 1A98A 1NRIA 1WCIA 2OXRA 2VK4A 5HKBA 1GN8A 3AKYA 4C3ZA 1UQRA 1L5KA 4R54A 3IIEA 1NUPA 1CZUA 1F14A 2LBPA 1PGQA 2Q62A 4IV8A 4ZCMA 3ZUGA 5GADl 1E7SA 1WF3A 2QM8A 3L6DA 4C4YA 3U61B 3VJRA 4G5SA 2RHMA 3SLGA 2OP1A 2HMAA 2DBQA 4OSOA 2DF8A 1B1CA 3PC7A 1LJLA 1SO8A 2QVXX 2WFMA 4G24A 5JI2E 4FS8A 4LS3A 3RHZA 3T3DA 4NU8X 4XTVA 3RYFA 3C3YA 2XTNA 1YVPA 1ZUIA 2BKAA 2E4AA 4A0SA 4M1MA 1GGVA 1SC4A 2AR7A 1PG0A 3QV1A 4JLAA 5JSQA 2JH8A 1D5CA 1XTQA 3EDCA 1EX6A 3SSNA 3KAKA 1J22A 1KYIA 1J6UA 2R66A 3CW8X 4IHAA 1TJ5A 2AMLA 2R68A 4URHA 1YGBA 4V1CI 2OO5C 1QCYA 4HZUB 2QVCA 4PPQA 4UXIA 2WYUA 1JEYA 2KPOA 1Q0HA 2I7VA 1JKMA 2PANA 2PZKA 3KOYA 1UM9A 3WNVA 3KB1A 4CGYA 4NHEA 4X62B 3GPBA 2GKSA 3HY4A 1M2VA 4KO3S 4MO2A 1W85A 2I3DA 4W9NA 5TY0A 1BZYA 1Q3TA 3UOAB 4TTQA 1FS6A 3OO0A 4PLFA 5ER6A 3SC2A 3OJXA 3T35A 2H06A 3CLTC 1WO8A 4I7EA 4B45A 3F5SA 4S1PA 3RWOA 2K87A 2V8BA 1T36B 3FHLA 4DQ2A 4M0MA 4Q1EA 4QXMA 2NSYA 5KQRA 4MJXA 2O2ZA 2Z3WA 3ICVA 5A4MS 4Y6QA 3OIGA 4MEBA 3DCNA 4CKWB 1DTWA 3H17A 1C30B 2ZE8A 4KJXA 1Q14A 4FI3C 2X19A 3GPIA 2A9PA 2B6HA 3H1GA 5DI3A 1CIVA 2I6FA 1OD6A 3ITEA 4GMGA 3IP9A 4Q6GA 2Z5GA 1L7MA 4JCCA 3WGNA 4KXXA 4EMUA 3AVQA 4IP0A 1VP9A 4F3NA 1H2RS 5FI5A 4DAEA 1P4HA 5KHOC 1YC2A 1XZCA 1N3YA 3R0ZA 1PKEA 3VR2A 1QHIA 3OFSA 3INYA 3UCEA 5KVCA 2G4LA 4RTMA 5BOSB 3UZUA 1X7GA 1U7OA 1V8FA 1M7BA 4IYJA 4JZYA 3TJRA 1T2CA 1XVTA 1P2BA 3V2HA 2QTCA 5M3BA 1EA5A 4G01B 1NX9A 5CA0F 1SG0A 3FGZA 3WZ2A 5I3CA 4YAKA 3A2KA 3ND8A 3DZIA 5FPYA 1UFRA 3FTFA 4OL9A 2BCJQ 4RLHA 2PEZA 2X58A 3PFFA 1I4LD 1T0BA 2B37A 4QLBA 2JGFA 2ZS9A 3TR0A 1FYWA 4XM2A 3ZJYA 5K20A 3JQAD 1NMXA 1YVEI 4PXAA 5EXTA 4KMRA 5JDCC 1NR1A 3EH2A 3FCYA 1D8TA 1JZQA 3T0FA 4RLSA 3K2IA 4B76A 3HVIA 1ZNQO 3OIVA 3WGTA 1X7ZB 5JY1A 2ZM6B 3GMDA 4RDHA 2P7IA 4G9EA 1PK7A 3H9GA 2R48A 2YDXA 3MJCA 3MS4A 2AJ8A 2CT8A 4GU5A 2ZRIA 1GPUA 1C8VB 4NYIR 5HIIA 2IRWA 3WJ7A 3D1JA 2X5XA 1BNCA 1YQEA 2WYWA 2GEVA 3EZ2A 4OIMA 5FUQA 3ZDCA 1U4OA 3G8DA 1QX4A 5TF4A 2GVZC 2FQYA 5K8UA 2XA1A 4GVXA 2DERA 2SICE 3I73A 3D4OA 3T0IA 3KNZA 3HY1A 3CJQA 1QFXA 3K1JA 4G5XA 4KKVA 4KLNA 4OQPA 3D0RA 3IILA 3PRJA 1R1DA 5LM3A 4HR7A 4GEKA 1G5HA 1KP2A 3VOBA 2QVYX 4ZZIA 2CJYA 5KX5F 1PUIA 1E1DA 1ORDA 2ZTVA 4JL6A 5M04A 5CG1A 1YFRA 3QW2A 4WA8A 2WU1A 1UC9A 5ITZB 1H1TA 1B00A 2UV8A 3O82A 1ZZEA 1VE1A 5FBQB 3ZIAA 4EY3A 4CH5A 