3PUKA

Re-refinement of the crystal structure of munc18-3 and syntaxin4 n-peptide complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
579
structure length
552
Chain Sequence
ERGLKSVVWRKIKTAVFDDCRKEGEWKIMLLDEFTTKLLSSCCKMTDLLEEGITVIENIYKNREPVRQMKALYFISPTPKSVDCFLRDFGSKSEKKYKAAYIYFTDFCPDSLFNKIKASCSKSIRRCKEINISFIPQESQVYTLDVPDAFYYCYSPDPSNASRKEVVMEAMAEQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKGLIKGKTQSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLEEIPKLMKEISSTKSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTEENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYRTNYLELDRKNGSRLIIFVIGGITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords Syntaxin-binding protein 3
publication title Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation
pubmed doi rcsb
source organism Mus musculus
total genus 152
structure length 552
sequence length 579
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00995 Sec1 Sec1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.60 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3pukA04
3.40.50.1910 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA02
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pukA01
3.90.830.10 Alpha Beta Alpha-Beta Complex Syntaxin Binding Protein 1; Chain A, domain 2 Syntaxin Binding Protein 1; Chain A, domain 2 3pukA03
4JEHA 1FVFA 4CCAA 1FVHA 4KMOA 3PUJA 4BX9A 4JEUA 4BX8A 1Y9JA 3PUKA 5BV1A 3C98A 5BUZA 1MQSA 5BV0A 4JC8A 2XHEA 1EPUA
chains in the Genus database with same CATH superfamily
3S1AA 4X1YA 1VMEA 3AUYA 3EHRA 3A1TA 3CTPA 3QLUA 5FPYA 1WVMA 4B6JA 4XJVA 2I4NA 1ZQ1A 3LDAA 4B81A 3AUXA 4MYCA 4RESA 2HGZA 4XIFA 3LDGA 4I9HA 1MA0A 4BVLA 2H1SA 1DRWA 3EW7A 5G0TA 2Q7FA 1KGSA 5ADVA 4L51A 5ER6A 4BLWA 1U7TA 1EVIA 3P2JA 1WIWA 4J3NA 2Y1FA 2AKEA 3QSGA 2YVUA 3KYIB 4DLXA 2VJLA 1LWOA 5FTJA 2OK8A 1JWLA 2UY1B 1J20A 3PPYA 4GI5A 3HXDA 5CA0A 3INTA 1EU1A 2ZR8A 1O5TA 1E2BA 1TF2A 4RS4A 3INNA 2QTWB 5SZHB 2ZGGA 3TFQA 4O4HA 1LUAA 2J9FB 2W11A 1JDSA 2GUGA 3A3OA 2VSOA 2PANA 2PRKA 4KQFA 1MCZA 2WXIA 1U4NA 1PFWA 