4HVCA

Crystal structure of human prolyl-trna synthetase in complex with halofuginone and atp analogue
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
497
structure length
482
Chain Sequence
LEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGILSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARMGAKSLCIPFKPLCELQPGAKCVCNPAKYYTLFGRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ATP-directed capture of bioactive herbal-based medicine on human tRNA synthetase.
pubmed doi rcsb
molecule keywords Bifunctional glutamate/proline--tRNA ligase
molecule tags Ligase/ligase inhibitor
source organism Homo sapiens
total genus 162
structure length 482
sequence length 497
chains with identical sequence B
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2012-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09180 ProRS-C_1 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 4hvcA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4hvcA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 4hvcA02
1WYDA 2EJ9A 4HWPA 5C53B 2IY5B 3NELA 4P73A 1QE0A 2ODRD 4HWRA 3RIRA 4P74C 3R07A 4BWAA 4UP9A 4YRGA 1H4SA 1X2GA 3OD1A 4DQ2A 1ADYA 1E22A 4YRRA 4P73C 1NJ1A 3HXWA 3E9IA 1X01A 2DKGA 1X54A 1W66A 2RHQB 4HWOA 4TVYA 3LC0A 1BBUA 3UGQA 3L2ZA 2QHSA 4H2VA 2ZCEA 4P75A 1PYSA 1WLEA 3REUA 1V95A 4YROA 3HXXA 4H2XA 2ZT8A 2E41A 3A31A 3TEHB 1LYLA 1NJ2A 3PCOA 2DTOA 2AKWB 2DU5A 2AMCB 4CS4A 1FYFA 1B7YA 1H4VB 3L4GA 1SESA 11ASA 2QHUA 3IALA 4YRNA 2ARUA 4P3OA 1L0WA 3TEGA 2HNIA 4PHCA 4P71A 5C52B 1NJ6A 2ZINA 4UP7A 4YYEA 3QO5A 3HXYA 1YFSA 4YP0A 4XTXA 2LW7A 1HC7A 2E3CA 3V7RA 1H4QA 3A7RA 2ZGWA 1WQ7A 4CS3A 1E24A 4P71C 2ALYA 1NJ8A 2DTIA 3CMQA 1G5IA 4CH3A 4OLFA 1JJCA 4YDQA 1X56A 4H02A 1HTTA 4BW9A 1EIYA 3W3SA 2DU7A 2IY5A 4L87A 2C7IA 4XU0A 1WNLA 1J5WA 4K88A 1YFTA 3IKMB 1G5HA 2DVEA 3BJUA 4XTVA 4TVWA 4YRCA 4UP8A 2ZIMA 3QO7A 5K1XA 2ZIOA 4CH4A 1N9WA 5ELOA 1E1OA 4YCUA 4YRTA 2ZZGA 2DTHA 2I4LA 1YFRA 4WJ4A 3VQYA 3A7UA 2I4NA 3DSQA 2RHQA 4CH5A 2I4MA 4ZTZB 2QHTA 2DXTA 2ZT7A 1ASZA 1KMMA 4H2WA 4YPFA 1BBWA 2Q7GA 4XU3A 2ZT5A 2Q5IA 2RHSB 3UGTA 4Q6GA 3HFZA 1X2HA 3G1ZA 2FYKA 4YRMA 1EQRA 2DZCA 4LNSA 4HA8A 1B8AA 4TTVA 5C51B 1HXDA 4J15A 3MF1A 4XTUA 4CH6A 2Q5HA 4P3NA 2PMFA 2DDZA 1ADJA 4NCXA 1SETA 4YRFA 1VQZA 4P75C 2PMEA 2DQ3A 2ZNIA 5HGQA 4KQEA 4HWTA 1NYQA 4RQEA 3VBBA 3NETA 4XEOA 1PYSB 4CS2A 3V8JA 3P8TA 4Q15A 4H2SA 4X5OA 4H2XB 4YCVA 3M4PA 3RGLA 2E5AA 4TVAB 4KR2A 2XGTA 3PCOB 1EFWA 3TUPA 3HRIA 4TQDA 1EOVA 3WQZA 4P3PA 1C0AA 1B7YB 3L4GB 4K87A 3ERRA 2EWNA 3UH0A 4H2YA 3A32A 3RL6A 3HFVA 3LSQA 2ZR2A 3A5YA 1BIBA 4UPAA 1NYRA 2ZZFA 4RDXA 1B70B 5F5WA 2EAYA 3HXZA 4XTWA 5K1PA 2E10A 3HY0A 4YCWA 2XTIA 3HY1A 3HXUA 2CJ9A 3RF1A 4EX5A 4OP0A 1SRYA 2J3LA 3L1AA 1G51A 3P8VA 3RUXA 4XEMA 3HXVA 2DXUA 1Z7NA 1WPYA 2CGHA 1EIYB 1KOGA 2G4CA 4G84A 3MF2A 2DQ0A 1SERA 2E64A 3TEHA 4ZIBA 4P72A 3HTZA 3NENA 3HRKA 3VQVA 2AKWA 2AMCA 2ZT6A 3QTCA 3V7SA 1ATIA 12ASA 2ZTGA 4WI1A 3IKLA 3P8YA 4YREA 2ZXFA 3NEMA 1GGMA 2EJGA 4O2DA 1EVKA 4YRSA 4P72C 4YRJA 1IL2A 2EL9A 1WQWA 2DEQA 4AH6A 2EJFA 4KR3A 2CJAA 1USYA 4TWAA 3BFMA 4YRIA 3MEYA 4RQFA 1ASYA 2CJBA 3REXA 1NJ5A 3V8LA 4TVAA 4YRLA 3HFZB 3RKXA 3KFUA 3M4QA 4XU2A 2DZ9A 3QO8A 1EVLA 1H4TA 4PG3A 5KNNA 3A7AA 2ARSA 1USYC 4YRPA 3QNEA 2Q7EA 1NNHA 3RKYA 3FJPA 1Z7MA 3ICAA 2E1HA 1B70A 5ELNA 1X55A 3I7FA 4HWSA 2C8MA 1YGBA 2ZR3A 3PZCA 3V8KA 3UFGA 3EFRA 4XU1A 2ARTA 2CIMA 3IG2A 1B76A 4TQFA 3VQXA 4XTYA 4YRQA 2DJZA 4RMFA 3A74A 2ZZEA 2P5IA 2ZNJA 3A5ZA 4EO4A 2E65A 4DPGA 4YRKA 4H2TA 2ODRC 3RKWA 4WF2A 3LSSA 4ZTUB 2Q7HA 2QHVA 3RACA 1QF6A 2J3MA 4HVCA 2ALYB 1KMNA 4K86A 3EFSA 4E51A 1YB3A 4P74A 1BIAA 2P0LA 4XTZA 2I4OA 1JJCB 4H2UA 3VQWA 1E1TA 2RHSA 4WJ3M 5E3IA 1WU7A 3E9HA 1RIQA 4G85A 3V7CA
chains in the Genus database with same CATH superfamily
1VLZA 3FAKA 2O48X 4EA7A 5F3WB 2QJRA 3M6UA 4N7RA 3T9AA 2AN5A 3HA3A 3ADDA 3HKBB 1IZ8A 1XQVA 5LC1A 2JASA 3U7QB 4C4SA 1N9GB 5G1OA 1JECA 4HS4A 2X6QA 4Q82A 4F4IA 5KX5B 2WU0A 3BJZA 2X3FA 4H7PA 5M7EA 5E1BA 2Z6VA 3H2KA 2DM6A 4CMCA 4J2TA 2WAYA 3QM1A 1KJNA 2BIFA 4ME6A 3EXG1 4OK5A 3G59A 4CBVA 1W2GA 3G1UA 3OJEA 2Z2KA 4QUAA 5IUNC 3DPUA 4UQOA 4L27A 3EDCA 4TV8F 1X86B 2FCRA 4KQJA 1T0PA 1SVWA 3DC2A 4CLRB 4XRGA 1DMRA 1A1SA 2V9CA 1ADYA 4YCSA 4J16A 3PWTA 2JH9A 3COPA 1FP6A 1MPTA 1Z2NX 4IIJA 2B83A 2GPBA 5KJEA 3P9XA 1NQTA 4GYYA 4ZALA 2DWPA 5GJVC 1QK3A 1RXSA 2XAUA 3C5WP 4YI5A 5KVSA 2LNDA 2TMGA 3RABA 3FTDA 1T0BA 1KOFA 1ZGJA 3PXUA 4EHKA 4D4LA 2WHQA 1FDUA 1P73A 2O5VA 1QC5A 2F43B 2F7SA 2VAXA 2WF7A 4B6GA 2IU6A 2V7WA 4B8YA 5KYWB 3UGQA 2GASA 4MW2A 2IFEA 1YR8A 5EJ9A 3CNHA 3LDFA 3OM0A 4CF4A 2VF8A 3TTWA 5AW1A 5A5DA 4HNGA 3ZHCA 3HZZA 1V95A 3VO9A 4GOND 1OD6A 2PSSA 3ZWMA 3MJ4A 2GZ3A 1EFRD 1W2WB 5A04A 2G71A 4EW2A 5B12A 4P2BA 1XTSA 4QDOA 5L7TA 3WY9A 5L3QA 5EUMA 5IT5A 1LYLA 2QUZA 3E84A 5SZJA 3COWA 1ZI6A 4DWVA 3D3EA 3AEKA 1I6MA 2GTIA 3AIOA 2RI1A 3E61A 3PXAA 1TD1A 4O2BA 1NPYA 1OX5A 4TMWA 4PR0A 3FOEC 4ZVNA 3A0RB 4AROA 4HHEA 1IBMB 2GKGA 2PVPA 1GRRA 3N86A 5FULA 4NK4A 5ALVA 4DJDC 2D3TA 3GRKA 3RYCB 3KR0A 2NMVA 3GMDA 3DOCA 3CCCA 4N65A 1XNQB 3D7RA 2ARUA 1E98A 2DRIA 1J09A 4CTMA 4MCIA 4R51A 