3LLVA 2X8JA 2RHDA 4P32A 3A14A 1N32B 1JEDA 4YRJA 1Z26A 2WHQA 4J2TA 1PR5A 3LBYA 4QOGA 4RPHA 4EG7A 4F9FA 2Q3EA 5DTRA 2X9NA 2QN9A 2ZRJA 5DNEA 3KKOA 3KRTA 2FZKA 2F4NA 3QVOA 5F21A 5IMBA 3UG6A 2HLDA 2DY0A 1DI0A 3CUUA 4ECAA 4UOEA 1E77A 1II9A 5IC5A 3LUKA 4GDFA 2QNIA 2ZCVA 3PHGA 1RFLA 3EB9A 4ZI7F 4IG4A 4EARA 2F1OA 2O8CA 2ZS7A 4KBYA 4BE4A 4TWIA 3SOPA 4M38A 4QNNA 3G0GA 1TFUA 3U48A 2BBSA 1I4OA 5AHKA 1DDGA 4A0HA 2Q2OA 4CM9D 1FTNA 2Q6IA 3BTOA 5IANA 3PENA 3CUYA 5A1JA 1JDZA 1AZTA 1PCXA 2E18A 3BS4A 4KMSA 3ZNQA 2HF8A 1Y1QA 2E5FA 3UCFA 4EQ6B 1U04A 4HBZA 3NRJA 3O8NA 1SCQA 1EFAA 3QEMB 3OPYI 1VE9A 2NT4A 1B0ZA 4JR2A 2QAGA 3B8HA 5J9FA 3BXGA 3C3BA 3KLPX 3QGMA 3QVMA 1C0IA 4QHYA 3BB4A 4PHCA 2PL3A 4OXQA 2NZVG 3A7DA 4MJ3A 3AR2A 4WOPA 1EVYA 2ESRA 3CRZA 3RU9A 3OU2A 4F4IA 5JS6A 3DDHA 3EZXA 4JVOA 1SXJB 4G5HA 4QHSA 2Q45A 4URVR 1FRVA 2ZXEA 1UBMS 1GILA 2ZYRA 4GXQA 4S0ZA 3T95A 2XBMA 3UT6A 5GJBA 1VXRA 4FDVA 1C4WA 2HSWA 2P2ZA 3FNGA 3O5AA 4ZGGA 4LZLA 4ND8A 2V7QD 1KR2A 1A76A 4JT9A 2AXNA 2EL7A 3AERB 2W6PA 3LLSA 1U8ZA 5FPKA 4GSKA 3AOEC 3CMMA 3EN0A 3S5UA 3UK6A 1BHO1 5HE8A 3QEBZ 2MINB 1RLTA 1T8PA 2H17A 1I51A 1Q0RA 1D2MA 1KEPA 5HX7A 1OXSC 1VM6A 1NBMD 1P5HA 3ORYA 2X0KA 4R84A 5GJWC 1O94D 3RU3A 4CG2A 2ALYA 1OX4B 2SCUB 4BPRA 1BIFA 1Y8RA 4H2DA 4UBIA 5DH9A 2YFQA 1KNQA 1FFWA 5AKIA 2OBLA 5ENDA 3V00A 1RWNA 4QULA 2IH4A 1TM7E 5IFLA 3CW9A 5K1XA 4QXPA 2UUAB 3EFHA 1TC2A 3NATA 2DPHA 1MPXA 1QHYA 2WPNA 4EBBA 4OY3A 3KZCA 5AVWA 1GPYA 1PLJA 3NDJA 2WQ6A 1IBLB 1W2WB 1HYGA 3QTTA 2YICA 3ACBA 2EZTA 5CLLA 3QM1A 4I0WB 3D4LA 4QUJA 1EDDA 1NE7A 2WDZA 4PSUA 1ZVQA 4GFDA 1FFBA 1KKLA 1R5BA 1TJ4A 4C6TB 4RQTA 4R0MA 4FHDA 1DBWA 3CT4A 3IAM1 3OU7A 3BJUA 3FPAA 4KMMA 2REBA 1QGUA 2BFFB 1NL3A 5DBFA 2LKDA 4M9XA 3CKLA 5C8VA 2ZK7A 1CETA 3QE4A 4FEEA 3VU3A 1A1SA 2EG9A 2ROQA 3EZ9A 4X3OA 1MMFB 5ETJA 3WGJA 1YFTA 1BRMA 2F90A 2ZIFA 3JD1A 4LE1A 3VPSA 3EHEA 4EVRA 1FVHA 4OI1A 2G25A 1QRRA 1DADA 1XZQA 1O5OA 2JEYA 4L76A 3MHTA 1HT1E 1M67A 1YS4A 2IT1A 2QUIA 5ELMA 1R9JA 4YP9A 2AYYA 3P0IA 3QOFA 2V97A 1TIPA 1USUA 3VZQA 3MVEA 2JEZA 5SY4A 2ZI9A 2LUOA 4ZARA 1NHWA 4H7KA 2A35A 5EY5B 2CL6X 5LP6F 1HLPA 5DPMA 4B2IA 2IYXA 3CJRA 3WDLA 2FSFA 4TS3A 3WWOA 2BWJA 5CTAA 3M9WA 4N3BA 1B6TA 4Z7NB 1W88A 2R8ZA 3DVRX 3G8BA 3K9HA 4M1QA 4Q3AA 5CB4A 2IEYA 3SEZA 1I7QB 5CFZA 1BIBA 2Z9BA 4JEMA 