4C2AA 3IV6A 3Q6IA 4G4SO 4ABTA 2BN4A 4HLUA 1T6XA 3EOAI 4RPLA 4RJ2A 4KN8A 3VAAA 5T3RA 3L17A 4BQSA 2G4VA 2X3YA 4A2WA 1CNMA 5JAPA 4X65B 3DMHA 3USES 3TXNA 3T0GA 3O3NB 2GN2A 3F7MA 4M7WA 3U4GA 4M7RA 2WYVA 3NOVA 3SY8A 4IOKA 5F21A 2CCGA 2B4AA 3U5ZB 3KQVA 1I5RA 2A0FA 3PE3A 1MO4A 3TLBA 1JU4A 3T9DA 1NP6A 5M34A 1E9DA 2E4ZA 2EZ9A 4AEZC 4IXNA 3KAJA 1NGSA 5C8ZA 3ENVA 3TDMA 4X44A 4HB3A 2QPAA 3BTOA 4DPKA 3ZTWA 3CF2A 3SD7A 3UMBA 4ER6A 4ON9A 3C1OA 1R5NA 4PQEA 4IILA 3S5JA 3U3ZA 3F9RA 2A58A 1NPYA 2J9YB 1D4FA 2YV1A 4MVJH 5BXOA 4M1WA 2XPZA 1RP1A 2ZSHA 1CT9A 3L1HA 3NYQA 4JL0A 3ZPJA 1PWEA 3PWKA 3HHPA 5CJPA 2NOAA 3FMIA 3LBNA 3FG9A 2CWWA 1SB8A 3SVLA 4FC6A 2ZKLA 2XZDA 3CO5A 3RNLA 2F43A 1DV1A 1AOXA 3VNSA 3B2EA 1G21B 1GL7A 1XPOA 4JQOA 2MOWA 1DB3A 2IUTA 3I1IA 4IAOA 5IC6A 4DWJA 2ZI4A 1ZISA 3VDNB 2R4UA 1IXVA 3KU1A 4KE7A 4DJJA 3L0DA 4QBFA 4G07A 3LTEA 2G80A 4NCXA 3CONA 4EMSA 3AL3A 4EEXA 2GR9A 3NVKI 3ZJTA 5GOTA 3TXXA 1C30B 4O4JF 1H19A 3I5MA 1XPJA 3ZV4A 1PU2A 4HDMB 5CT9A 2G71A 5EZQA 2O0MA 1GPH1 4UTZA 3JD3A 3ZVRA 5JS2A 3VBEA 4ZJZA 1JWAB 4L5YA 3F4KA 5JXGA 3SQOA 2X22A 3PYMA 1Z7YA 5DGCA 5ESWA 1JKXA 4TQGA 4TS3A 1K6JA 3TIGA 4JX9A 3VI3B 3TG8A 1N2IA 1BYUA 1CUFA 4F5YA 2DM6A 2X9LA 3JQRA 2OG2A 4LMBA 2QMEA 3VQTA 2CSUA 3SC6A 4J1QA 1T5DX 4JCOA 3WGHA 3ZJYA 2LSUA 1XEWY 3CINA 2PRZA 3K09C 1J2EA 1U9IC 4OLFA 4ZCRA 5CBPA 5JAHA 3RVPA 1O8BA 5FI3A 4ZQCB 1Z63A 2BMVA 2GDJA 1DJMA 1E0JA 3K2EA 4P7FA 3KYJB 2FG6C 1OPXA 4HH4A 1U1DA 2P6RA 3WGLA 1IBCA 2QQEA 4I8IA 4NY1A 4I8DA 1VE9A 2GBPA 3UFXA 4CQLB 3ZV3A 4TMYA 1EFRD 3W05A 3MLBA 3LPCA 4UQLA 2ZCUA 3G2KA 3NBUA 4JUBA 3KKPA 5IKXA 1ZI9A 3CKMA 4MV6A 2WSYB 4BRWA 4ALLA 1DWUA 2C2KA 1JDUA 1N5IA 3T7AA 2QMQA 1MUUA 5AVXA 4UVGA 2E87A 4DLLA 1XQXA 5CW2A 3C3QA 5JA4D 3FYCA 2C7PA 1PFKA 5B1AE 2JLAA 1TUEA 3P5SA 4Z2YA 2PCLA 3L4SO 1A9SA 4OO3A 2VGXB 4RE6A 1SUEA 3FJYA 2VSFA 1E1CA 4D92A 2WMDA 4LYGA 4H7JA 3PEYA 1VA5A 2ZTSA 3T7TA 4BRSA 4IXMA 4EELA 1SKBA 4MVJA 4TSFA 3PHCA 3SGLA 2IF0A 5IKMA 3R5SA 2C9OA 3WMFA 5CDUA 3OJWA 2CDRA 3HA7A 1R5BA 3QTBA 2P3SA 4RFLA 2XOKD 5B4VA 3EZ2A 4EQZA 4I9GA 1YASA 3D9MA 4GVXA 2ZYRA 4LZZA 2AQ8A 5EJMA 