3RV3A 3FNHA 2AJ8A 2D62A 2L42A 2VTDA 3QQ5A 4JYCA 3TEGA 5HCIA 5TDHA 3DLCA 4P71A 1GKLA 5DM4A 2FSVA 3OUTA 3I05A 4TSFA 2C0CA 1EUCB 2NSLA 4X3OA 4YLGA 1WY7A 3IEPA 2IUEA 2QTVA 3LA6A 4JLBA 3CVXA 1H65A 3AY7A 1QTIA 3N05A 4GI7A 4OHMA 2XW6A 5IJ9B 3ZC3A 3N6VA 3V7RA 2QJOA 3BMOB 3W3AH 4BVEA 1Y8ZA 2GK7A 3K8YA 5GY7A 4DLLA 4FNGA 4L28A 3U7EB 2UUCB 2GHTA 1H6DA 5CLJA 1OKKA 1V11A 1Z2OX 1HBJA 3GEDA 4FJ0A 3W05A 1EZ4A 2AXQA 4KTVE 4J3JA 2VK2A 1ZD5A 3OOEA 4ARCA 4ZOEA 3THSA 4AQ7A 4P71C 2QR5A 1G8FA 4HK4A 1BRTA 4LXXA 1JO0A 2FSVC 1PO7A 3LW7A 4PZAA 4RV9A 3OZCA 1JFFB 4OI0A 1FMJA 3V8NA 2JFOA 1TE2A 4KZKA 2H4FA 1RI2A 1DHRA 5I7HA 3SBOA 1Z17A 1D7AA 3IPAA 2ZSUA 3PUZA 3QWHA 1SBYA 4FGWA 1GY8A 4KH1A 5CDFA 4I9UA 3M5WA 1R0CA 2WMOB 3G2IA 2LVBA 3LUHA 5ES4B 2ZJ4A 4P4SB 3UMSA 4DV1B 3B6MA 3RJ5A 2UKDA 2IY5A 3BAFA 4JJZA 4QBKA 2E55A 3R3SA 4BLRA 3ZDDA 4MS1B 2CUTA 3QLUC 4WDQA 5EGNA 1GVHA 1CUJA 1HWYA 3VX4A 5JD4A 1YFTA 1M6EX 5EJ7A 2VJKA 1G5HA 3MUNA 1JLLB 1IB0A 1L5FA 3PNLA 5EKSA 1DTEA 2H1IA 4LE1A 1Q1NA 3HO8A 5AK3A 1SKMA 2PYIA 3WYEA 5GJBA 1QP8A 1UOOA 2I7CA 2YYSA 1E2FA 4TV8B 3QW2A 2ECQA 3D6AA 3HRHA 5U4QA 2JKZA 3DL4A 3GGPA 3GPCA 1AD2A 2NPIA 5AKHA 2OYRA 3SHQA 4CKBB 4F4JA 1QGZA 4TYWA 2W6IA 2EL7A 2WEKA 3H2HA 3TDMA 2VP0A 4RKWA 3Q3EA 2J87A 5FF9A 1TEZA 1KJIA 1D07A 4OYLA 5A2QA 3DKVA 1C4KA 3RUEA 4A0SA 2IITA 4P38A 2H9YA 1T43A 4NU6A 1L7XA 4J2OA 1PGQA 2W0SA 1Q7GA 3V4VB 2IZ6A 5B3AA 1F06A 1ZQ9A 2W2QA 3IUBA 3D6MA 1OH6A 1JHQA 4JASB 1OXKB 3U4AA 3ZWQA 1OGJA 2QLFA 3C7DB 1KIMA 3DSDA 1CNMA 1KF0A 3AB8A 4AN1A 3VH2A 3RQSA 4ER3A 1CQZA 3ZI7A 3LT5A 1N1DA 3JQRA 2A3NA 5FEUA 3TZQA 3QA9A 3RAEC 1GL6A 1QOZA 1QIMA 1RAIA 3PDIA 4RL6A 3GLSA 5KCMA 3VZCA 3LQYA 4UE2A 2H54A 5JAMA 3CVJA 4N54A 1DAPA 1CUZA 1SKBA 2B3TA 2UZ3A 3U3XA 3UJ7A 3VU1A 4E7OA 1ID8A 1DC7A 1X2HA 4JJKA 3PNBA 7REQB 1SVKA 2Y1LA 4KAJA 5AVOA 4Y67A 3GB9A 4JLUA 2JBAA 4OHFA 4D9NA 3GA5A 3GBPA 3HJNA 5LMZA 1A71A 3D0OA 3ET4A 3HA7A 4ETWA 1W9HA 2M1XA 4ZO4A 1A04A 1UMBA 2J3KA 2H57A 3G5TA 3W2FA 4HA8A 4NZNA 1HRKA 1HXDA 4CV0A 5SZIA 1HK7A 1XFDA 2BBSA 3O4HA 1WDTA 1JJFA 2DFNA 4Z8XA 1LDGA 2G0NA 1TTHA 2HSWA 2VWQA 1YAHA 3SEAA 3VISA 2XCTB 3I8SA 1ZD3A 4FTWA 3IA7A 1JT9A 3AJRA 2GZAA 4IHQA 2ZJ3A 3IC5A 2X9NA 2LWIA 2Q5FA 5IAAA 2WHYA 3GYBA 4OGGA 3V3TA 4Q1DA 2GBGA 3Q6IA 4GRAA 4EQ6B 5FUXA 3I5UA 5G3YA 3ZE8A 1OIXA 3V1LA 5JNTA 4ZT2A 1I3NA 1P80A 2AE1A 5A7FA 3ER8A 1OI3A 1C0EA 1IOWA 5KJ6A 1MH9A 3F78A 2H18A 4JLSA 3WK5A 5JI3E 3WGLA 2OCIA 4O8CA 5F5LA 1L4GA 4JUIA 4V02A 2IHUA 3BCUA 4LTMA 3RI3A 1GLGA 4XWTA 1VTKA 1XAGA 5JD5A 3AV0B 3U4GA 4HRXA 3MMPA 1EE9A 1SFRA 4L4RA 2F8SA 1NU8A 2AW3A 1SELA 1P7VA 3N70A 1SBNE 4I5EA 2H06A 3W7AA 2RBGA 2RGWA 4D8VA 1FYWA 3S8MA 1RZUA 1L2TA 1M2JA 2WWXA 5HGJA 4D4MA 2ZIAA 3VPGA 2RHBA 1WUJS 1JQ3A 2J8ZA 3FRJA 3QITA 2HYIC 2CMGA 2FMIA 1Y5IA 1LY1A 3GNQA 2ZPTX 5MDHA 2E5AA 4OXNA 3ZVMA 3AVXA 3AVPA 5HKLA 5TPWA 2H2DA 3JVVA 2ID8A 4IM7A 1WZUA 1EFPA 4AY5A 1FP4A 4C88A 3AEUB 2YRFA 5I9LA 2XDAA 4IRUB 2ZRMA 5IKOA 3PDUA 2PMBA 1U9ZA 5LWHA 2HREA 2I6QA 2XY4A 1V47A 4M1TA 4S1WA 1D0VA 5IFKA 4MJ3A 1QRDA 3RL6A 4QQFA 2JZNA 1VPTA 2X0DA 3R7FA 3FNQA 4P7JA 1Z34A 4P54A 5DI9A 5P21A 5LYYA 1PNVA 4WXEA 1WD5A 4KSCA 1LBHA 2FPLA 3SQNA 4F21A 1F2VA 1PJ4A 2AOTA 5CFRA 3EWSA 4XQ9A 2I3GA 4CJXA 5J4KA 2JLRA 3D8HA 3T7IA 4ZCMA 1EUDA 3HHPA 5JXJA 5AW0A 4BX3A 2XTIA 3FJOA 3OTIA 2VHZA 3GVCA 1G8JA 2HDHA 2WTUA 4WBNB 5HW0A 1JDBC 5I7SA 5HS6A 3B1WA 1X1SA 5K45A 1YMQA 2ZIFA 4DCJA 4GLJA 4XVQA 2HA7A 3FPEA 3P96A 1WHTB 5T3YA 4ESVA 5IARA 1QDEA 3BZWA 5ENDA 5FOXA 1GSOA 2PFKA 1AKWA 3BE4A 3IEXA 4DXAA 5BSGA 2IHTA 2AFHB 5A9SB 4B32A 3EJWA 1NF8A 1Z47A 4BS9A 1LV8A 3GJTA 1I2CA 2CJWB 3NZEA 4YAUA 3RSQA 5LSAA 1EBBA 3KLOA 1FNDA 3JZMA 2QYOA 3WQBA 5GTDA 4D3SA 1M10A 3L7IA 5A02A 5CT5A 5E95A 2LZ0A 3KO8A 3WRVA 3PWKA 3R3UA 2HTFA 2G4CA 1RSZA 3PX7A 2PQMA 3TJZA 5AT1A 4ZICA 3A4VA 1RS0A 4OMDA 3H2GA 4C2BA 2QYSA 1RKUA 3W78A 3IUYA 1PS0A 1JPJA 4G0WA 3SDBA 2IS6A 3GFSA 5AM1A 3KOXA 1H1LB 2JC3A 1EFHA 5HZHA 2V98A 3L7YA 3VQVA 1G55A 2WIBA 5FWXA 5THXA 5A03A 2V03A 4BEBA 3VYUB 3V7SA 3ZI4A 4MV5A 4F2DA 3KQLA 2GBPA 1JH8A 4F8EA 3FSJX 3N76A 1I5EA 1VGRA 2HPAA 4X61A 1L5SA 4AC9A 5BT8A 1SNYA 3G82C 4WI1A 3ZIHA 4WSOA 4E2FA 4I1YA 3VBEA 1E0JA 2F3RA 1ZUD1 4BNUA 2CNWD 3DAGA 4ND8B 5AHKA 1A9SA 4LOKA 3TQCA 4DW8A 4DLRA 1QYIA 5AJVB 4DNQA 2A33A 4TV9A 4DWWA 2B1GA 5AI4A 4JI2B 3LVJC 4I9FA 3UUGA 3JZAA 4YJ3F 1IL2A 2QRLA 3K9GA 4GGOA 4FEGA 4R8MA 5F35A 3ZWCA 3FOFC 2P9BA 1TMKA 1OJLA 3TH5A 1UZLA 1MCZA 1QRAA 3U5TA 4A8PA 4F4FA 4NMHA 1IB6A 4HBGA 2J3HA 5JFTA 1ZL2A 2HQRA 4RMNA 1Y7IA 2ID4A 4DQKA 3H0KA 1AQYA 2O0LA 5DF1A 1DUSA 3IHWA 1YI0A 2GCOA 1KYTA 5HM6A 4PYOA 3U0BA 2YWEA 3UIEA 3WYNA 4GBGA 2GYUA 2A92A 2PD6A 4B3IA 2EGHA 5EIWA 5I6DA 5M2QA 1KZYC 5GVSA 3E22B 4XU2A 2DZ9A 2NUPB 3HP7A 3PTZA 3TIXB 5K3BA 4NXNB 1IHUA 1X19A 2VYQA 5FWNA 3PSHA 2WPDD 1RLMA 5I7VA 3PJGA 1E4EB 2AR7A 3IJRA 1PR1A 2AUNA 3KZOA 4HR7A 4OOEA 5GV7A 3OOYA 4JI5B 4D41A 3SG0A 4BX8A 5CFMA 2R8RA 3K0AA 4N82A 5EJFA 5KKNB 1ESMA 1R0YA 3BD6A 2Q1SA 3EQ6A 1U8YA 2ROQA 3D8NA 5A5GA 2CE2X 3I1FA 1EAYA 3I7FA 4BIMA 5FP0A 2CFOA 4UD2A 2WIFA 1O6ZA 3GRVA 3PQ8A 4BMPB 3PI7A 1QR6A 2JI9A 3L7DA 3V4SA 1JFVA 1VE1A 2IZ5A 3O4GA 3ESXA 2OENG 5K3CA 4NEGA 1CDDA 