3L1AA 6ADHA 3AMVA 1MAVA 3BWEA 4ETMA 5AQ1A 4TVKA 3T5AA 3VPHA 1LNSA 2A1IA 4L9RA 2QVZX 5DX8A 5A4JA 1Y1KE 2ST1A 3MWFA 5DK6A 2ZJ4A 4O8CA 3NMUF 5K51A 3SBEA 3IOEA 5CPBA 4LISA 1KZ6A 3KXPA 3W8EA 5B53A 4BO1A 2NUAB 4EMBA 3GFRA 4MTCA 5DM1A 4PC7A 4I1IA 2WMOB 2ONJA 2A9JA 1QV9A 2J9YB 4BAGA 1CR2A 3MRSA 4LEIA 4DL9A 4BX8A 1ZCFA 3ZW7A 3ADKA 1ODCA 4LG1A 1JAXA 1KH3A 5AJYA 2VBCA 4DLXA 4INAA 5FTKA 4E3WA 4KLZA 4OP3A 1ZVMA 3C6YA 4IXNA 4OQFA 3SVTA 1IVYA 2F2TA 5AXAA 4N3AA 4PBSA 4YMLA 3C3KA 3EZGA 3C7DB 1TUGA 4OL0A 5B4TA 3HJUA 2FSVC 3NBXX 3P4XA 4V0KA 4RPLA 1U6JA 1IU9A 5CXSA 5B6IA 1XZIA 4DPMA 1OBVA 2JCXA 1KY2A 2C4MA 4U5QA 2XXAB 1KSHA 3A7RA 1I2DA 1AO3A 1K6EA 2XUFA 3NEPX 2W2XA 1YJCA 4N3NA 1NXQA 5B1SA 1C0EA 2FFHA 2EP7A 3JD2A 1RRPA 1XHLA 3G6KA 3RV3A 4YPOA 5CURA 3EXFB 4RKYA 4HSGA 4MLZA 3KETA 4LDJA 4CEJA 2H1WA 3ET4A 1C0AA 2QNRA 2EP5A 3I1YA 1QB8A 2VPTA 4AKHA 1N3LA 2FWMX 4M6WA 3PXXA 4WH0A 1O6CA 3Q6IA 2WHXA 3NEAA 4I4TF 3UC9A 5KNNA 2L82A 3WV5A 1WYDA 2R84A 3AB8A 2VUIB 5D3MA 1JILA 4FCWA 5AVYA 1T8UA 4K1XA 1QLWA 4CDGA 1YE3A 1T0JB 3E3LA 3U44A 1WP4A 1MA3A 2ZVQX 1ZK3A 2XMCA 3L8MA 3TCNA 1O9BA 4RMHA 2IDMA 4L0DA 3TKYA 2GD2A 2HQSA 3JWPA 3KJIA 1LJUA 4TXHA 1DXYA 2RGAA 2IZ6A 3ZE1B 3PA6A 5F5LA 4EEZA 3BMXA 1LBEA 1ECPA 3GC6A 2HA4A 4HLQB 4NS1A 5T6MA 4E51A 2BM9A 3ECCA 1GKUB 2Z1NA 2B8NA 4RNDB 3KHTA 3ADPA 5K0BA 2BOVA 1X7WB 2GSDA 1SQFA 3ZE6A 4C78A 4OMFG 5MN6A 2HM7A 2Y99A 4H3VA 3ZLBA 4DCNA 3LOPA 3QF4B 3KS9A 1JIUA 5JWHA 4EX6A 4IFBA 4M8IA 3U7QA 3DD1A 1OI3A 2NXCA 2Z8YA 3C2QA 3K5HA 3ZDFA 4CRWB 1QOQB 4HEA6 3ZE9A 1LFAA 4EPWA 3BD6A 1Z6ZA 4E32A 1V9LA 5BQOA 1NE2A 2X8WA 2YXEA 3BL5A 3DKRA 4LJYA 4B6PA 1EXWA 2JAXA 4S0XA 3N87A 1D03A 1N2BA 4ZV4A 3ZWBA 1BX1A 4G81A 3WFIA 2GJ8A 5JAPA 3PNYA 4ARZA 4XJXA 2Y6UA 1JPNA 5E9WA 1SN7A 1ULTA 1DGQA 1RTKA 1JJAA 3U4AA 1BBWA 1EINA 1KFBB 2C04A 2VC2B 1YRQA 2P75A 1TMKA 2WJIA 3WDSA 2I7TA 4CN8A 2DHQA 3FLAA 1X9GA 1M5TA 3Q9NA 4KQFA 2VP0A 4WLOA 5H83A 3KZMA 3KOXA 1TVCA 1RPTA 2XX3A 5D1HA 2H4FA 3VHLB 2ERCA 1Z28A 2F6RA 2C3MA 2H8KA 3MFYA 4GGMX 1XXLA 3GEDA 4RPJA 4DUGA 5I8PA 4DUYB 3AUYA 3DGEC 4QDZA 2IXBA 2QGZA 4TTTS 1CPYA 4RIHA 3ND9A 3ZD6A 1ZK4A 4C1BA 1Y3AA 5HUQA 2EYUA 3FZEA 4P4TA 5K01A 1NVDA 3THXB 3GN2A 2ZXFA 5HBGA 4MAMA 1DV1A 1EWKA 1R4NB 1RJEA 1JHXA 3G9ZA 2JDID 5LBUA 1IBMB 1I01A 1MZVA 2RKWA 1I14A 3C48A 5L3QB 