1AA6A 1MZVA 1BXGB 3GVHA 2E6KA 1XP8A 2XHZA 3MAJA 3EY4A 4CJXA 2O5RA 2CFSA 3RFCA 1L7VC 1UK9A 4NE7A 4B8YA 5KPJA 4N8EA 3JAWA 1R4MA 1V39A 1A9TA 4M9RA 5EHQA 4X1IB 3U0BA 2LKDA 2YFYA 1UC9A 5LP1A 2BZGA 4EA6A 1KC1A 9LDBA 5H81A 1QV9A 4LJLA 5TY0A 1OFVA 2QRNA 3LBIA 4DUIA 2A35A 4MRPA 1G19A 3L0IB 1EFTA 3KSBC 1DDGA 1NLYA 1PEKE 3IRVA 1NPTO 1SXIA 3GFRA 3V1TC 2HYIC 2DWPA 7GPBA 2HU2A 3UT8A 4Q00A 2AUNA 1JIQA 3CX7A 4KIFA 1R6AA 1DWQA 3AVOA 1J00A 4XD2A 2JFQA 2X19A 3CIFA 4ITVA 5C0OE 3DHVA 4IMRA 5BNIA 3PEWA 5JJ6A 1QTQA 3NWOA 3CHSA 4LDZA 4I50F 2HIAA 2EW2A 3BZUA 2HPAA 1MIHA 1BMFD 2VZ8A 1CC1S 2ORYA 5IAKA 2A9RA 4DV4B 4G5HA 2JIZD 4RVCA 5M3BA 4F86A 1V55E 2WMNA 3B6EA 2OFFA 5LU8A 1W76A 4WECA 3KWMA 4MWDA 3B5IA 3A6HA 4HUQB 1AKQA 4Y98A 3EG5A 1Z6QA 3AOEA 3OJOA 1VI2A 2VYVD 4UMEA 5EWLB 4D0SA 4G0QA 5E0KB 3ASFA 4ND4A 4JBXA 2V65A 3FOWA 4FB5A 8MHTA 1VMIA 5AWFC 3TRHA 2VTBA 4BO8A 4RJLA 3KV3O 2R97A 3MUOA 3H7AA 4JXTA 4NZNA 4TQUS 1GKYA 4YUAA 2V9PA 5DKFA 3BPSA 3WDMA 7ADHA 3R3UA 4ND8A 1EFLA 4FEAA 4JC4A 4IVNA 4XLTA 1KYZA 2N42A 2GZHA 3UHFA 3M6MD 3GEHA 3E37A 4JL5A 2W00A 2WPDD 3D7KA 1UXKA 4FZ3A 4JP5A 2GZ2A 2PWZA 3SR3A 3VTAA 4DW8A 2TECE 4O4JB 3E0QA 2CMDA 3Q7QA 1JMVA 1C2TA 2I6TA 1NFQA 2FCAA 2WXMA 2EKLA 4WBNF 4LV5B 3LOQA 4V3CA 3IKLA 2JGDB 2AFHA 5GM1A 1VE6A 1ZLXA 1ZGJA 4MPDA 2PR7A 1DKRA 5BT8A 5SYAA 4UDNA 4F56A 2H0QA 3SZMA 4TYQA 4GXRA 4IDDA 2WIDA 1KYVA 1P4GA 3QVTA 3UW1A 3DOIA 4MLZA 2GRMA 4I3HA 3HYRA 4IFIA 1PJ2A 5DZSA 1Z0KA 2XYRA 2H08A 3C74A 4G0OA 2JRCA 1PNQA 4BEJA 4P3NA 5DBKA 3V97A 2H1OA 3HB4X 4D9KA 2EL7A 4U6QA 3O8CA 4J8FA 2AOVA 2PH5A 5ENOD 1KVRA 1VSVA 1GGMA 2ZJ8A 2F00A 3HJNA 1P72A 3PKIA 2NTNA 5DYTA 3OI7A 5T4EA 2YWRA 2JI4A 5IJ0B 1BZYA 4XPZA 1KSJA 1LS1A 2PBLA 2JL1A 1SBIA 3LDHA 3LL4A 2WWIA 1TM2A 3H75A 3BHIA 2X5NA 3QF4A 4Q3KA 4M4SA 3SEQA 5LYJB 2XZTG 4P80A 1A5TA 1SC6A 1G0OA 4CVNA 4BLPA 2W2VA 1VIDA 2PAFA 3CRNA 3GO4A 4BEBA 3QLUC 4WNGA 4YJ3F 1XLVA 4BVEA 3MW8A 3U1TA 5BN5A 3DVSX 4E4TA 3P52A 1KTIA 4JUIA 2XLBA 5DP2A 2Q3MA 4UZFA 4X41A 2PRJA 2P9SG 4J0QA 1CQXA 1YNOA 1ISHA 3CEMA 3NZEA 3P0EA 1M2KA 1RLOA 2CMFA 1RQRA 5I7WA 3IIJA 4KYTA 3ZY2A 1VSTA 3NW9A 3IJEB 