1T9GR 3ZV5A 1E0AA 4H18A 1ZM3A 4GDFA 3LUKA 2CHVA 4WA8A 2CL6X 2OD9A 5CUQA 3RNOA 3ROTA 1MW8X 5BNTA 2I2AA 1UJ4A 4FYVA 4AX4A 4QEDA 4NC9A 4GLOA 3K15A 3NCHA 2EOAA 4QOGA 3RJMA 3I4CA 4Q6BA 4XB6B 4RTMA 1EK1A 1HDZA 3SGLA 4QWWA 4QXRA 4C4YA 4EUNA 2Q2QA 2NU8A 1GEEA 1NDUA 2FTKE 4QUDA 3P94A 2MJLA 5EMLA 2C9YA 3UXHA 4JLVA 2WTBA 3T1QA 4DSUA 4N0PA 1PCXA 5DLQC 3FE2A 5EHNA 3DG9A 2QUKA 1R5OA 1Z8HA 2EP7A 1QUFA 2G6TA 3R8FA 3EZ2A 4D9EA 4DGQA 5E0OA 1ZJZA 5B1IA 4HVCA 2ZTHA 3E58A 1II7A 3V5NA 1K8RA 1IBRA 3D7KA 4TL9A 1W4CA 4R2WA 5C5IA 1BIAA 3CKKA 4LXQA 2BAGA 1K8ZB 4RA6B 4RIEA 4X6UA 1NR1A 4EFDA 1XZIA 1KEUA 3BN3A 1YZLA 3GP3A 1GN8A 3HDQA 3OTWA 2ZWVA 4GMXA 1AMUA 2B4KA 4NAVA 3HU2A 1D2RA 1RBZA 1WV0A 3JAWA 3L0OA 3U44B 3IBYA 1CSEE 1IMJA 3F3SA 3VHXB 3O82A 3WYDA 3IP8A 4GSLA 1YVRA 2GESA 3U3ZA 3F49S 2RHDA 1Z5GA 2HT6A 1T5BA 4DQUA 2Q3DA 3COSA 1OB5A 1NDHA 2WLTA 5AVZA 3H19A 3K5IA 4ZQFA 1P91A 1B6SA 5EIBD 4NL4H 1XLVA 4RYDA 3K53A 4DCCA 2X7HA 5AOVA 4HWRA 1T9GS 3ZS9A 1CUYA 2H16A 1T6BY 3L4BC 4BVJA 2W9XA 3E8SA 4UMDA 2PGOA 2ZJ5A 3L6OO 5FLKA 5BQXA 1YGYA 3V9PA 1ZISA 3W06A 5JZMA 4NOLA 5IMBA 1P4JA 4FDMA 5EKXA 5K8IA 1NE2A 2H0RA 1BYUA 2HHJA 4Q4HB 4X93A 4BWFB 3DYBA 2FPGB 1SMKA 3IRUA 2OLKA 4URZR 1NULA 1A69A 2A0KA 2C0PA 4WCDA 1OPXA 3AL0C 4N5HX 1F6DA 2EBWA 1D2GA 2HO4A 4C4TA 6REQB 1DJQA 1MC4A 3R3YA 5CNKA 3MTJA 2WIJA 3TWOA 2BM1A 3CMCO 3ND7A 3VVCA 2JIZD 2P5TB 2HFJA 1UCFA 1EFUA 5DO9A 6PFKA 1A5BB 3BBPA 1RYBA 4KW7A 5CGZA 3RJTA 4ZJZA 3GG2A 1UBRS 4XJXA 5CFLA 1NFHA 2VDQB 5KYUB 4BGEA 1W4ZA 2BGTA 3PXBA 1PVDA 1XRJA 2DECA 1BW9B 1P0PA 1B23P 2BKEA 3ELDA 1TJPB 2CSUA 3HUFA 1UZMA 2QM3A 3ESYA 3COZA 3QKSA 4V0NA 2IPXA 3I37X 3CLUD 4O4LA 1CY7A 4Q02A 3RIEA 3UMGA 1GL7A 3JQBC 2Y93A 2BZ1A 3GJRA 1M5TA 4EJFA 1T4MA 5BURA 3VZSA 3K70C 2OCKA 3CUKA 1OGYA 5EWJB 2JI6A 4E22A 2AMCB 1L4EA 3F9CA 2ZR8A 4QQRA 2XMQA 4LDRA 2DETA 1J8MF 1BA3A 2IBSA 5I4KA 1T91A 3O2SB 4YI3A 4CEHB 4KB5A 3AR2A 1KH2A 4LY0A 3RIHA 4C2AA 2BP7B 1ML4A 5HOQA 3CXUA 4MVCA 1UJCA 3HJCA 1R88A 4HS9A 1W19A 2JGMA 2YHBA 3C43A 4EO9A 4IUYA 3WAKA 4XSHA 2ZK7A 4MCAA 4Q3BA 2WI8A 2IYPA 2HF7A 5CVVA 4CM6A 2X5XA 2C2WA 3BMQB 1NJ6A 3FMPB 1IXRC 2CNOA 2QX6A 2W8BB 1KYYA 4YJFB 5LXTA 2AI3A 2XCLA 3KDPA 4UP7A 1H93A 3IVCA 4FYXA 3QO5A 1PQWA 3Q2OA 3UGKA 2L69A 5KOHB 5ABPA 4KPEC 4QDKA 1R4NA 1SD5A 1WB6A 1NAHA 3FOBA 3IX7A 1Q0ZA 4KX5A 2J4FA 4MW4A 3NC0C 3PU6A 4HEA6 4O0MA 2J30A 5K3OA 5ALPA 1RAAA 2IE0A 4N9QA 4FBWA 2J67A 1Z35A 2PS3A 3OQ6A 5CYOA 1G59A 3CNBA 2CHFA 2NU9B 1U99A 1BS9A 3L6RA 1U2SA 3LBFA 3M6LA 1O9HA 1E24A 3R0JA 2HPHA 1UMCB 1EDOA 1NVTA 2A3RA 4RD2A 3WHLA 4A6PA 2UUOA 1OAKA 2FOLA 1IDOA 2QT9A 1RWMA 3I4LA 4DEXA 4EYEA 4J0EA 2RHTA 2X8JA 3R1IA 2FY8A 1O95D 3WQSB 2JD0A 3KZKA 1CTQA 4C6RA 5IJAA 1II8A 5CA1A 3HSKA 1TQ2A 3EGWA 1YQGA 4G0NA 4MVJM 1XTPA 3E82A 4EUEA 5IT9A 4RTKA 2BV3A 2YASA 1WZ2A 4A4DA 2JRLA 3K6KA 4UZSA 1NQAO 4FDVA 3TR5A 3B82A 4BVGA 1JJIA 5FI5A 4QRHA 2GPTA 2JLQA 4D46A 4C05A 1RXEA 4X8HA 4OOFA 2PRSA 4I4TF 2IUYA 3R75A 3LYUA 4ZVQA 3T3OA 3D4LA 3K0FB 4HFJA 3EOAI 1ZINA 4C0AC 2VHXA 3MT7A 3PE3A 1LKZA 4OQFA 4DDHA 1BHQ1 1QQ7A 2PMKA 4ZO7A 1P0IA 3ZK7A 2QVXX 1W4RA 3D0RA 4UP8A 2I9PA 4N7BA 2PUDA 1JLHA 1JA0A 4DC0A 5KPDA 3N5KA 1ZCFA 3MTAA 4UUAA 3PXGA 2IYRA 4RJ2A 2R85A 1I24A 2GNOA 2X6RA 4PZPA 3GLGA 1E1OA 1KVQA 1LLDA 1G8YA 5DKFA 2YYAA 2JJ1D 1GILA 5KYYA 4F04A 1RRVA 3V7UA 2K4MA 2JHCA 2A5JA 5A0FA 3VYWA 2HUNA 3LZCA 4LVIA 1GPMA 3C5CA 4RS3A 4N3GA 2JJYA 1CEQA 3BD7A 1IZ0A 4QDTA 1GZSA 3FMGA 4MVJI 4CH5A 4EI8A 3HA2A 1XA4A 1TEVA 3GJQA 1UOPA 3KFXA 1CQJB 3ISTA 2MYUA 2ZT7A 5FD8A 3MMSA 4QHYA 3INTA 2ZR7A 2Y0PA 4UREA 2PUBA 3LC2O 4H2WA 4YPFA 4JL5A 3PNMA 4P7BA 2ZT5A 1TLLA 4RCZA 3RS4A 4TMTA 5JH7F 4RZ2A 3QGMA 4KHZA 4GUDA 3EPPA 2ZBUA 1M34E 2V7QD 3EX7C 1KP2A 5JO9A 5FBRB 5LIRA 1UBEA 1C7FA 2JGAA 1TJYA 1OFIA 1R10A 1X80A 1X77A 4OXQA 4N47A 2OBLA 1H5UA 3BSSA 3A2NA 4NULA 3BL6A 4CIVA 5JU6A 2QTMA 3CS3A 2WTNA 1P5JA 3IUEA 3K0CA 4RVFA 4HN4B 3O8CA 3CVUA 2QZ4A 2ZOSA 5C5CA 1NG9A 3G1TA 2QU8A 4NCAA 1FLDA 1XCBA 5I9SA 2Z5FA 3N0XA 1YOVB 4V3CA 1MX3A 4KACA 4C4OA 4D57A 4O4IF 3AY0A 5C4IA 2D1YA 2IY8A 3HCWA 1K08A 2O8FA 3O4IA 3AVQA 3FKSA 3M3HA 1QX4A 2KYRA 1PEYA 4O3FA 4B43A 1TF7A 5ALIA 4F7DA 1VQZA 4WK6A 2JKYA 2BH2A 3D5TA 1KFBB 4NYMR 1D04A 3UWSA 3OWXA 4XYBA 3DOOA 3DO6A 4OA5A 5LB4A 4EY5A 5JJ5A 1X2BA 2C3PA 2XNHA 3EF3A 3GC6A 1GLNA 4JP3A 5EPEA 3UYKA 1OZAA 3ABSB 4O6VA 4YRZA 2O3JA 2VJPA 5J2UA 2NTJA 1BE8A 1CIJA 5BOVA 4EHNA 3WRXC 1YRYE 5BNZA 4LF5B 3VR5H 2ZS7A 2OV3A 2QRZA 1U3GA 2IHZA 4EHAA 1O4WA 4J0GA 2QQ0A 2HMWA 2KPOA 1V8BA 3IJ5A 5F76A 5G0VA 4JYMA 5C7LO 3HO1A 3DH0A 4DDKA 1BDBA 1RWVA 1I6KA 4LYGA 2CMFA 5CMLA 4AZTA 1UMDA 1ML3A 3R7BA 4DARA 3OPQA 4MEJA 4QICA 1XG5A 1O97C 3B3GA 3M5DA 1RJ9A 4RDHA 5E2IA 4DIEA 1W1UA 4WX2B 1QYDA 1SWWA 4E46A 4ZARA 4GWLA 1NR5A 5JADA 3CRW1 5AKYA 3UG7A 1FMCA 3CRZA 1QK4A 4N41A 2R7AA 4KUGA 4N8SA 4UATA 2ODEA 4TRNA 5TPZD 3RODA 4B6PA 4GP9A 5HILA 3GHYA 4I50A 5DASA 4F3RA 1YZGA 4DLBA 1BGXT 1RXYA 3EVNA 1AZWA 3E7DA 3HR8A 3NBMA 1NQWA 4HV4A 2VSYA 3T7EA 2INGX 2WAXA 3OFSA 1W46A 2WTXA 2XTAA 4Z9YA 1TKCA 4Y9UA 2HMAA 2CXUA 1JJ7A 3SLRA 5JYDA 4UNNA 4NH0A 1Y9XA 2R65A 2OO5A 4XGRA 4CR7A 2QROA 1JIJA 5T6MA 3RRYA 4CXMA 4FXPA 1PAUA 1FXSA 