5CHEA 3ZDAA 1OWLA 4PIVA 3QY9A 4F84A 5JYDA 1IB6A 4D6PA 4OXRA 5L6MB 2FX5A 5HDQA 1T2AA 5K99A 2P4HX 2N42A 1GPDG 3ONNA 5E9JA 5EIHA 1E99A 3KDPA 4PSDA 1U2ZA 3OOEA 4HRYA 4FYIA 3OZDA 4JN6B 4RAQA 4X8LA 2H2DA 5DNWA 4YX9A 1KWGA 5T4HA 1CR0A 1JZTA 3TPFA 5DYNA 1NXXA 1TVMA 3BQNB 1DCFA 1V6SA 4JWKA 2XCTB 2D00A 1VJDA 4L8LA 1QQAA 2BEUB 3K05A 4EG8A 1AQNA 4J2HA 1USKA 2VRNA 2H92A 3GRUA 3MMZA 2YRWA 3W77A 1SRYA 3PUZA 5HKKD 1W36B 2NSDA 2V9ZA 4DMMA 1CDDA 1X87A 2RD2A 2HIAA 1MXHA 1AV7A 2WJHA 3EVCA 3EPPA 3TVYA 4C01A 2J3LA 2O6LA 1E3MA 2WVHA 2FPXA 4KI0A 5AM5A 1GG8A 3NO4A 3Q5GA 2ODRC 1KO7A 2X23A 3F4BA 1OKKA 5ESDA 1LX7A 5FQNA 3EGXA 4BV8A 4BBJA 5JADA 2WG1A 2QP9X 3H0CA 4B82A 1J06A 1T34A 1SD1A 3LSQA 1T0HB 1YMVA 4IHJA 3UIEA 4CMEA 3GLIA 1YO6A 2A1TR 5FUYA 2RG7A 5EAIA 1RM4A 1FQJA 2IHNA 1L1RA 2C7IA 3LP5A 2QTVB 4RORA 5AXDA 3KD3A 2FE4A 4LKRA 2V6MA 2GJSA 2IP1A 3QLJA 2WM9B 3VZBA 3L43A 3OZCA 4IF6A 1XK6A 1FE8A 2DWQA 2YXLA 3UUFA 4PCLA 3JD4A 1BS9A 1SEVA 3DMYA 3GPCA 5K3AA 2ZBEA 2HAEA 3C39A 2GM9A 4POOA 2IQIA 3HXPA 3I39X 1DKNA 5JIBA 3C3JA 1TVKB 1XEFA 1SD2A 2FN9A 3H5OA 4ZC8A 1C1HA 1KYQA 1QCZA 1OAOC 4B83A 5CLIA 3LFUA 2Z6QA 5JCZA 4ME6A 4ERNA 4PZLA 4YJFB 4LYYA 4NCKA 3NAGA 4Q24A 1CFJA 2KS6A 5FUXA 1SR8A 3ISJA 4GL4A 4X8OA 1F4LA 3TRHA 3LPCA 1M76A 4KIJA 2BI4A 2GK4A 2GVNA 1CYDA 5AW0A 1RRCA 4PO8A 2Q4DA 1O77A 3H42B 2GYYA 2XSZD 3H5AA 4G0QA 1LNQA 2WU0A 4NBLA 4X6XA 3P2JA 5D00A 2VG8A 4Y2XA 5HSGA 3RFVA 3N9IA 4ZAGA 121PA 2WILA 1BBUA 2YXNA 5KNCA 3HYTA 4O4HB 5DM2A 1WVMA 2CJPA 4GXRA 2PGXA 2PLWA 1E2QA 2FPRA 2WUVA 3A4TA 3I34X 5FTJA 4COOA 1QP4A 4U0KA 3CLUC 1TK2A 1RAIA 3TFOA 2FLVA 1JB1A 1XTJA 3IMFA 5BVGA 4MWOA 1KA9H 1DAFA 2FCRA 3GG2A 4Q9NA 5EKSA 2FWJA 3FZGA 5IWCA 1A0OA 1IEVA 2QRPA 1ZKMA 5F35A 5BSEA 5K8VA 4BQEA 2XGOA 4N5NA 5G4KA 2J3KA 3K9BA 3Q9SA 3V8PA 3ZGXA 1QXSA 1NXVA 1YZQA 4WTOA 4IX1A 2YHUA 1VI6A 2FMHA 4KX5A 1ISFA 3SMQA 4IH1A 2EJ9A 5CEJA 5FULA 2VHVA 2X1MA 1KXZA 3PCXA 3ES9A 2XUJA 1BHQ1 1OYWA 2ZBGA 3KDSE 4JT2A 5E4TA 1E96A 4DSNA 2HXGA 4WOCA 5B55A 4H7EA 2ORVA 3HGTA 3CZCA 4YY3B 1HYBA 1ONNA 3RFFA 3AUJB 4XA8A 4ZT2A 4PG6A 4ZRNA 1EAMA 3TL3A 4MS1B 3TUIC 4HB0A 3L1JA 3M4QA 2G6TA 1GAEO 1HPLA 4QUGA 3IHKA 1EHIA 1VL1A 2BEJA 1RCTE 2P2CA 3C15C 3GFGA 2CXOA 1Z0SA 2I03A 3LO8A 4JU8A 5EJ7A 1WUIS 5K6AA 3TBKA 2BMVA 1HE1C 1YQXA 2Q4EA 1DFHA 2ZDHA 3EIUA 