3W9UA 4B76A 5JHAA 4ZYVA 4N7BA 2EFHB 5JS1A 5F1YA 3ZX4A 4ECEA 4QAQA 4Q02A 1T3ZA 2M6LA 1NNLA 1TYZA 3E35A 1TW2A 4UFPA 1UP6A 1L3BA 1JEQA 4EHBA 3QKRA 3EF3A 1V95A 1RC8A 1QHYA 4DQKA 1MJGM 1OILA 1KYWA 1ONBA 3R6LA 2OPHA 2CKDA 4XVCA 3KPVA 1QG0A 4QHSA 5DWDA 1E32A 1P1FA 1QO0A 1KDVA 4HX5A 2UYOA 1W36D 2C4TA 2ICAA 4G3XA 4PX2A 3D9JA 1WW2A 3DYBA 3AG6A 3PLNA 3I62A 2VJKA 2XCSB 4LHYA 1TYBE 4F8EA 2VVTA 1JDBB 4X24A 4KQ2A 1FS5A 1GFSA 1T0BA 4BTVA 4G8KA 4Y6LA 1FJ2A 4MYHA 1PZFA 2CL0X 3C3XA 2NNLD 1WF3A 1Q2ZA 2I8CA 2IELA 2DSNA 1HE8A 1OUMA 3FB4A 3JQAB 3BX1A 4TYNA 1SQFA 2VHCA 1IYGA 5HW0A 3PVSA 3EXFB 2ZETA 4HFRA 4P3KA 5MDHA 1JEDA 4IRXA 3EVGA 1ISFA 2HA3A 1KR2A 2JVIA 4EG3A 4HTFA 3SXUA 4MMXB 3D9LA 1SZDA 5KYGA 3PDJA 1DNPA 4I50B 3WXMA 5BVGB 5LUBA 2HRZA 1Z5ZA 1EK0A 1P73A 5A6SA 3TSYA 4FHGA 4NXMB 2GAIA 3EH2A 3GAZA 2XQKA 4DCVA 4C0SA 2B30A 4H0FA 1IMJA 3O4IA 5KJCA 3RH0A 2BEWB 4IO1A 5AI8A 1Z3IX 1QG4A 3QKWA 4H7IA 3GGCA 4IRMA 4BEWA 4JC8A 3GMIA 1I3OA 3RVLA 1N3IA 1TMYA 2O3TA 5FPPA 2ZQYA 2ZATA 3U7HB 4OFXA 4DBLE 4BZQA 2I1JA 1ZI8A 1V0JA 5JMTA 3GZSA 3BIXA 4HMOA 1EGQA 2J3DA 5LQKA 5CFQA 3MV3B 1GFIA 2XQVA 4E12A 3FI9A 4JFAA 3RK1A 1GZUA 2WVJA 3OZTA 5HXAA 3E18A 3R09A 3UX4A 2FXVA 3T7SA 3ZU6A 3U0VA 4KAJA 4UUCA 3DSXA 3AZQA 2QTVB 3L7DA 1GNQA 2Z1MA 3OQVA 3PQ5A 3QPVA 1UBEA 1WXXA 2KPOA 2YWGA 4YAGA 2CY0A 2QNRA 4DEVA 4KUEA 2CD7A 5TPWB 3TNFA 3FYUB 3RV4A 2OAEA 1M54A 3L7IA 3DLTA 4FDMA 1R37A 3BGSA 3KXPA 1ZI6A 2DYRE 4MWOA 4I1MA 1FXSA 3FKJA 2VHZA 5F5LA 1WKCA 1HTTA 3H5VA 4RAQA 4RK5A 3C97A 5HE9A 4G0MA 1U8AA 4RNCA 3H2GA 3BC1A 4AXBA 4JR2A 4DLWA 1B3RA 1SQSA 2BM1A 3R7WA 2BFOA 1BG6A 4GTVA 2DHDA 1TN6A 5FBQB 2VJNA 1RHKA 1XZCA 4AKTA 5DM2A 5T8KA 3HVJA 4TRNA 4H3HB 1P7VA 3K0CC 2BJHA 3CUSA 4F3YA 2I76A 4ATZD 1QVZA 4CCYA 5HR5A 1CR2A 2W2KB 2P9HA 4MQBA 3GA0A 4HT3B 3NHPA 3V9AA 4HPWA 1E4YA 3C5EA 5E95A 3V1KA 2C4MA 2HDHA 2R48A 2XNDA 4GR4A 2J59A 2NO5A 3MOIA 4R7GA 2P4UA 1WAMA 1R0XA 3E53A 5FX2A 1JGTA 1SVNA 5GONA 3QU4A 1W47A 3R75A 3N86A 3EVFA 3PNLA 3K2BA 2B1IA 4B44A 4HS9A 3TPFA 3ID6C 3PV0A 2RGRA 1YZNA 2FUKA 5CB0A 4FZVA 3COYA 1ENPA 2ODEA 3QUCA 4ESVA 3CHQA 1KMHB 1K8ZB 3AONB 1XXHB 