3ZY5A 1WMDA 1B1CA 3AKDA 4GKVA 1FFXA 1OYYA 1UPCA 2JAXA 1VHLA 3LMKA 3PT5A 4H08A 3LOUA 1EJBA 2FOXA 5CJJA 3FYUB 3A4NA 3NONA 4GNRA 1L5KA 1E77A 5FBLB 1JB9A 1NVFA 3VSEA 4YAKA 2EW1A 3F4BA 3KP1A 4RKYA 4BNVA 4TMXA 1PWYE 2BYTA 4EJMA 3D7NA 2OLJA 3WGYA 1YWGO 1ODTC 1LDMA 1US8A 1L7MA 2OO5C 4PIVA 4KVFA 4UU7A 3LD9A 2C98A 2FJPA 2HF8A 1QGUA 4PYQA 5CHYA 5BN3B 2BE9A 2ATIA 1BKDR 1TQ4A 5K0TA 2PKEA 3JQEA 3LXMA 5KNLA 3QFHA 1XEZA 1I0IA 5H3HA 2GM3A 3ZJYA 1W8DA 5IYZA 5K2OA 4YT5A 4BUJA 3ROFA 1PZFA 2VNHA 4F4HA 4MP6A 3I2HA 1ULUA 2IPAB 4DDWA 4PTYA 3ECAA 2VA8A 3BCHA 1JTEA 1EGVB 1NI4A 1ST3A 3PV0A 3HR4A 4IEIA 3AETB 4DR1B 3VNVA 5LQCA 1OHHD 3KXDA 1QSGA 5DLEA 4DIBA 4ZZ0A 3RKRA 3CSUA 3VPDA 4X7MA 3WGQA 4HNSA 3UHOA 3AJEA 3IABB 1DAGA 4KDCA 4BC0A 3SSOA 1GKKA 1ONOA 2OFWA 5CHEA 2QIPA 2FI1A 4M1KA 1XZPA 5BQ5A 4AMYA 5JANA 2XIQA 3MWEA 4WN9A 4J6EA 3A3OA 4U02A 3L0DA 3KVOA 1V1JA 2PFGA 1E5DA 2WUEA 3MC1A 3KEMA 3AUJB 4IY1A 3CX4A 4BQIA 4CEJB 4MI6A 4OSEA 1GTL1 2ABWA 2BY4A 1O96B 3ECSA 3RBXA 3MCUA 3SQOA 3AVUA 1HDRA 4LV5B 3S5JA 4DA7A 5LR6A 1HL7A 2LCQA 3JD3A 5HCUA 3MA0A 4Z4IA 2ZXFA 2OQVA 3VZPA 2AEFA 5FQNA 2ORWA 3T3MB 5AM5A 1CUAA 1H6CA 3MF4A 4IMPA 1TUBB 5GPBA 4BO0A 1DIAA 3TSQA 2B3DA 4EF5A 2Y1XA 4XGQA 4YRSA 3CZRA 1YB1A 1L5OA 2AX3A 3I1JA 4GGPA 1XC7A 1DEAA 2WSLA 3QE3A 2JJQA 1O7JA 2HSJA 2EG5A 3EISA 1S01A 1R2QA 5KQRA 1Y80A 1G6OA 2F00A 4D26A 2QR3A 4OYHA 2BFBA 2CCJA 1R8XA 5B6IA 3C6YA 4TZ0A 3PX3A 5BWOA 2P5YA 4UM5A 4X64B 1TTPB 2W70A 2AN3A 3ENKA 1IUPA 2BM8A 2KLHA 1D7OA 1L6RA 2ZJ7A 1ASYA 1A2QA 1JBQA 1ZG3A 2GJ9A 3REXA 5ERXA 1BMFA 3JARA 3WIBA 4E5UA 4YB8A 1XZNA 3HZ7A 3VNQA 1YI1A 3AR7A 3I6QA 1F8GA 1WLSA 4XYMA 3ASUA 3WFJA 1E9FA 1QG4A 3KYIB 4C01A 1U4NA 1G8SA 1U8UA 1NV8A 2FR1A 3ZU5A 4C4PA 4Y1EA 5AI9A 3HYTA 1K89A 3HZRA 3QFCA 4KQ1A 4WGFA 2FRVA 2ZE8A 2A2ZA 2Y0EA 4TS1A 3R9XA 4D81A 5JSZB 4NBTA 3RF7A 3L06A 1T5DX 5LPNA 1QS0B 3CY6A 4K9RA 1TIPA 3GYGA 5E4TA 1E2PA 2HX1A 2MYPA 3RYFA 4C1NA 1QP7A 3IP3A 4Q19A 5FI0B 2NUTB 4G2NA 4DUGD 1UDVA 1CHDA 2XEDA 4QASA 4QM7A 1OZFA 5K3AA 2XUKA 3M6VA 4GPBA 1CNEA 1RKQA 2VZLA 4TSKA 1C7IA 4PRLA 1U0RA 3LWZA 2W2KA 2ZSEA 4OJKA 4DV7B 5FLYA 2R8ZA 4OVKA 1QKJA 1GSAA 4ZC1A 4CODB 2V6JA 1E79D 2WB2A 3KL4A 1AX9A 1UBNA 3OQIA 1U2DA 1T8WA 3QVGA 2WHPA 1MBZA 1YMVA 4GX5A 4UNPA 2J6IA 5AJUA 4IIJF 5ALKA 5E6SA 3ZQKA 3DEHA 3F9IA 4FN4A 4ETNA 3OQHA 3VPCA 3T5TA 2B4YA 3PF9A 1MGPA 3HADA 3ABZA 4A27A 4Z4HA 2POCA 1GCIA 1E3IA 2I7TA 1YB4A 4M0DA 1TW3A 1L5QA 3KEFA 5KNBA 2P6NA 3H04A 4OBXA 4QU5A 5FOWA 3B52X 2PYZA 1RHUA 5HKOA 5FUVA 3ZJVA 1SU7A 3AR4A 1T24A 2HH9A 3OOSA 3SKXA 4C04A 3RKWA 2H07A 4FBGA 3AXSA 4L4ZA 1X70A 4BMDA 2FP4A 4YECA 5JCOA 2QVBA 3ZWAA 1U7ZA 2ODQA 3C1OA 3NBKA 3GUYA 3JQ9A 3WWDA 3D6UA 2ID7A 3QMPA 3UH1A 5EQTA 3PXEA 4F8YA 2A0WA 2J3MA 3RD5A 1NXVA 4BYGA 2H00A 2I4TA 2OGZA 2VK4A 4Z4CA 1X3SA 4PHTA 4QARA 4O2BF 2PR2A 1VBMA 3EIWA 4MRSA 3UMCA 3VKVA 4OMCA 4EA9A 3ZHVA 3LX5A 4KQWA 1D4ZA 1G1AA 4FGSA 4JWKA 2AXPA 1TZKA 1EVQA 5CA0A 3P9PA 3HDVA 4EG5A 1TC2A 1EQAA 2IDJA 5ECYA 2ZIXA 2XZDA 4UVGA 4CQNA 2Z83A 1OA1A 5E2BA 3QPUA 5JCOC 1QH0A 1O8BA 1UH5A 3JWJA 1R6VA 2HJSA 1EDEA 3JPYA 1YA8A 3NTXA 3REQB 1NI3A 1FP7A 1IEVA 1TECE 1XK7A 4S04A 2XI4A 3F67A 4Q0MA 4ZQEA 2QW1A 4B4DA 1NQXA 4JUBA 2OQRA 1PLJA 2B5VA 4L78A 2BSQA 1KAEA 5LZ8A 1N33B 2PJRA 3EJ6A 3I1YA 3VAAA 3MBIA 4OQEA 4UTVA 2CLIB 4ZO9A 3O0TA 1C30B 3AF2A 1CXZA 3RHSA 1KQPA 1H4SA 4XTCS 4XIGS 3CKMA 1DCFA 5DMXA 2QI9C 3P9IA 1ABEA 3T35A 4UOEA 3TTUA 4AXXA 1FUEA 5IVPA 4F4UA 2ZUCA 2WTMA 4OXYA 2F67A 3CNEA 1NJ1A 2ZR0A 3D4PA 2R8PA 4IFIA 3LVQE 2AF4C 2AEMA 2VUHB 3A06A 1NBMA 3ZXSA 1X0XA 4G23A 2IOQA 1J6UA 2BKYX 2J5KA 2QK4A 2IDKA 4E08A 1N8NA 2FGJA 2XGMA 5LBTA 5C7OO 5BR4A 4I8IA 1QB8A 5JD3A 2I33A 5I7OA 4YMSA 4LZZA 4ZGBA 1JKXA 4WE3A 1FNMA 1ZNZA 4HWOA 5A4FS 3K0SA 2A7XA 2PTGA 3AH8A 1D5WA 3EHDA 4HLNA 4AQYB 3WKCA 3MWDB 3DVRX 5C18A 4RPGA 1UJBA 2IDMA 4G0MA 3E8MA 3G0BA 4R9VA 1KJJA 3NBZC 1TCCA 2Q28A 2QN8A 4JSRA 2H7VA 2FLWA 2UVPB 4C07A 4AAYA 2WB4A 1WMAA 4HVZA 5EG5A 3ZWBA 3V4RA 1JEEA 3FSGA 4MUMA 5HRUA 1WB4A 1EJ0A 5J2TB 2GN6A 4LYHA 2Q1XA 3P4XA 2X3UA 3L5OA 3QPBA 4FDLA 3A1WA 4H4CA 3SZGA 1RDFA 4ZDKA 3R5KA 5ALEA 3OFKA 3AHIA 2WYHA 3N0TA 3TM5A 5KREA 2P9QA 1XU4A 5A3RA 1B7YA 1M83A 3OZIA 1WS6A 4ITUA 4UNIA 4RFSA 3D2LA 2WE7A 1VFNA 5BSUA 2GEUA 1SESA 1S8FA 11ASA 1CUVA 4FGLA 4FIDA 1OXMA 2PEYA 1MA0A 1EVZA 2BHRA 1N9ZA 2ZPAA 2ZM6B 3EPHA 1T9DA 2BFCA 5EL0A 4IZHA 1JR6A 1QV9A 1VRWA 4W9NA 5AW2A 4Z99A 2ENUA 3N2KA 2J6BA 2JLVA 1QU3A 2GA8A 4KK3A 4AG6A 4IXTA 4Q5IA 4MVJG 4WXMA 1F48A 5D7NA 1WETA 5K0ZA 1YJQA 2ZINA 3C3WA 1HYQA 4JU8A 3O3NB 2KMLA 2O0HA 5BYKA 3PRHA 1HZZA 2A9PA 4LQ4A 4Q1EA 4CF7A 1ULBA 4JFAA 2IF0A 1FFCA 4HLUA 3CPSA 2XE8A 3O7WA 2AYXA 2J0UA 2LW7A 2PH1A 4PG6A 4EG4A 6GPBA 5FV4A 1JILA 2I6GA 3BRWA 1SOMA 4U7TB 3OF2A 1CULC 1ZESA 4TLLB 1ZK1A 2V1XA 4W9NC 4H4DA 3QFSA 4I3HA 4DDTA 1DGQA 1SIBE 3EQ2A 1YS2X 1BCSA 2QQ5A 4BNJA 5BSFA 2M98A 2PEZA 1LGYA 2QY9A 4GP6A 3FUTA 3G0CA 5HIKA 4GU5A 4KN6A 5FUQA 2NG1A 2BFEB 3H75A 3Q2IA 3QIAA 4YRDA 4XWYA 2PUEA 2XRZA 3X2EA 4OLFA 1FLAA 3LPLA 3DZJA 1GXSB 3TTTA 3D1JA 5K20A 4H02A 4UVHA 4TTTS 1R1DA 2Q3HA 3TG2A 1PNTA 1XEXB 3I3OA 4NAHA 4JC8A 1XD2B 1DXHA 4BEWA 1P9WA 3DSRA 3NHAA 2AN1A 4HSEA 3JAMA 