2EZ4A 3B6EA 3OX2A 4U7FA 4DZTA 1T2UA 3DV9A 1EEHA 4N76A 3TUPA 4MKIA 3AI3A 3L0IB 4QQRA 3FPHA 3IFSA 3T7TA 3K7EA 4QUDA 1ZIDA 3CLSC 3OFJA 2P2GA 4QPZA 1POXA 1WIWA 2CWDA 3EBPA 3PR2B 4EWLA 1IWOA 1DCKA 1U7ZA 4F46A 1QANA 4M3NA 4MITA 1O0SA 1EAYA 1ESNA 4W8HA 1FRZA 1H0SA 1UJBA 2ZINA 4RK5A 2VXOA 3WTCA 2PUGA 2CNWD 2CLMB 2L42A 3JZAA 5H81A 1P2UA 2NIPA 4F6LA 2WWHA 5GVSA 3ZV3A 3WKBA 1BD4A 1JXOA 1DOZA 1FUKA 3BRWD 4WESA 2Y0PA 5THKA 4ZICA 3A1FA 5TB5A 2IXAA 2ET6A 4Y2PA 1XNQB 3C6QA 4TQUS 5CVEA 4BECA 2Q0HA 4PQEA 3F3MA 4U7DA 2BH2A 3LBAA 4DB4A 2ZE7A 3OI7A 3K4QA 2NTNA 3LQFA 4JS0A 4B2LA 1E0JA 3BSYA 4EYSA 1TU0A 1ZOLA 2CXQA 3DNMA 3MNFA 2YMQA 3L07A 1GTZA 4B6OA 3SYKA 1IOWA 5EVJA 4LTNA 4H16A 1YFLA 1RJ9A 2HU8A 4E13A 4KQJA 4ZTUB 2P6PA 4GOKA 4JLPA 4BBZA 1XZDA 4BX3A 3FCXA 3G85A 4I8DA 4G0MA 1AKEA 3CPEA 1QOPB 1ORHA 5I9LA 1DPGA 2JFPA 3CUSA 4XFJA 2KBEA 1V16B 3PQFA 1ZWLA 5DYGA 3MD0A 3UUGA 1F17A 4FGZA 4JA0A 4PPYA 2HDHA 4CG1A 2WM8A 1X19A 4W5NA 1WPRA 1BRTA 1KNXA 1FMLA 4A8JB 5CBPB 1HA3A 2OGZA 2X4IA 3LDAA 1JX6A 4DV2B 1U81A 2G4VA 5D3KA 2O5RA 4H4DA 2DUUA 5DIFA 8ADHA 3H2SA 2JFVA 5K3EA 4O3MA 3V7CA 2ZE6A 1LTQA 2Q5LA 2G76A 2WZDA 2ZWVA 1PR3A 4V1CA 1H8HA 2VT6A 2G8LA 4HAYA 5DTJA 3F47A 1H8EA 1HE4A 1C2TA 1F8GA 5KWVA 3QEAZ 4PS1A 3M4NA 1BOOA 1VG8A 1AURA 1IH8A 3CLTD 3LF2A 1V6AA 2XKJE 2OQIA 1TFRA 4YFVA 5FNVB 3C6BA 1GKIA 3NP7A 4BVJA 2Q27A 1GZVA 3WGMA 3NWEA 4ZYZA 1B70B 4ZYWA 3MIIA 2TMDA 4AXBA 4UU7A 2AZDA 2DUWA 2RCYA 2FXIA 3Q9LA 4PX9A 1Q92A 1YS6A 1KRHA 3G1ZA 1XTRA 2FOLA 4GM1A 4ZVQA 1YRWA 1UFKA 3V7UA 4B33A 1WDTA 4U2EA 2OR3A 2ZANA 1S7GA 3E9HA 1N2EA 3DA8A 1R5NA 2RB5A 4LXXA 4UUOA 2C2BA 2VSNA 5COAA 4R2KA 3TLCA 4LGYA 3FRHA 4Y2UA 2CZCA 4G1FA 1LPAB 5ULLA 4A2QA 3NIDB 1R6DA 4JEHA 3FY4A 4EO9A 4FDLA 5CDTA 3T7KA 1YIDA 4C14A 5JJ5A 4G8JA 4HDMB 1OFVA 2W11A 3JTMA 1YBFA 3VNVA 2FRVA 1Z5ZA 3FBTA 1RAHA 2MYUA 3AEQA 5TPWA 2AF3C 3PS9A 1CJKC 2WAYA 4E5DA 3NDPA 1OQAA 4IMJB 4Q12A 5C35A 1UBCA 4EATA 1NBAA 6REQB 5ADHA 2P7HA 4FXPA 4P4LA 1MOSA 1Q1NA 2EGHA 4Z99A 4AAYA 2WTAA 4EJFA 4AJPA 1QU2A 1ZESA 3DFIA 4U2GA 1UDRA 2PKRA 4GYYA 3ROTA 3N74A 1KMIY 4CKWA 1E1LA 3B1XA 5K0JA 1S8AA 1Q0ZA 2DECA 4I46A 3UJHA 1WX1A 3TQHA 1MXFA 3B89A 3U4MA 1EQ2A 3RYCB 3OLYA 1W581 2H11A 3FSRA 4L4UA 3EPHA 1MAWA 1P0PA 3DZCA 3DUWA 1B7YB 1US8A 4CKBA 4CS3A 2OECA 4ZEOA 1L5OA 3GNQA 5AK3A 4JXZA 