1V8DA 4HFJA 2DERA 2FQ1A 2XRZA 1DG1G 4K5CA 3S7BA 2ZSJA 1T9ZA 3AG4E 1WSDA 1EJBA 3GJ4A 1QYRA 4RHFA 1XAHA 4IM7A 2JGKA 4MRVA 3MTDA 4NULA 5THXA 2I1WA 5CD9A 3SS8A 1HC7A 3ZQJA 4KBGA 2WJWA 3CW9A 3HCBA 4L4YA 1WHTA 3KLNA 1K68A 1Z25A 4EL0A 3T7JA 4P83A 2Y9PB 3WNZA 1UBNA 3C8DA 3LKBA 4PFSA 1BKYA 1DJQA 2WM8A 3D3WA 3SI5A 5H9WA 2Q6OA 3NYIA 1BH6A 5HUHA 4WXRA 4OI0A 3KTFA 2CYCA 4AUMA 2NV6A 4AI6A 1JHMA 1S96A 4HYQA 1HLFA 5EXTA 2EJVA 1BIFA 4EZIA 4F92B 5CCXA 1V4BA 3AT1A 1JLRA 1PC2A 2NV0A 4UWLA 1SUIA 3Q0TA 3ROGA 4C05A 2O8CB 5IARA 3ZHUA 4P3YA 4LHVA 5JAQA 2I80A 4L8GA 3GRAA 3KOWA 3V2GA 4LOLA 2VDVE 4MA4A 3C85A 1ESDA 2BFAA 2WR8A 4ZZ1A 1FDRA 1Z6AA 4ZZ2A 3WYEA 4OU5A 4QLBA 3ABRB 4DSZA 2C8JA 1EBUA 2XZTA 1PLJA 3L6AA 1WJGA 1EM8B 2EQBA 4NJMB 1M2WA 4HWSA 1PR4A 1E9VA 1CZLA 1E0AA 1QYMA 3PWSA 1FSGA 1XAIA 4ENTA 4UKDA 2O1XA 2HB6A 5DHFA 2H54A 2GTHA 4C0WA 2CXUA 4AWAA 1KKUA 2WNSA 2XUOA 2K4MA 5F35A 1L8OA 1Z5VA 4CIAA 1RXCA 3TDKA 1RKVA 5FLXA 1LJUA 5KQMA 1AURA 2ODQA 3IYLW 1XVTA 4IDBA 1R3DA 2C96A 1DIBA 3GJTA 3ORQA 4ASUD 5C4MA 2OEWA 2X0DA 4OHYA 1NMYA 4RHEA 1ZSYA 4W5JA 3H42B 4QGHA 3TPZA 4N0EA 1E96A 2C2YA 1J1UA 4WJZA 1C9NA 4AV7A 4X20B 3H9CA 3MFQA 4CM9D 4KRYA 1U94A 1JKJA 3GDOA 4WEQA 4F1SA 2GM3A 1XDGA 4GNKA 3MTJA 4QDZA 4BNHA 3ZQUA 5CECB 1K75A 4LTMA 3EAQA 3GJ7A 4JXXA 4C3UA 4XDGA 4WFIA 3BMQB 4C1BA 3C3CA 2D1SA 2M32A 2NAFA 4IJ6A 2VDQB 4JJ6A 3T99A 4RK0A 3L93A 4YJHA 3LJKA 2PG3A 1JB1A 4DABA 1Q1NA 3L82A 3M5DA 3A05A 2R2GA 4QGAA 1MQAA 4BGDA 2SKDA 3ET5A 3ZIAA 1FDSA 2YICA 3FZQA 3HQ4O 1UMKA 1E2IA 3H3XA 3UGQA 4MAAA 3CHOA 4JVMA 4YR9A 1QYCA 1MN6A 4EGCB 3HB5X 4OATA 4Z4CA 4KITB 3PL1A 1V1MA 5BQ5A 5EMHA 5C1PA 1AHPA 5ICEA 1XZGA 4DSNA 1I3NA 4YLEA 5AHKA 3SX0A 2VT3A 2XCOA 1V11B 5LYYA 2GEFA 5ALFA 1SPBS 4H35A 3D4NA 3KYBA 4G24A 2VA8A 4DMHA 3D3KA 4N2QA 2CV2A 3EMKA 1QHEA 5JJIA 4PLTA 3WWDA 1XRLA 4DNPA 4N40A 3HJTA 3ZW7A 1X7WB 4F3KA 2QV0A 1Q44A 2VJMA 3BXZA 3OPVA 2X1VA 4GRAA 3HUTA 3PHHA 3OSUA 1TEHA 4P98A 1GQFA 1UBJS 1PV1A 2OR3A 4WNAA 2OILA 3E22B 2PUAA 4REMA 4RJTA 3AHIA 2VYFA 2V74B 2OCYC 4H1TA 3DXXA 2I9PA 1EDUA 3AR5A 2AXNA 5ADHA 2CF6A 1VZ2A 2G9UA 1QRRA 4HKTA 3GK3A 3L2OB 