1P6QA 2VDRB 4X1YA 5DWDA 4YWHA 3JWHA 3HVJA 5ICFA 1ZJ4A 3BHMA 1PTJC 3ZH2A 1GRVA 4XI9A 1CY1A 3OZTA 2CLMB 1XLTC 1UKEA 1Q15A 4D42A 1IIBA 4GEKA 7AT1A 1SBCA 4KPUA 5SYMA 1CZHA 2FPIB 3GY0A 3NP7A 1AQIA 1EQUA 1QHYA 2EWWA 2NZJA 2YNMA 3NHBA 5CK4A 5EZ5A 3ZGYA 3NV9A 1ZYUA 2JFUA 4R01A 1Y1QA 3NWEA 5C1DA 3AJDA 2D5IA 3F5SA 3IR5A 1MTZA 1IRXA 4B76A 4QM6A 3N7AA 5AVXA 4PXAA 2DX7A 1E62A 1HQCA 2WU3A 4HMQA 1VJ1A 2XNSA 3H2ZA 3R7LA 3L1IA 1YV9A 1SIOA 2EHDA 3QK7A 2XB9A 5EINA 2HMVA 4P3XA 1Z36A 1P18A 1P9OA 4Z8YA 2PVCA 3EG5A 5IBQA 3V32A 1F4VA 3KPWA 4N03A 5I45A 2UXBB 1QV6A 3AR9A 5HJ2A 5FUMA 2QN6A 2VKTA 4K9PA 1CY0A 1UZAA 4XCVA 2D7DA 4UPEA 4LQLA 1H2AS 3NIDB 3LKZA 3DOEA 3NUQA 3N0WA 5ERGB 2JHGA 3LX6A 3EMDA 4IH4A 4URWR 3PLRA 2QHTA 1FDWA 1TYCA 2JG3A 2BGJA 4RPCA 1LPNA 2VR1A 4MMXB 2VP4A 2HDOA 4Q3KA 4DB4A 5E1OA 4DIUA 4D8TA 1NHGA 2GPWA 5HF9A 2HSEA 3PQ6A 2SKEA 1RACA 2AIRA 2HWWA 3H5RA 2XUHA 4LXHA 2JZCA 2XOEA 5CVUA 4DEYA 2Q5IA 2RG7A 3UGTA 1JSLA 1P3DA 4KWEA 2ETXA 3I2YX 2X2OA 4FYIA 3EG9B 4RSHA 1YTLA 1WB9A 1PK9A 2IYEA 1XDDA 1ZX1A 1HUQA 3PTLA 1QYWA 1KJYA 1SH7A 3JRXA 1FW8A 1YDMA 2EATA 3GT7A 2G88A 2ZDQA 2GZSA 4L5AA 4IDAA 1ANKA 3SZMA 3WSWA 2LBPA 4HPWA 3GU3A 2BEUB 2FSUA 1SKQA 1C3EA 3KM0A 3QPCA 3QVUA 3GVIA 4L95C 4N4AA 3K35A 4BRUA 5J47A 1GAXA 4XTUA 1FVXA 3OO0A 3MCWA 1FFHA 5LMUB 2BDEA 5DGTA 3V8MA 2XR1A 3EOZA 4OLAA 2QG6A 2ZKLA 3TNYA 3WLQA 3FHOA 1U3FA 1ADJA 1OLSB 2BM0A 3N28A 4L76A 1TK3A 5C8YB 5FOQA 1WXWA 1CEEA 2VQDA 1SQFA 2AJBA 5CEEA 2O5EA 3DFUA 1WDWB 2FVYA 4BDSA 4D43A 2N0SA 1J0EA 3HVUA 3M4JA 2HWKA 3WZ2A 2L17A 3VU9A 2Q3EA 4RULA 5AHXA 1NW7A 3TLAA 2BLNA 4MQ6A 3MWLA 4Z9BA 2CN1A 4CM5A 5CAEB 3N58A 3RREA 2DQ3A 3AIKA 3KOYA 4DG5A 2B37A 5HGQA 2IYZA 3I6BA 2BFNA 3LFHA 3H4VA 2DXIA 1J56A 1FA9A 3LGAA 1J2UA 3AQ4A 3RK4A 2IPOA 2CDBA 1E2IA 2YJNA 1VZ2A 1L3CA 3VYVA 3BX1A 3S2GA 4X20A 2Z2XA 2I76A 2I4IA 5KNCA 4BFYA 1YFKA 2IXDA 2X6TA 3CLTD 1CZUA 3KKPA 4ONEA 4OKNA 3UN1A 3UT5B 4Y8VA 4JJ7A 2VJCA 1DJPA 3Q3JB 1RJFA 3U81A 2G1UA 1GRCA 2AMYA 5HR5A 2F8MA 2GILA 3LCUA 2DQSA 3RGLA 3KZNA 5G40A 1U0TA 3WIVA 3EQ9A 4MV1A 3VDMA 2P4SA 2QAGB 3UMMA 5FOUA 2Y05A 1NH9A 3CURA 4NZMA 1UBSB 4FSHA 4IOMA 4Y2JA 4BBJA 3H5LA 1FBTA 1RPJA 4XZ3A 2PWYA 4HNUA 4N5NA 1HNZB 1XTZA 1RJDA 3AEQA 4C7OB 1RLTA 1CR0A 1NY6A 5FPYA 4MRVA 3DBRA 4DS3A 5JRZA 4F72A 4K87A 1FNNA 1V8ZA 1ABFA 4JT4A 4OHRA 4U2GA 1KI9A 3RWBA 1IJEA 4PO3X 3H11A 4O3MA 2DY1A 4Y2PA 4P7KA 4MA0A 2AFIB 2DTXA 2NNLD 3E7WA 5FBWB 4PC3A 4GL2A 3MIIA 4GGMX 1Z0DA 1L7QA 2CLFB 3GIDA 5DNVA 2A9JA 2XZOA 3LNTA 1GJRA 1FU7A 2Y76A 3QU2A 5F12A 3UMFA 1HEIA 2BFMA 2E10A 2QVGA 3PC6A 2XZTA 5EIFA 4YCWA 4B6QA 1Q16A 3HY1A 1IWPB 1QK5A 1VA4A 4TL7A 1JJVA 1VI5A 3KR9A 4YUYA 3I76A 3SFTA 1G4HA 1QQ5A 4X41A 3SIPA 4WW0A 3IQEA 4UM9D 1UM8A 1E2MA 2CNKA 3ELYA 4HQNA 5F1OA 2Z5LA 3ZWDA 3HJHA 1F2DA 5CT4A 4IYJA 4BTEA 1SRYA 1X9IA 4Y98A 4QTYA 3DKPA 2YJTD 2RC6A 2GPAA 2W00A 3ENQA 4R3NA 5DNDA 3UCEA 3I62A 1ENOA 1KZHA 4HOYA 1L4BA 3OY2A 5COQA 1DDOA 1ZVVA 4JQYA 1PUJA 1T2UA 4WRRA 2XMSA 3VKWA 4BO6A 3GDWA 4TKUA 1PFGA 1KPIA 2I22A 1UWKA 3PEWA 3HC7A 1EP3B 3FNBA 3OP1A 2RGXA 3DTVD 2O8BB 2JD1A 3VR0A 3CW8X 4ZZ3A 3UA4A 4K9MA 3WGUA 2GD2A 2X0FA 1VDMA 3DUWA 3FPBA 4RK0A 1Y6GA 2XB4A 4JZYA 2JFZA 4MV7A 1PG5A 2PZGA 4P08A 1BS1A 3AV3A 4Z1MD 2GD0A 3EIOA 2I0FA 3PTAA 1NF3A 3LAWA 3LZDA 3DNFA 3OM8A 3TB4A 3ZKWA 1KO5A 4BLPA 2XT0A 1E99A 3PCXA 3UUWA 4UBOA 1JE3A 4RJLA 4I4IA 1PP4A 2NP7A 1MAAA 1UUFA 1U9IC 3QBTA 1BVHA 3WI7A 1Z2DA 3TNFA 2PGJA 3GOHA 3QVSA 1JU9A 5I5GA 1E0KA 2ZT6A 1K4MA 3C3CA 4FD2A 1DTWA 4N5DA 2R4QA 2X23A 3QNWA 1O1YA 1W0KD 2WWGA 2DQZA 4WGGA 1ODIA 1M8FA 5L40A 1PFUA 2H7CA 3MTIA 1E61A 1B0ZA 2ZDGA 1X15A 2JGIA 3CF6R 3GMIA 1U3TA 1J4AA 3CZMA 4REQB 3GFQA 1WA5A 4KXQA 4CM1A 2H1OA 3NRBA 1IPHA 2ZEJA 4RZSA 1WW3A 3N59A 1KZGB 2X8AA 4QTTB 3NHRA 4G97A 3WLHA 4O2DA 1E3JA 3WP0A 2R0QC 3PDJA 2GCEA 3CBQA 4S1TA 3JATB 3MTBA 4DKXA 4F5ZA 3NT2A 3STWA 1EAMA 1H8HD 1YMUA 4M7RA 1GYPA 2R6ZA 1E6WA 4NVRA 4I19A 3DLBA 2NADA 2OBYA 4UXHA 2JLXA 3WMFA 2OCLA 2FUNB 3DEZA 3VTKA 2BCJQ 2EGGA 1IE3A 3ESQA 3I9JA 3MJDA 3MD0A 3RH0A 3S0JA 1K6MA 4BFTA 3KAQA 1RQ2A 4WXYB 2IH5A 5EQJB 4RELA 5K6AC 1KJWA 3DZGA 3REGA 2VVTA 4JT8A 4CCAA 5DX1A 1C0PA 3H2JA 4RC9A 3G8AA 2RD2A 1NLFA 3J7AC 2L2QA 3N39C 3RC1A 4D4KA 1QVRA 3CJTA 4NMMA 1UBTS 1JHUA 4NQZA 4B34A 4D02A 5BR8B 5BQPA 4UTXA 1R5JA 4GW3A 5CIWA 3M4QA 1DEXA 2I87A 3SNHA 3C6MA 4EOGA 1F5SA 1M6WA 1ZCZA 2CK3D 3ES9A 4UHCA 4JX9A 4UZFA 4OL9A 5E4JA 4CYMA 2B34A 3BWBA 1Y9DA 5KNNA 4U1RA 4WLUA 4QXOA 3OLVA 3M82A 2CYAA 4RESA 4YJGA 1TF5A 2J5BA 3T5MA 1FP2A 1DAIA 2UXCB 1GAWA 3R0ZA 5AVYA 1ZM4A 3P2KA 1OIWA 1AKRA 2YOGA 2Z1DA 4KE8A 4NE9A 5K99A 1TQHA 5JIBA 3ICAA 3B60A 3JAKA 1VPVA 4OTZA 4JSYA 4R2KA 1A9XA 3KOOA 1G20A 2BMVA 3ZWNA 5ECDA 3DF7A 3P5BA 1CG6A 3ANXA 4QXPA 1KI6A 5B3JC 3G8YA 2GHQA 3SQXA 3TLEA 1U0SY 1YRWA 2RAVA 3V46A 2QUHA 4KLNA 1VYVA 2GDJA 3BL8A 4F3YA 1ZZEA 3NGMA 3OA0A 3WTBA 4A10A 2I6XA 3RC9A 2PXCA 4R2HA 2YH2A 3H7AA 3PE4A 3VQXA 4NP6A 3LJKA 2DJZA 4RLSA 4H6WA 1ISJA 4MPRA 3GZNA 2A57A 2YBDA 1KI8A 1CF2O 3Q3IA 2DUJA 3KQTA 5CB8A 4G01B 4LSGA 5A6VA 4B6JA 4BFCA 1FSZA 2HDWA 2M2IA 4AIRA 4Y30A 5T4EA 3C0KA 4JOQA 4BZWA 4CM8A 1O6CA 3AG6A 3QYAA 1A7UA 4LBWA 2WM8A 3NM4A 4LK2A 4BRZA 