2NUTA 4D3SA 1ZN9A 1MFPA 3P9IA 4HRXA 5AK5A 1JI0A 1U1EA 1A9ZA 3B3JA 1E60A 4PN7A 1GPMA 1C3LA 1ODIA 1B7GO 1QRAA 2QLJA 5JWRA 3VPGA 4JSYA 1F7VA 1HNXB 4IILA 4DA7A 3SIPA 2MYTA 5CDHA 4Y0VA 1YFJA 1RAAA 1PAUA 2OHIA 1U3CA 4OBXA 3AR7A 3MSXA 4RDCA 1XP8A 3TG2A 4OVKA 4M89A 1I3OA 2CEAA 3K8OE 4LRWA 2Q9AA 5JSUA 3HP7A 1OB5A 2XNSA 2VDNB 5DCWA 1BCSB 5DEOA 3KZVA 2VIIA 3NOVA 1JWLA 3O93A 4DR7B 2JLQA 4ZVTA 5JXWA 5IAJA 1OR8A 2M6LA 5TQ0A 3ZHOA 2O8DB 2XY4A 4PG4A 2GRJA 3DDWA 1QM5A 2H52A 3CR8A 4KW7A 4ND6A 4L4ZA 2FUEA 4CMIA 4UD2A 2QBYB 3K0AA 2R1VB 3QE3A 2G80A 3JYNA 4EUEA 1DIGA 2J6HA 1N1GA 1M1NB 3S3TA 3ZHRA 4D6YA 2BUAA 3AUTA 4DIBA 1DG9A 4DABA 3TG8A 2IDZA 4GS5A 3DTVD 1FX0A 1O9GA 2CJ9A 1Q2XA 3AHCA 4A4DA 1OPXA 4I2NA 1EI9A 1EK6A 5CD9A 3V8JA 3NQ41 4WCDA 2REQA 2WIDA 3KC2A 4LHXA 4EG3A 3RSZA 1IN4A 4PLYA 3A3YA 3FOBA 3SF0A 3LVQE 4A0GA 4BNNA 5E3HA 1H2WA 1CUDA 3MWDA 1Y80A 3IHLA 1RWBA 1C1DA 1T9ZA 2NU7A 1D2EA 1QVWA 2HWWA 3IOCA 3EULA 1N6IA 1WHSB 3OLQA 2HPAA 1VFNA 4W5HA 4ZOCA 2QZ9A 2YIJA 3ZU2A 5IK2D 5EJIA 3OX4A 1KWKA 1GNSA 1I1NA 1BS2A 2V7UA 2FAXA 2P9TA 3UYKA 2OM2A 2G5CA 2QLNA 1YR9A 3A5YA 3TGLA 2WICA 2ADMA 2QR2A 4ZEMA 2V7GA 3PC3A 3D54D 3U4HA 1P2VA 1H2HA 2Z2JA 4RF2A 3ZCPA 1T9KA 2QQGA 4C30A 1DQRA 2H2AA 1UBTS 2NNWB 2TSYB 2Y0CA 4TSFA 4LF5B 5FO0A 4TKLA 2JNWA 3T9CA 4B4DA 3DL7A 5KOHA 3THYB 4NENA 3ESQA 3PV0A 4TRMA 4D4KA 1SERA 1R4MB 2RSLA 2Y0DA 4NL4H 3OJ0A 4RCZA 5BN4A 2Z98A 2VT3A 3D59A 4O5OA 1E89A 2PG3A 1M2KA 2YJ5A 3EQ8A 1E4VA 2VJLA 3DH0A 3ZTWA 1EKXA 1R16A 1EJ6A 1GTVA 2PFGA 3NXKA 1T5IA 1VKHA 2WUGA 1THGA 5IJWA 1MNQA 2AN1A 2FQQA 2XIQA 3PUIA 3TLGA 3UMCA 3I30X 2H5JA 3A11A 1A2BA 3PQ6A 4MGYR 1ZP6A 3TAHA 4LRXA 1NR5A 2I6SA 4Y1RB 1V35A 1DTSA 1QO7A 1MEOA 1VRWA 3LDGA 2ZT5A 1LJ8A 1WW2A 2DY1A 1RCFA 1B8UA 4ZP1A 4KN8A 4C7BA 3I6YA 1P7ZA 3E4DA 3E5MA 3ABSB 4AF8A 3FMFA 1Q2UA 1IXZA 4WCFB 1ZICA 3I9NA 3KBOA 4XDHA 1L5YA 3DVSX 4X95A 4CM4A 1VG1A 4YB8A 2G8NA 3RS0A 4B7AA 3ICEA 3TZ6A 1U4SA 2JLRA 3OCCA 4KGDA 3R4CA 3WB2A 1VJ5A 1TAHA 1CLUA 1CG6A 4P5PA 2X8AA 3FGPA 3ESCA 5IJXA 5CA0B 1APBA 1XCJA 5FOXA 1Y48E 2LZ0A 2PZAA 4IAOA 3ZY2A 1FBTA 1A7KA 1Q1BA 3K09C 1DXHA 2CMHA 3CUTA 3UHPA 1T35A 5C18A 3GLIE 3GLGB 1C50A 1CJTC 3SQNA 2DMRA 4RUKA 1GEEA 2VT7A 2WJ4A 2FW9A 3A36A 3KT0A 4RTRA 1TRKA 1EFRD 3IQGX 3QYPA 4LYHA 4NFSA 4ZQGA 3IURA 1GG2A 3KOUA 4EENA 3BMNB 