1IHDA 1Z3YA 4PYLA 5C80A 4XGNA 2BFNA 4JLOA 3ZDEA 5JD4A 1EUCB 3ORYA 4IICA 4QGBA 3TEMA 1ZM3A 5F23A 1I2MA 3PQEA 2IYNA 3M7IA 1QVVA 5KOHA 1RZ4A 1NMQA 2GYYA 4Y18A 3EZ6A 1I4LD 4RZSA 2BUCA 2XEEA 5D2CA 5I7HA 3UBMA 3WNBA 2B82A 3SCZA 1Q1ZA 2FPWA 3QYFA 1P7PA 2NM0A 4E2FA 5DTIA 2W4QA 1ZWLA 4GX2A 1X5BA 3RU7A 4CFSA 2X8JA 4ZQEA 3AP3A 3SDBA 2ZR0A 2O2CA 4ZOBA 3OJLA 4MKGA 2QXTA 5ITVA 4YV7A 1GNPA 2QM8A 4GZLA 5AW4A 4HRVA 2JA1A 4JL6A 1OI2A 4I1VA 2UYQA 4Z0PA 2UUCB 1WBJB 1E2MA 2N46A 4HX2A 2O6LA 2HU7A 3P71T 3HNPA 3WWEA 4PWZA 4EEZA 1U0FA 3BYZA 4UE6A 5JBNA 3NM6B 1Y4AE 4OGKA 1CQIB 1BVYF 3C87A 4W7HA 3Q72A 1OYWA 4N3BA 4XGKA 3C14C 2IYPA 3L7YA 4V24A 3X3HA 4KGZA 3PF9A 5JJ5A 5CA1A 1I8TA 3CT6A 2E4YA 4MI9A 3TMYA 3KWLA 5LZ9A 5HF6A 3VR3A 2P75A 5BMVF 3MUNA 1Q91A 4N5DA 2X0IA 4FT4A 5IAGA 1XJCA 4ND6A 4LJ9A 3PQ4A 3OM9A 2R5WA 1X81A 3F5FA 2NZ8A 1XC7A 4OUKX 3TTWA 4OP1A 5BMOA 1WY5A 1MW9X 4RFSB 1OLOA 2XUFA 1NKTA 1JIKA 2YC2C 5DM60 4MEJA 5D86A 1DIOB 1PJRA 4UE2A 2CDCA 2Q29A 3IDZA 1YO6A 5BSWA 2G08A 1D2GA 1W46A 2WTMA 3IR6A 3NAGA 3TBFA 3ZJUA 3JZIA 4QOHA 2G06A 1JFRA 1HDOA 1FFYA 4IYPA 1SEPA 2BCEA 2ZB2A 4L72A 3ZXSA 1E1QD 4EY7A 1Z34A 5KYUA 4QDJA 1OA1A 4RY8A 4OHKA 4KR7A 3DD5A 3N71A 4BL5A 4UZSA 2ZIZA 1E60A 2QMHA 4AJWA 1NI4A 5C18A 5J90A 1GR1A 3JVEA 4KMMA 1FNNA 1PGNA 1BFUA 3H1PA 3ZH2A 5DRTA 1SKQA 2VSXA 2X7XA 4W63A 4I9NA 2CL6X 2DFNA 1W1WA 5GINE 4P86A 1FRNA 1LBIA 2R8YA 5AT1A 3ZI7A 4IDPA 3G2PA 5ALMA 4HN9A 3DTTA 4YMSA 4V0KA 5B2ZA 1XFDA 2PZEA 5B7NA 2DYSE 2MJLA 4YAJA 4UTOA 5K0TA 1QPGA 1XFAA 1EFCA 4M8IA 3K09A 3FULA 3EZ9A 1U9IA 3ASYA 3LSYA 3OZFA 3CLUD 621PA 2PRYA 4JB2A 1AGNA 5TPZA 1NL3A 3IULA 3KNZA 2PD6A 1U0HC 4ANFA 3ITNA 1QLWA 3SAJA 3DOJA 5KJNA 2A9VA 2VI5A 2A1IA 1HX8A 4IDFA 4OQEA 2PLWA 2W48A 2CHQA 4JYBA 3K3PA 4RZHA 3WL8A 2QIOA 3B51X 3QP9A 4BO1A 2I2WA 4UNIA 1F2UA 5BN1A 2IXTA 5DTEA 1HZJA 1NVXQ 3HXCA 2IYOA 4EA7A 1KAQA 5C8YA 2Q3BA 4TTPA 4RIFA 2CNOA 1A7AA 1RWQA 2M9MA 1E61A 3HP7A 4JENA 4MPRA 2ID9A 1X7ZB 5DYIA 4DMCA 4NPHA 4B4WA 1LNSA 3ILSA 4CETA 3GJ3A 4E7OA 3FPHA 4MKIA 3QMMA 1QLJA 3IE0A 3TQFA 1LSOA 2WICA 5EIHA 5KBYA 2O2EA 2MOKA 4KXYA 5TB5A 3AF0A 4ZZIA 