4H0FA 3VVMA 1DWPA 1G7SA 3QPDA 1CZOA 2C4KA 2YCBA 4HDSB 4M6WB 3VPHA 5HKKD 3Q3VA 1IY1A 4IIBA 1S2IA 4R83A 4WACA 4ZU1X 3OEEA 1L7AA 1A9ZA 2JHAA 3DV0A 5LVAA 1PS9A 2VUSA 3PB3A 4WK0B 5TR9A 1SOAA 2FFAA 4KMRA 3WHPA 2GRAA 3GDFA 4OUKX 3RKSA 4ZEMA 2FJ0A 3KJEA 1VQ1A 1JX6A 2VAMA 4QL3A 5ESDA 3EULA 3VSCA 4XTZA 3C3MA 1QH8A 3ZD7A 5TGTA 1GR1A 2PKQO 1T0UA 2PBLA 1L8QA 2R1ZA 1G17A 5TC4A 4C4XA 2NU7B 1REQB 3FOWA 4D7AA 3ADCA 1RFGE 1WM1A 3RVBA 1HEUA 4OXXA 2WWVD 4KQFA 1JR4A 2RJNA 1Z6PA 4YMUA 1BGVA 2IEIA 1EWQA 4JUFA 3DMYA 2JB9A 2QTBA 2IXEA 4WCFB 4ZU6X 3DMFA 5FUYA 1QRUA 1LI5A 4GPTA 1YB6A 3SZOA 4BDTA 3DE4X 4ML3A 2BMEA 1XNRB 2MSDB 1NL3A 3I2JA 1U1GA 1NVVQ 3IO3A 5IKEA 1SULA 1L4HA 3DB2A 1SHTX 5KTNA 4OH1A 4J3NA 3PWSA 3HSYA 1GDTA 3PDCA 4HDKA 1U90A 1ONBA 2JGKA 4PS0A 1QKKA 3WFZA 3ERCA 1A9YA 2HF2A 2ZBVA 4BRWA 4F6RB 5BQFA 3OD1A 3I73A 4CM9D 4KR6A 1UAAA 4LHVA 2XKJE 3F3YA 5IBPA 1KEEB 1V26A 2EQBA 3CLRD 4U2DA 2V6MA 3TL6A 3NNNA 2VTBA 4RKRA 3NVMB 1H9CA 3VNBA 3IODA 2HKIA 4EGSA 4Y2UA 2EP8A 1K86A 3NEJA 1G19A 2O2SA 3P9YA 1N2CE 1T4GA 3DP9A 5IAKA 1OAOC 1W5TA 2I1QA 5A6SB 3TYXA 3ZU3A 2YXEA 5LNK6 5CA1F 1H8EA 4RTJA 3GMSA 3EGEA 4NICA 3SF8A 2VAPA 2J3EA 3NDPA 3SBXA 3ZCUA 1IN7A 3CRVA 4V0RA 2DHRA 1UJ6A 4FYKA 2ZUVA 4MKIA 4JYZA 3RUFA 3H99A 2GEFA 2F2TA 1M8PA 1UK7A 1T6ZA 4P92A 3GAMA 4GYKA 3FDJA 4H2XA 4PLWA 1UPAA 2O20A 3P2IA 1AKQA 2IL1A 1H6AA 1P4AA 3NO4A 2PLRA 3OIUA 3IILA 1BIFA 4NE2A 3KLBA 3QWBA 4F85A 3TTVA 5L45A 1RZRA 2C1XA 2P6RA 3MMZA 3N2IA 2ICAA 4V1CA 2IXGA 4YV1A 4R8LA 3VTHA 3IAXA 1NRJB 2R1VA 3G85A 3NH6A 1EXMA 2R84A 1ZVQA 3C3KA 4HGZA 4KNWA 1Y4UA 3A1TA 3KSRA 5CM9C 4TUYF 5JXHA 1G2IA 1IHXA 1SQ0A 4G09A 1XZFA 2QY6A 3I2GA 3JQQA 1G2PA 3V8BA 2PAFA 3UFBA 2VNSA 4XE5A 1B0AA 4M1MA 4QBTA 1L0WA 4WDRA 5ED0A 4QGSA 3ND5A 2PZMA 3U19A 1TCUA 3EZ9A 4CQMD 3VGPA 3PEYA 1N7HA 3KKOA 5CT8A 4QREA 4U5XA 5EQFA 2WAOA 3SXUA 2AUTA 3GVXA 4QPNA 3RS3A 1RCTE 3RUAA 1Z56C 3PNQA 4O5AA 2G5CA 1RE1A 2XQFA 4HAOA 5FNVA 2VF2A 4RY2A 4G8CA 4CKCB 3MJEA 5LZ9A 1TO1E 2DGDA 3WISA 3NDRA 1RLOA 3O91A 4J6FA 2ZBGA 3VZRA 2FZ5A 3FIUA 3G2QA 4FP9A 1MQSA 2A14A 1QIKA 2GZ1A 4MS3A 3WMXA 2DWQA 4E32A 5B7GA 4JBHA 2K87A 1B0PA 3AHDA 3RF6A 1NT4A 3MOSA 2A4KA 3F4LA 1M1UA 3SNKA 2D1RA 1WJGA 2RMKA 2ZIWB 4DSNA 3S4YA 4I1OA 1U1CA 2R62A 4QPCA 1CUIA 1B7GO 4MQUA 5FKJA 1J9EA 1CUDA 4PXSA 1GA6A 4UDNA 4QDJA 4XRRA 3TZCA 4EW3A 1BEUB 1VHTA 1I7QB 1EM6A 3W1WA 1KGDA 3MK31 4M83A 4TZKA 1SUEA 4QUHA 4KI0A 4Y6OA 3TZBA 1HTTA 4CKWB 5ITZA 1QVAA 3I6YA 4NATA 1TZBA 2P2GA 5HMLA 3B8HA 2R1TB 1IHPA 1BN7A 5IDQA 1EA7A 1T0IA 1DAMA 3EH1A 4L87A 1P3JA 3WK6A 5JBQA 3CMMA 1XVVA 2G6BA 3V1UA 3ZHTA 4CLOB 3HABA 1J5WA 1JZQA 3M0EA 4A5OA 2J9FA 5IMSA 3EUFA 1I4OA 1WXQA 5J5AA 4LYYA 3EWNA 3DCNA 1RT9A 1I7LA 2RGDA 1T9BA 4QYIA 1R3UA 1JKFA 2ACVA 2F48A 4J1TA 1LLCA 4MWBA 1RIIA 1F0NA 1ZIYA 3OZXA 2C9CA 2XMZA 3U4QB 4LJRA 3D2CA 5LD2B 1IXSB 1YQXA 1M1YA 2MSEB 2R8OA 4C0SA 1Y5RA 5K1XA 3IRVA 4EATA 4B44A 2F1JA 4OFZA 1N9WA 3WDKA 2VPZA 4PZLA 1E5LA 1NBAA 4C3ZA 2HNAA 4WJLA 4DJAA 4X62B 1FMFA 3EEIA 1N0IA 3QELB 3RPEA 3RIYA 5TLSA 4V0MA 1NXQA 1P62B 3BULA 5T4BA 5EWLA 4UULA 1OF1A 4UMVA 4Z6KA 5ICMA 3OIGA 3L4KA 1FJGB 5B30A 5AKKA 5DULA 3MWJA 1HE5A 4WNAA 4IWNA 4IS2A 4IICA 4R7TA 5JQGB 2QN1A 5EFOA 1V96A 2XRMA 4A2QA 1FTWA 3H86A 5FO1A 3R7WB 1T9ZA 4RIGA 1GPWB 2GHIA 3BRQA 2X1MA 5FPQA 5DHQA 4LVLA 2GDZA 4DRYA 4ETIA 4JKYA 1K98A 1UEIA 4Y0NA 2JFQA 3L93A 2G5GX 2X8WA 3G3EA 4P80A 1OTXA 2Z8XA 3MPOA 3QHAA 3GZJA 4XASA 2C3MA 2W58A 1OBFO 1Z6QA 2ZTSA 3JCZA 3MB8A 4DMUB 2P2ZA 1VYTA 2BEWA 5FJJA 5B37A 3PF8A 4TM8A 2O54A 3HFZA 1KPHA 3O8QA 3LWBA 2LIVA 1ZN2A 1W2HA 1OXBB 2FW9A 3HO6A 2W93A 2DT5A 5DBGA 2PA3A 1JUDA 2UAGA 3O3MB 1B8NA 3OBIA 1XDSA 2QVCA 2VNAA 2OHOA 3U0VA 6NULA 3ZE1B 3ZZMA 2K2QB 3OPYI 5K4GA 4FR0A 3N8DA 5J9FA 3ZCVA 4D0NA 1UBMS 2FG6C 4DCTA 2P9GA 3EVGA 1SHUX 1ZD9A 4DE5A 2XVYA 2BOVA 2C4MA 3NHWA 5IU6A 1CRQA 5GP1A 1FDTA 1RBYA 1MOSA 3HFSA 3WLNA 2A0YA 4NOJA 4XPIA 1JKJB 3K1AA 4FNOA 1FSSA 2GAIA 3HBMA 5KYGA 4PFJA 1Z75A 4BE7B 1ZXBA 3EXEA 2W6ID 1CY2A 3BAZA 1FOEB 1V16B 3VUEA 1Q0HA 1XVUA 3BA6A 4P75C 5G4KB 2IXFA 4AZ0A 3ZD6A 2I2WA 4C3VA 3E3AA 5EJ2A 4YAGA 3KYDA 3T3HA 3V3KA 2B2XA 1T34A 1FTSA 3W34A 4BGVA 1RKXA 4ZDJA 3LTEA 1K92A 3DFKA 5DTJA 4K0KB 5AUOB 1WXEA 1O58A 4IHAA 4MIEA 1J5XA 1P45A 1NBHA 1PWZA 2CD7A 2J9ZB 3EC1A 3GBVA 3L9XA 2PGXA 3JASA 3QEMB 5WRFA 3ZW9A 5JSHA 2DR0A 3VBBA 3EDRA 3IQHX 2MYTA 1Q7CA 2VHYA 3RVSA 1Q22A 1H3FA 4EW6A 1N2XA 3V8JA 1J99A 5TF0A 3GLHB 1Y3CE 5D85A 4FUTA 1UDWA 2H5IA 2EWMA 4N8DA 1SXJA 2FDCA 1G98A 3M4PA 3G8BA 3KTAB 3B36A 4U4AA 5DH9A 1TUGA 3U61B 3GK3A 3IDZA 4C0LA 1S89A 3WX0A 3PFCA 3CPHA 1P4RA 5D1HA 1PL7A 3S29A 1T8YA 1A27A 1E7SA 5F7JA 3WLSA 1RC1A 3KPYA 4NDNE 1WQ4A 4UAGA 3ZV3A 2V0GA 3L7CA 5TGDA 1FUYB 4OCZA 4FCTA 4A3SA 2QTZA 3MMXA 4A1OA 1CR6A 4GXRA 5EJ8A 5TQ0B 2JLUA 2IY9A 4WFIA 1AUPA 3VKUA 4O25A 3ZZ1A 3S8YA 1AOXA 1YCFA 2ANCA 4M1OA 5IM4F 1U5AA 3H87A 5A4AA 1YF3A 4IGIA 5G4LA 2QRJA 1D6MA 3MGGA 4BVAA 4BE4A 1SXJC 2DUUA 3BIFA 2E87A 4YJ2B 4MTCA 4FWIB 4XTWA 2NUAA 4E1VA 2A94A 1V7ZA 3PUVA 1ZI9A 1DCTA 3U49A 3U1TA 2C5AA 2BC9A 2P6PA 4LQCA 4C7VA 4CPDA 2M6LA 1Z4JA 2BFFA 2OORA 3DM9B 1FX1A 1KETA 1LJ8A 3G5MA 3IAAA 3IGFA 3N74A 4GVPA 5KYKA 3DFIA 