4JHLA 1GITA 4GOMD 5H7XA 4CQMD 5C52B 3VKGA 2PX3A 1V7CA 1KJ9A 4XJTA 4YP5A 4DV0B 4H3KB 4GVPA 4I4LA 1BGVA 1VMDA 2BFCB 5JLAA 4KO2S 3T7CA 1LUAA 1UEJA 2QLBA 3L7NA 3S2ZA 4IINA 3QSGA 4UBKA 1S4QA 2AZMA 3LCUA 1Y5LA 2WF7A 1ZMOA 4G63A 4TWBA 4EA9A 3NBUA 3UHJA 2IY5B 1FNSA 1PZNA 2YYAA 3BXHA 1HFWA 1TZ2A 2BEVA 2M1ZA 2ZI3A 2BJHA 3DEZA 3CB2A 3L1UA 3RS7A 3C5WP 1VKZA 1TU3A 2J5QA 2Q8QA 2Q1XA 2WC1A 5TIIA 5J2UA 1G3RA 1NNLA 3L05A 4GX0A 4ZJUA 3HCNA 4OA5A 4FCTA 3Q2OA 4M0EA 5F7ZA 5ITWA 5KX5B 3AF6A 3U6KA 3Q4GA 3MT0A 1R0KA 3PSAA 3KELA 4M60A 5FYDA 1M8FA 3CRNA 2ZPUA 1KZHA 3NYRA 4ACBA 5JBNA 1A3CA 4WZBB 3MW8A 5LCXA 4LYGA 3ZH9B 2Q3JA 1E2NA 5IJ0B 1TM2A 4X65B 2BUCA 4JL5A 2Z5FA 3TNJA 4P4SB 3VC2A 4YK7A 1Z5WA 2DR3A 2Y05A 2EWNA 1EMDA 2X6TA 1SY7A 5T8KC 2PYIA 5TMPA 1PVOA 3FJ1A 5BORA 1Z4JA 4HWKA 4K5QA 4DIOA 1S2IA 4BNMA 2ZB8A 1KO4A 3ROEA 3IXMA 3T9EA 3FDZA 3ORSA 4ZI7B 4JLVA 4FDAA 1KKMA 3IQDB 5L3SB 3FUTA 1HBJA 2ONKA 4RMFA 2GLXA 3ER6A 3DKPA 2Q41A 1LWOA 5IC6A 1YHNA 3A26A 3LBHA 3RVSA 1V8BA 3QOWA 4F8YA 3PNSA 3X1XA 1FFXA 4GWLA 2LDBA 1DOHA 3PXAA 2RGNC 2GD1O 3ABOB 2HD4A 5DFAA 2CJWB 1DHTA 4QM7A 1E20A 1O03A 1I2CA 3BA6A 1CFZA 4CCYA 4HGOA 3HN2A 3SZGA 4TV9A 4D82A 3R3HA 2QA5A 4RV4A 3K1TA 2BE7A 3AR8A 3X1KA 2EDAA 2HTFA 3QOXA 1M6VB 5K0LA 2ZI6A 4XIYA 3UC5A 1LQTA 2UKDA 4R1TA 2ONZA 3S40A 2W0MA 4L8GA 4NX2A 3A0RB 3W79A 3L49A 2SHKA 3LX8A 3LCJA 3PQ2A 4CLOA 1YB2A 5FLYA 3KXKA 1WD7A 2G9UA 2ERXA 2P78A 2BHTA 1JQBA 3CUEF 3E53A 2RK3A 2YN0A 1XZBA 3N3BC 3TD2A 4MUBA 4BFWA 4O2AA 5MFPA 1NN0A 1UK8A 4L57A 4ODIA 1G3QA 3PFCA 1NUUA 1OWNA 5BVHB 2ZP1A 4XTUA 3H11A 4M46A 3RANA 4EPRA 3KR0A 4XD7A 4URXR 4BFUA 2GWHA 3EG9A 5IMSA 3LL7A 3RSFA 4XWGA 1T9HA 4QTXA 4NCNA 1DAKA 1LW6E 2NVUA 3GJXC 2ZJBA 1G51A 5IG2A 1SKMA 1U7PA 3ETDA 3NVMB 4NZNA 5BNFA 4BKUA 2YASA 5D2CA 3X1MA 1CJCA 1BQ4A 1CY0A 1H2ZA 1TA4A 2BBTA 2FW0A 1G0OA 4O0MA 5IBRA 2W71A 2RONA 4RQEA 4YGXB 1XXHB 3ISTA 4C07A 1DEOA 3GJTA 1XAGA 3CF4G 1GNRA 1NF3A 3OMXA 2WLTA 1EFLA 3GI1A 4V0LA 3O8CA 1EFUA 4RD3A 3FYSA 4XGKA 1VPDA 2ZIGA 1CX9B 3AR4A 2D7CA 3VSAA 1JDPA 3SYTA 5BMVA 3M2TA 3COZA 4M1EA 3R9KA 3I9MA 3PE4A 3VU8A 3IJ5A 3GLRA 2NN3C 3QQ5A 4MUHA 2BELA 5CB4F 2C1XA 1I3LA 1U0GA 4DA8A 3D7RA 5C5CA 3LOUA 1VHWA 1LDMA 3USCS 2IYZA 3DV2A 5B6PA 3T1YB 3KSAC 3E7WA 3WJ1A 4CYMA 2F43A 4FTWA 1H6DA 1QFSA 3D4PA 3PLRA 4P84A 3HYRA 