4EGJA 4PGAA 3EA0A 5JXIA 1T8WA 2BE7A 3VNUA 3RODA 4HH1A 1H8HD 3KD3A 3PFIA 2BBWA 1YGPA 3P0JA 3AVVA 4E2XA 3DQQA 1Y5RA 2Q0SA 2YMPA 3GXOA 3RSQA 3THWA 2LAIA 2FEAA 2JGMA 2C84A 4E15A 1U1IA 3Q85A 4C0AC 2MDTA 4A3TA 1Y6ZA 2WSIA 1MHQA 4Q4DA 3ETNA 2XZDG 2X0RA 4WNEA 3T8YA 4N18A 5CFOA 3WA6A 4Q1AA 2QE7D 1G60A 3JYNA 2RHDA 3C8HA 3OA2A 4P5DA 4KAAA 4C89A 1RXIA 1GSIA 1EIWA 1SKYE 2YRXA 1Y8MA 4KR9A 2X77A 3A1WA 1JTEA 3SSOA 1NJSA 2YHUA 2BKVA 2XTMA 3EVCA 5KJ1A 3PJDA 3N8GA 4W9NC 3O48A 3JQ8B 1FDWA 2YUTA 4ZC8A 1U5CA 2DPMA 2Q5QA 3U3KA 1IHBA 2A9JA 3EC7A 3L9WA 4EPYA 4TT3D 2X42A 3HCFA 3THXA 2ILTA 3UOWA 1GXSA 5K20A 4ACAA 4CM3A 1CEEA 2C7BA 2VK4A 3GFFA 3B8EA 4NZZA 1PZEA 1YJQA 1IN7A 2G5TA 2WLTA 2V98A 1UPBA 2J3HA 2REXB 1NC1A 3CB4A 1ONOA 3DZBA 1OYYA 3OIYA 5EHZA 3K94A 2IUFA 2FX2A 5H3LA 2Z04A 4JQCA 1PJBA 1F8GA 3DULA 3DDOA 5BMVB 4I4NA 1FC0A 4O2BF 5HJ7A 3ZGXA 1SD5A 4HLLA 1ZX1A 2XX3A 4FJ0A 1N2CA 4R54A 4B9AA 5JSFA 2VHVA 1NN1A 4Q01A 1ZEMA 3OD5A 4E2YA 2G1UA 4L9SA 4I6GA 3IAEA 2BM0A 3WV5A 4JX8A 4F91B 2P5YA 1PJSA 4UM7A 5HIIA 3JAKA 2J7PA 4X8HA 1U90A 4LKOA 1W5BA 2WD9A 1FTWA 2XXAB 1J1IA 3LXUX 1U2PA 3GPBA 4MVXA 1L5RA 2D1QA 2YVQA 4D9GA 1GPJA 3O26A 1Q3KA 3KDSE 5AKLA 3KLPX 4L76A 3UV3A 1VJ5A 4U7GA 3TB6A 2ATCA 3D8NA 1EQUA 1BAPA 2HCBA 2BUBA 5AVQA 3HI4A 4GOJA 5JIBA 3O9ZA 1CETA 1TGYA 1X7YB 2FSGA 1KMQA 4PZYA 1DXQA 3DKRA 4FD3A 4ETIA 2BY4A 2O20A 1FSSA 3WGNA 3TOCA 1F14A 4ZANA 4WADA 2BR4A 3HXLA 2Q4BA 3ULYA 4WQMA 2NXJA 2DLDA 4XSGA 1YU9A 2NQ2C 4MVJG 5IY5E 3H1AA 1X1SA 4GLBA 5ALIA 4WNFA 3BWEA 3MRXA 4B3RB 3RF7A 3HU1A 5G4KA 1QZ2A 4YAWA 1N3BA 4E6HA 3UUGA 3DXYA 3HS3A 1CJUC 3QVXA 1U8FO 1H5UA 3GH3A 5ISMA 4ANVA 3D2BA 4L57A 3RO7A 3ASGA 4W5QA 2OHGA 4MVJM 2Y69E 2Z4SA 3ZW8A 5EXPA 5ADWA 4ETWA 2WINI 5EWJB 1YQTA 3P0HA 5AM1A 5F3WB 1GQQA 3T3DA 3WK9A 1MB3A 2IDKA 1VL2A 2DIWA 5YASA 3IAS6 1P75A 3F6YA 1Q12A 4MUHA 4ZHSA 4D8TA 2BGRA 4G5RA 1V71A 4XFDA 3LJ3A 3B48A 1DTWA 5F77A 2BL4A 5T3UA 3BFPA 5LBUA 3VPFA 1GRRA 4DIOA 3PXEA 3FBTA 4AF7A 2QL7A 3H97A 3EIUA 4A27A 2HR1A 5F51A 2CNWA 2JFYA 2P27A 1UP4A 2GXSA 2IHTA 1R66A 4HH3C 2G88A 3PEUA 1KH2A 1DS6A 3D9NA 5E76A 4ITUA 1YE5A 4ER0A 1UMDB 