2BGWA 2NT3A 1GZ7A 1LBEA 1U31A 3AVYA 4IH9A 1AS3A 5LJLA 5FFFA 3CZ5A 4O8ZA 4PLZA 1OVGA 3KU1A 4RACA 1RE0A 3LQQA 3NBXX 1Z5NA 1N1MA 3W77A 5ICEA 3NVKI 2WAMA 3LY5A 1JE1A 1W73A 2FZWA 2I67A 2WUFA 1LK7A 2XYPA 4PHFA 1PJLA 4ARUA 5KSOA 2AF3C 1YL7A 2AJTA 3EZ6A 3WB0A 1EK5A 2I2BA 3QKUA 4LG1A 1EFRA 2YVKA 5J63A 4ARAA 2CXQA 2OORC 3PUYA 3PR3A 1U0NA 3FCXA 4MW5A 4DTCA 4NBSA 2C7RA 2JI4A 4IGFA 5D3ZA 5SZHB 1L7EA 5KOJB 1Z5PA 3CVYA 1K7CA 3FN4A 3WWOA 2XE7A 4R16A 1JDUA 2JIPA 1WUKS 2HD4A 4MW7A 3KQSA 2OZLB 2VXBA 2FK8A 3SE7A 3HFJA 2PNFA 2Y1WA 3HDTA 1SU8A 4G6ZA 3S2YA 4CU5A 4JQSA 1UDAA 2IU4A 3W5VA 1YASA 2BRUA 3Q87B 3OX4A 4XM1A 3TDNA 2AOUA 3WRYA 3UVEA 3KQOA 3DBHA 4W5QA 3NENA 4CFSA 4URXR 2IYLD 3VHLB 5KQMA 2BGMA 3QVOA 1GQRA 2NSHA 4QECA 5GQSA 4ZV9A 3OBBA 3GZTB 4XR9A 1QP0A 1YZUA 2A86A 5IS2A 3CH7A 12ASA 1LC3A 1NQOA 5L4LA 1BWQA 1DOHA 5KQGA 2Q9CA 4HB4A 4GEGA 4OM7A 2DCMA 5ADVA 1KC1A 4PX3A 3TBKA 2YQ4A 1YRAA 2OMKA 4ZVMA 1A0OA 3S68A 3HB0A 2QT0A 4DZZA 3DEFA 2AD5A 2VT2A 3SEFA 1LC0A 1GTSA 2BRUC 3ECCA 4LYJA 5CURA 1LFDB 1ES9A 1YK1A 2WOJA 2X4DA 4NWIA 2E4YA 4PAGA 2AOVA 3WRYC 1C1YA 2F1RA 4H0CA 4O2AB 4G25A 1XXHE 2Y1KA 2EL9A 3K1JA 3P52A 3RE1A 1OFUA 5K8TA 3UHAA 3AZOA 4ITVA 2O50A 5A4IS 1SCDA 1E7RA 2ZCJA 4GZ3A 4B3BA 3RYHA 2HW8A 4AL4A 1DQYA 2JANA 2XWBF 4Q7MB 3VI4B 3ZE0B 1EUYA 3IR6A 1C4WA 3PRKE 3UO8B 3IAS1 3W2TA 1RP1A 1Z5VA 2CUKA 2P2CA 3P7MA 4C7BA 2G80A 3OE5A 4O59O 3C6QA 3DWEX 5BV0A 4RENA 1V71A 3RWOA 3HL0A 4YLEA 5BRNA 1L1QA 2VQFB 1KA9H 3WWYA 3PBKA 2AC4A 1X1DA 3IDFA 5EP3A 4C03A 3FDFA 4IPTA 5CA0F 4CV3A 4FYJA 2VHVA 2LUOA 3ZJ5A 4CG1A 3U39A 2VYNA 2OD2A 5DNCA 4BBPA 5FI3A 2X0IA 1EA5A 3G9ZA 1B2LA 3BZUA 5IVDA 2IGBA 3QXHA 3BREA 3VR2A 1V7QA 2G07A 1JQLB 4F9GA 3OPVA 1NMXA 4PGAA 1YA6A 1LNZA 1MQ8B 2GARA 1HPLA 2V0NA 2YDYA 3UNXA 3G0HA 4GR5A 1AXEA 4WPGA 4F93B 1MFPA 2E6UX 3TE6A 1KMHB 2IEYA 4DSTA 5BNFA 2VBGA 4PSUA 4R54A 4JJGA 4BNXA 4HVLA 3TSPA 3K9BA 5JDIA 5KJFA 1V3TA 1W5EA 2R66A 1WE2A 1NOIA 1IUKA 4MRAA 2HIAA 1SKYB 3L04A 2UYQA 2JJ2D 3K1ZA 4U9UA 4AMGA 1LSOA 3SVLA 4B2IA 3RADC 2QZPA 4HDOB 1LH0A 2K7ZA 2ZUTA 4F1JA 3QI2A 4TQFA 2DR3A 3GG9A 2BBTA 1ZD1A 5D3QA 1JAZA 4YRQA 4IVQA 5JXIA 2Y1FA 3R76A 1G5PA 4Y6QA 2R86A 2X13A 3WBJA 3B7GA 4B75A 3BTSA 3CZPA 5LOVF 1Y9EA 3QE4A 5AOAA 2O14A 3UPTA 3QLTA 4TQUS 4EUSA 2DQKA 5FWDA 3G2JA 3WS7A 1GKIA 3SOPA 3WRWA 2W2LA 4X3CA 4RXTA 4BFZA 4RE5A 4HDRA 4QJ3A 2HRQA 2IHKA 1ORRA 2EDCA 5KCZA 1NY5A 1SUPA 2C9OA 2OP1A 2XNCA 2Q7HA 4ID3A 1VE5A 4QC2A 2MMGA 2DYKA 1JSXA 5TY0A 4CIAA 2JW5A 1M2VB 2YV5A 2W2PA 1U7UA 3NNSA 3PGVA 4NBLA 3K9LA 1B42A 2MSKA 1JV2B 1ZA2A 4DM7A 4I5DA 4OLHA 2JKVA 4CR6A 3DDSA 3M7IA 3P2JA 2FLKA 3HWSA 4E09A 4GYJA 1SO8A 2WW8A 1U2ZA 1YB3A 1EP2B 1M3SA 1VSVA 3C3XA 5T5QA 1JEQB 3V4OA 5C80A 3O31A 4JAVC 3E9EA 2P0LA 2FPRA 3DNMA 4FFMA 3VQWA 4FMCF 1DIOB 4JVLA 1PR3A 4JI3B 3ZHRA 4ZI7A 1XMOB 4NLLA 1WU7A 3M1YA 3BGIA 3KVRA 2CV1A 1K4KA 3A6HA 2NM0A 2MCFA 4YQFA 1L1FA 4Z4QA 4LX8A 2WJ3A 3HKDB 4W5JA 1U6JA 5DWQA 1QE0A 2VOJA 2QYTA 4LKOA 1M75A 1V9CA 5GONB 2DMRA 3AERA 5K3SA 1WUTA 1ZK3A 4RZ3A 3SFZA 4DA8A 1U5BA 2ZBDA 1PEKE 2J41A 2NQTA 4HYYA 4MWZA 2PZLA 3TLXA 4IDNA 3LCMA 5DNYB 5F64A 5BSWA 2REQA 1UQRA 4IQ0A 4Y1RA 1Z6ZA 1P0CA 4X71A 2PO7A 3JZDA 2F55A 2V54A 1E1KA 3OEHA 3NC1C 4G8DA 1XCJA 3O3CA 3IE1A 1KARA 3EWAA 3VNUA 2B92A 2P68A 2Y77A 2EZTA 2PLNA 3IBFA 3N0VA 3NIWA 2ZIZA 1LTKA 4QUEA 5E9AA 2FW0A 3ANTA 2GFQA 3DEAA 4NJMA 3NGXA 5BVHB 3KFVA 4Q00A 2JA1A 5ESWA 4EMBA 5I7EA 1RLUA 1JHXA 1QO0D 1GUZA 1P3Y1 1T1IA 1XZHA 4YDHB 3W5UA 1FW6A 4B0OA 3JD4A 2A1UA 3CNOA 3VV2A 2IYYA 1N7GA 1FDRA 2SKCA 4PN3A 2P40A 2TMYA 1T4CB 1TLFA 1XGKA 1W66A 2HWXA 1QX3A 3GCZA 3HP1A 3JQGA 2EYQA 3K72B 1BEEA 4LWQA 5NLLA 5AW5A 3E05A 3WL4A 4E5MA 4PPFA 4KR7A 2O5CA 3EEFA 2P1ZA 1U8FO 2XKBA 4ZPXA 4FQ8A 3H3JA 3MJSA 1VLLA 4JVMA 4AUEA 2OC4A 2FPWA 3RANA 3ROPA 1AHPA 5FTNA 1E94E 2I1LA 2WWFA 2RJOA 3PIRA 1NW4A 5TARA 1U7HA 3LHFA 4BQFA 3FUXA 2E3JA 5B4UA 3OQ1A 2ZT8A 3RUIA 3A31A 2PK3A 3BOSA 4QLOA 3T5AA 1R6UA 1TGVA 1Q11A 2FPPA 4JC4A 4UHEA 4RD0A 4QJ5A 3RVPA 4FE3A 2AKWB 2BGIA 1FX0B 3PGXA 4FDUA 1KY5A 1YS1X 4ZC8A 2XADA 2F17A 3NIFB 2J0VA 4HDAA 4Y9DA 5UKDA 2W71A 3BMCA 3MAJA 2YZ2A 1N36B 4G5FA 1J0XO 1Q20A 3AY6A 2OZPA 4WVFA 3UJ8A 5L6LB 4UEJA 2YVLA 3CIOA 3DAHA 3UAWA 3D3KA 4EENA 1OBCA 3QEJA 4KQGA 3KT3A 1UQUA 1JI0A 3GWZA 1H2EA 2O2CA 1IZYA 1H2WA 3C7KA 2QZ9A 3CW9A 1M67A 4U7PB 4KKXB 4E13A 3SHVA 5KWSA 2V3WA 1XJWA 4Q3EA 5IT0A 4DZRA 4JXZA 4I7EA 3D2AA 3GGCA 1USKA 4BNHA 4TLAA 3L4JA 1M72A 1A8UA 2HU8A 1DC5A 3GJ3A 3OJWA 3PVCA 4Z2AA 3SEZA 2NVUA 2YFYA 4MWOA 4K9QA 1V5EA 2C2OA 4GWKA 1CDOA 1HF3A 2CDNA 2JK0A 4IWYA 1WAMA 1HYHA 3OCWA 1Z16A 4D25A 1IN6A 3I12A 1FNCA 2CFTA 4ARZA 2WG2A 5D3MB 3GN2A 3OT1B 4D3FA 5KB3A 3K70D 1PFYA 3IV6A 3ORRA 3G2MA 2W5UA 2FSPA 3TSCA 3HBFA 4Q21A 1NFFA 4DMGA 3KG2A 1T8SA 3DVAB 1MZVA 5AI5A 4PONA 2QL7A 4POOA 2I29A 2ZU0C 2DTIA 2EV9A 4KR9A 1YUBA 3ZQ6A 5AW8A 2R87A 4LXIA 1FFBA 1U0OC 4D5EA 2WQ7A 2FSSA 1JIIA 1UK9A 2EVWX 4YCLA 2QXUA 2W6OA 4JX8A 1X7ZA 2I55A 3OG9A 3T06B 1X56A 1WV1A 3E5RA 1KBZA 1KU6A 2N75A 1EWVA 3THWB 4KWTA 1IQPA 2GRUA 2H2HA 2XCOA 1EWKA 4WHMA 4ZHQF 5KZMB 4LDAA 4X45A 4EYQA 4CIDA 1KZ6A 3LDUA 1J70A 2QM7A 3TLZA 1ND5A 2OV1A 1AN9A 5ULLA 3CIFA 1OU4A 3PGA1 