3ZV4A 4RZHA 5F1PA 3BIWA 2NXNA 3M0EA 3OOHA 2I91A 4GPD1 3M5WA 1TZKA 1VLHA 3F6CA 1GWNA 1E8MA 2ISSD 1BE8A 4FZRA 4NU0A 3RFUA 2YWXA 1X1EA 1NU6A 1SIWA 4HDNB 4HG2A 4WSOA 4YGYA 1T9AA 3AXSA 2J3DA 2VTEA 5T3UA 4J1TC 1YHYA 4J15A 1TKRA 4EHDA 4GBED 1DCTA 2BMDA 2CV0A 2O1EA 1YF3A 4AQDA 2AI3A 1JLLB 2W6OA 1SIBE 2PVSA 4NYJQ 2O7RA 4P73C 5EJ2A 2PBRA 4RZUA 4CMBA 3U5TA 1Q44A 1W0CA 1JPVA 4RBNA 4RXMA 1NP6A 4XD2A 5LP6B 3V4VB 2WYVA 1TT5A 5J5CA 3DP9A 2NO5A 5B2EA 2RGBA 4XU0A 4F3YA 1SUFA 4BNUA 1G5RA 2CGHA 2CK3D 1JVNA 1EFHA 1VECA 4KYUA 3W5VA 5JXHA 4NJOA 2NO4A 5ALPA 1NYRA 1N5LA 2Y66A 4ND3A 4REQB 1QLHA 5FOWA 4LJAA 3MB5A 5H9WA 1S02A 1HNNA 3VU0A 1CUJA 2HMVA 3I5XA 5KKAA 3FCSB 2OORA 4ZYTA 1E3QA 1JAZA 3H1BA 5EE0A 4ZKDA 2D1SA 2YHIA 4YRMA 4J1NA 5JQWA 4QFBA 1ND6A 4MQFB 4EHJA 3TOZA 3N8GA 1EP9A 2BEWB 3ZG6A 3LCMA 1J70A 1N8KA 5DGTA 4WFKA 1U0JA 5FLKA 2XMRA 4I9GA 3SYLA 2GS9A 2LIPA 1RCUA 1TW2A 4HXGA 4S2UA 5TF0A 3VU9B 3QA3E 3Q72A 3O8RA 1UPBA 2OBXA 3AEKB 2FRDA 2IOYA 4LYFA 1XDBA 2VTDA 3TYXA 4KJZA 1JEEA 3TIFA 3TTWA 2PMBA 2BR3A 4TQAA 2JIDA 5ALDA 2AFHB 2W90A 2O8FB 3DBIA 1T3LA 5DMXA 2EXXA 1YZLA 1J1ZA 3IODA 4RZ2A 4WWHA 3E8SA 1FRQA 5TT1A 1SULA 1TZBA 3A6EA 4MWGA 1QGYA 3AFNA 1ONOA 1T9BA 4MKFA 1JV2B 4XOIA 2O14A 4EABA 3KCNA 1QC5A 5CYFA 4JYCA 5DLEA 1KY3A 2HMSA 2JS7A 2ZRNA 2EBUA 3DCJA 4DHWA 2XODA 5HQ3B 5I7OA 4X66B 1A9SA 2OZKA 1X7YA 2PH7A 4JZKA 4Y1GA 5FWAA 1TMGE 4FFBB 4KQIA 1EUCB 4W5JA 4BKMA 3R9WA 4A8TA 4EHHA 5I45A 4RANA 1V7PC 1XD2B 1MB2A 3NCHA 1LQUA 2PJUA 3OVMA 2DBRA 4D46A 4KYTA 3VA7A 3PHBE 2Q7EA 4JOSA 5B4UA 1P91A 1O8BA 2BN4A 2VH5R 4UU1A 4CTOA 2COUA 4UQLA 1SHJA 4I4TB 5E6UB 2FCAA 3G5TA 1NJ2A 5E6UA 2PS1A 3P9XA 4JDPA 2XNJA 3A6HA 3M3PA 4OQDA 4R5HA 2W2OA 2Y0BA 4RVOA 1KZYC 1VKJA 2DQZA 4QUIA 2WTEA 3R3UA 2AKAB 4FMBB 3RHFA 4ALKA 4EFMA 3PZBA 3I9LA 4M0CA 2I62A 3U4DA 1DMRA 4QD3A 3FWKA 2R1ZA 3GB9A 5E6SA 1B3RA 3I2FA 3ENNA 3R9XA 2FK7A 3CSDA 4LDNA 2I9KA 3E3OA 3HZZA 2FW7A 2I2XB 5ALVA 4GLFA 2XJ9A 1JIJA 1RNLA 3I76A 4P71C 1IHYA 5TMBA 1JPJA 3IQFA 4B09A 2YW2A 1CS4C 1K5PA 2AZXA 3B52X 4H7FA 1WETA 3GZ4A 6AT1A 2O59A 2DWUA 2OY0A 4FUTA 4EG4A 3GARA 1H66A 1B0PA 1RZ3A 4Y98A 3F8SA 2IYUA 4H2UA 3R0JA 4OF4A 4PX3A 2WTUA 3PFGA 3KPYA 2BEKA 3SEAA 1SUDA 3MF4A 2VDKB 3OCZA 1YGPA 3IEKA 4FLEA 4F5ZA 2H4YA 4JWTA 3V4PB 4PICA 1L5QA 3L8GA 3PXBA 3OP4A 5ALOA 4A2WA 3PUVA