4DV5B 3GEHA 3IEIA 3KSAC 4QPPA 4HNAB 2CNWA 3Q0IA 2VH1A 4D3YA 4DABA 1NMZA 3AFGA 4YS6A 5JJKA 1M7GA 2SCUA 5DHUA 2V7VA 5JSKA 1MORA 3GFOA 5EVCA 2Q6VA 4L8VA 3HEMA 4TVWA 4WKCA 5GZ3A 3EF0A 4HLDA 3HXLA 3MAGA 4IH1A 3T3GA 3RVDA 2P8JA 4I1SA 5JNSA 3IQXA 2N3ZA 4DY4A 2OAGA 1RQXA 1ONNA 2BCEA 2RC5A 1N4AA 1C7RA 5ELOA 4ZVLA 3E9RA 4INPA 4Q12A 1Q6YA 2V8OA 1WW2A 1GN9A 3WE7A 3PNVA 5AR1A 4H2DA 4ZO6A 1XAHA 2Q1UA 2VJMB 3DW1X 3PC4A 2IOFK 3D02A 4WY5A 3RS0A 3HUTA 3K8QA 1CE8A 4TZTA 5AM4A 4EMSA 3Q6NA 2P30A 3QKBA 2YN0A 3DOFA 5CG2A 1IK6A 5AVUA 3IAHA 1E1CA 1V8PA 3CB4A 4G5XA 1MOPA 4IUCS 3OZVA 4ZZ2A 4R2XA 1YKGA 4KYIB 4KRFA 2I7DA 2IOHA 3TKLA 1E2UA 2PJZA 2WWIA 2XIJA 2XWSA 2XSZD 3L3BA 4YALA 3OLZA 2ZBPA 4AS2A 4QRDA 4BO7A 2I8LA 2O06A 3B70A 2J09A 4K6KA 2VT6A 3ZLBA 2D06A 1MDBA 3MQFA 5DSXA 3S55A 3USZA 5CJ2A 4ZJYA 3I01M 4HD0A 3LRPA 4Z7OB 4RTNA 4BQNA 3K4HA 1RAHA 4C4AA 5MHTA 3A6LA 4FFBA 2A84A 3FTEA 4Q6GA 3M70A 1YC5A 1TUEA 4MYCA 2QYHA 4PZ0A 1MJGA 2X0NA 2Y68A 3AM5A 3V7FA 4BNGA 1CJTC 1TIBA 5BWCA 2KS6A 2FYKA 4PBSA 4A2CA 3EXHC 4BUCA 4HGYA 1G9TA 4AY2A 5K6RA 4M8SA 3ETLA 4NYIQ 4DCSA 2DZCA 4W5NA 1R6DA 1NYLA 1S1CA 1F14A 3M6WA 3TSAA 2O8EB 1LI7A 1ULAA 4O4JA 1RHJA 2JI8A 1F2UB 4J15A 3I64A 4QBHA 4DV4B 421PA 4YMWA 1L6IA 1QZUA 4OI2A 4BV2A 2CL5A 3F5DA 1P61B 4MVWA 3P5SA 3U5ZB 4N6GA 3O83A 4EJ0A 1THTA 2WVGA 5A9RA 1U2QA 1ZC3A 2QM8A 4NK5A 5L3ZA 4GS5A 3X0DA 3CE9A 3A58B 4NONA 4PIMA 1AY0A 1CB7A 2B78A 2X9GA 2O8CB 3GUVA 3R44A 3BK2A 4JXKA 1AM4D 3DXZA 4GKAA 5EPUA 2Q4TA 3GXOA 1OWPA 4Y2YA 4NH4A 3LYHA 4UNSA 4UQPA 3P04A 4FLMA 3VSAA 4WERA 1NC1A 3UV7A 3NBUA 1F0PA 1KJ9A 4G0UA 5CB6A 3LI2A 3LPAA 4KPYA 3TMYA 2UXDB 2EKDA 1GTJ1 4K6OA 1T5HX 5K5EA 1UC8A 2IH2A 4HWTA 3SJUA 2N46A 3U40A 1AZLA 2F59A 4NNPA 4BEJA 2HRBA 4MO9A 2C1EA 1PYOA 4MYSA 4KVZA 1P4HA 2EERA 5FV7A 3HNRA 1RC8A 2PQ2A 3I5AA 2BGUA 3GD7A 1EE2A 4RVSA 5HFJA 3UJ6A 4X5OA 1EB8A 4CDMA 5JBIA 4RQTA 2GTPA 3V33A 3OCZA 1KNXA 4CZ2A 2Q7OE 4Y6SA 3HKCB 3W9YA 2VDWA 3SS8A 4KR2A 1KEZA 2JFWA 1Z06A 4MPTA 3BIJA 4Y9SA 3BGVA 1K4YA 4XLZA 1CZNA 3TUPA 3ZJ4A 3VXKA 1G0NA 2FWMX 2O05A 2C2ZA 2WJYA 2FPOA 4JJAA 5P8WA 3KV1A 3NWJA 3QF4A 5A5EA 3KJHA 4LJ7A 1ISFA 4ZOLB 4Q1CA 1L5NA 1UMKA 3UTDA 2KW5A 4YNBA 1NXOA 2CYBA 2VT7A 1SG0A 1K1EA 3ESDA 1XMIA 4L0CA 3LSQA 3E7PA 4M8NE 2QRGA 1QIEA 1WXGA 3QVWA 1QH9A 1NURA 2ES4A 2ZE6A 4PS1A 1ZJYA 2H1WA 2PQ0A 2QVLA 3B3JA 4HF7A 1EXVA 3HXZA 4XA8A 4R5MA 1N2OA 3GCGA 4JENA 1KBQA 2AG1A 3A3NA 1NVEA 5J59A 4PTLA 4DRXA 3WBFA 1YC2A 4QHSA 1PUIA 4HATA 1J00A 3D81A 3FHLA 2HT1A 4LRSB 1S2MA 4IXWA 3VYSB 1BRMA 1AS0A 4WFJA 3UJAA 3PVZA 2QTGA 2MINB 1OFHA 4EAQA 3GI1A 1NKTA 3LUAA 4GIBA 4KI7A 3BJIC 4LF6B 4GI1A 3TXAA 4RAQA 1N92A 1QTRA 4YASA 5HF5A 2WYOA 4TXMA 2IYWA 1H2RS 4G9BA 1OWOA 2XUIA 4ER6A 5TMPA 5D00A 5K4AA 3E9YA 3RHFA 5C8VA 5KS2A 1AO0A 1I2MA 1KS2A 1Z7NA 5EP4A 5FBVB 4K2HA 4WZBE 5CB4B 5L53A 1GUDA 4BJ6A 1NZDA 3B9BA 1ZRSA 4LZNA 5BMVB 5LUAA 1CFZA 2AS0A 2FN7A 3M4XA 4QUKA 4Q3OA 4YA6A 2VAVA 3PDHA 3UT0A 1WUYA 2F4VB 2J4DA 1MRSA 3GIWA 3K9NA 2YJ4A 1LXCA 1V1RB 4LSMA 2Y1CA 5CXXA 1GG5A 2VQEB 3OJXA 3UPDA 3M33A 4B3TB 1RQRA 1CLUA 5KOIA 5C32A 3WK8A 3TTXA 1DIGA 1C3LA 2WOOA 1YDWA 4BPBA 3O26A 1E2HA 4C43A 4NFSA 1G8GA 4R8SA 3TTDA 1R27A 3IMKA 3RRZA 1SKYE 4YV0A 2ZTGA 4RANA 2E1RA 3IAM6 1O87A 2ZJ1A 3SS9X 4EIWA 2QXTA 2AUMA 2VL7A 4PSVA 2FHPA 3LL4A 5AW4A 4BB9A 1RM0A 2FOIA 2M6SA 3C15C 1JPNA 4J4HA 4TXLA 1Q0RA 4D4IA 4ENRA 4LHSA 2IBMA 3PC8A 5JRDS 4IV8A 2QR2A 2BEJA 1NVKA 3H1EA 3AOEA 1LDYA 1O0SA 2IHVA 3PEEA 3QMWA 3F9RA 4XFJA 3GUZA 4ND1A 1DHTA 4HD8A 3CUEF 3PICA 3GDHA 2OV2A 3JTMA 3F73A 1XAIA 4KE7A 1GAEO 1K66A 1QIIA 3MWGA 4H15A 4W4TA 4KR3A 3OCVA 4BAUA 1EUCA 2CJAA 4KOEC 5LYJF 5H3CA 3FLAA 3CEHA 4L5IA 1X1EA 3KYCB 4G81A 1N6IA 3RIGA 3T1HB 4J91A 1O95A 2WWTA 4MRPA 1A50B 3NR2A 3NEPX 5IJ9A 3BMOA 3TEJA 4BQRA 1MD9A 1N5RA 4EGJA 3NS7A 1WCV1 1M2NA 3PC8C 4IFBA 1TLTA 1IN5A 4I5FA 1ODLA 3CH4B 3G1WA 4FS8A 1SVMA 3AOEC 4M55A 5H4HA 5LA6F 3EVCA 1X1BA 1O2DA 4CIXA 3TQOA 3KFUA 4EA6A 1D9XA 2FSGA 3AESA 1C50A 3KAPA 3WC4A 3ZDZB 1ZKDA 1N78A 1B26A 2D1FA 3NWOA 2P4QA 4IIGA 1DOZA 3UBMA 4AMBA 1DXQA 3PXXA 2W2VA 1RM3A 1NKVA 2WIKA 4GRIA 4BNMA 1DE0A 1JVNA 3SC6A 4YLYA 6ABPA 3MHTA 4QIHA 2DPGA 4QJBA 1WKCA 2BKVA 3MS2A 3IE2A 5FAXA 1SUSA 4PQFA 4RU1A 3TAXA 1RKVA 1WZEA 3L6CA 1W88A 4P4SA 3H5OA 2BI7A 4ESEA 3IEVA 2P67A 2CLSA 3GGGA 4LJ8A 4E33A 1E6UA 3OSZA 4DXHA 2PNJA 3N7TA 4G9EA 4YT8A 4URHA 2I78A 2JJ1A 3I39X 2PPLA 1SUDA 3QUSA 121PA 4W5WA 1JLLA 1NFRA 4XX1A 4Z7QB 2ADOA 1X7DA 3TNDA 4XPZA 5AHOA 3STTA 3UFXB 2ZREA 3JQCA 1X13A 4UJ5A 1NUUA 2H4ZA 5ALOA 3TIVA 3EFRA 3UB3A 1UKCA 2YV4A 4TV8A 4AJPA 1R4MA 2HIHA 3FXAA 3HU3A 4KGXA 3LV8A 4GOKA 1XEWX 1ZONA 2XUAA 1Q3KA 3T34A 2VNKA 4CKBA 4W5OA 4X94A 2GVZC 4PLCA 3EUAA 1FYXA 1QYCA 1Q1EA 4N5LA 4UTPA 2P5IA 1C29B 5JTUA 4ZPJA 3GPDG 2E65A 1YS9A 4BNTA 3IB6A 2AJCA 1RHMA 2GVDC 1AZSC 3D6FA 3WHIA 4EY3A 2H1SA 4UUBA 5AW7A 6Q21A 4IV0A 2I62A 5ILOA 2BH9A 2HJWA 4E03A 1V11B 1ICIA 2WZQA 2Y66A 4BV8A 8GPBA 2FPKA 2V7QA 1ZRHA 3N8IA 2HIGA 5CM8B 2V4MA 2AEJA 5CTJA 3A6FA 4FBMA 4J4BA 5D3KA 1TT5B 1YZNA 2VHWA 3DZHA 4BV3A 1VG0B 4KK4A 1P5FA 4W5HA 4D82A 1X8XA 1YR1A 4HH4A 3OQOA 3QEOA 4YKEA 2TYSB 2WNSA 4G89A 4N39A 3KL2A 3O75A 2QL5A 1E1TA 1ZO8A