1Q77A 3FAZA 3V4OA 3DL0A 2H6HA 1KYIA 2B7BA 4N5HX 5D3ZA 1M7GA 1VMKA 4Q7EA 5J5AA 3DO6A 1U1EA 1YZUA 1ACMA 3CLSD 5MN5A 4KXUA 2SKCA 3UCXA 3FP3A 3COSA 5C81A 4CG2A 2ZIRA 3RABA 4GIBA 3O82A 3ADPA 1CQWA 1XTRA 3D6JA 5FOSA 4Z1MD 5B3KA 4EK9A 1NVUQ 1RKQA 4KQ6A 5CU7A 2PUVA 4TLEA 1YBFA 3EU9A 1AH2A 2COEA 1JN0A 1FDOA 3HZRA 4LGVA 1JDPA 4CF3A 2XUPA 5CLJA 5I9NA 5B36A 2G1PA 2ZE5A 1OC2A 4DJAA 3CQGB 3MT9A 3M6AA 1GVNB 3JSXA 2FPSA 4PRKA 4DBVO 1QYIA 3UMYA 2V7TA 4RWZA 2BTDA 4FJZA 1SBZA 3C6XA 1J9GA 4U7FA 1ZH8A 1OT8A 3L9XA 3AMVA 4D9HA 3STYA 5EZYF 5LP6F 4AB1A 3ET4A 4MUXA 1RM3A 2R1VB 1XZHA 4MQEB 2ZRCA 4I14A 3DCNA 3CKBA 2PZLA 2V97A 1PAQA 2OCAA 3WNCA 5EUMA 3AL0C 4OH7A 2AV6A 2VF5X 3U7QA 3BD6A 3LCCA 5TT0A 1XTIA 3R74A 4L73A 3IV9A 1MG0A 1W35A 5DIFA 5HQ3B 4RVFA 4MO2A 3K0SA 1CUWA 4LBYA 5JAOA 5EIOA 2FKNA 1RXVA 4UTRA 3K70D 5GJVC 5L4LA 1YQQA 4XDYA 3I0MA 1QPZA 1ZVVA 2P9LG 1EX6A 1AK9A 1HU3A 3K0BA 4WERA 4RVHA 4GICA 4KHZA 2NUAB 5HZHA 3JD4A 4X1KB 1AWCB 2DFDA 2RC5A 2QIPA 1JX6A 4PU0A 2WWVD 1Z18A 2EX4A 4ALIA 3AHHA 4QTTB 2AJCA 5AMXA 4PTZA 2GM4A 5DTQA 2FSSA 3B13B 4UDXX 3QYAA 3QE4A 1J23A 1GQYA 2BGWA 3QVKA 4TZ6A 2X3MA 4ABNA 5C8XA 1XWFA 2DH6A 2PX2A 2X86A 4INPA 4DDUA 1I30A 2NVWA 4Z9YA 1YZ3A 2O06A 4ZT2A 4JJGA 5K05A 3FBGA 4TL6A 4BCDA 3JARA 2DPLA 1A8IA 2AUTA 4TTRA 2IYVA 1W9HA 2X13A 1J24A 5I8PA 2ZSKA 2PKXA 1J9EA 1SU6A 4XCQA 1ZNZA 3HEAA 4GZ5A 5EDSA 2P4QA 1QGUB 4AZ3A 1MQ8B 3ZVMA 1G291 5FO0A 3WOVA 3WRYA 3SY2A 3RHSA 1NYRA 5IANA 3KXKA 3AUAA 1D8AA 3KP1A 1R4NB 2H4JA 3H83A 4DLBA 3C2QA 4R0VA 2GJKA 1UJJA 5C5CA 1QDUA 4MV4A 4ZV4A 3W9BA 3O8OA 4LTNA 4OBWA 1CRWG 4QEDA 2JAOA 1VLHA 3PVCA 2OV1A 4NU8X 3OECA 3NM4A 1T4GA 5AI6A 4B0PA 1HDCA 4NR0A 4YBZA 2GPNA 3RKVA 3WADA 1QK5A 2GSWA 4O0LA 3DWLG 2GZMA 3A3YA 5ITZA 3QVSA 5C53B 1YAJA 3VO2A 3V8PA 4DRXA 3KM0A 4KB5A 1SC1A 3MS7A 4GMXA 3KJEA 1MPXA 2XD4A 2VUIB 4V1CI 3MKQB 5CM9C 1K6MA 1MRNA 1OCRE 2FPGA 4RVDA 4UU8A 4CYMD 5CLFA 3F90A 3UAGA 1G5IA 3B3FA 2VHQA 2RSLA 5FOWA 3ZXPA 3G79A 2ZSBA 4RNDB 3S81A 3D81A 2CLOB 2H9YA 3QTLA 3VKUA 4LSZA 2PL9A 3DOEA 2HF8A 3CCCA 3K0CA 1YHYA 4JLPA 2QLJA 2IP4A 4NRHB 1YOVB 2Z9DA 4FLMA 3ZHOA 1N8SA 5MHTA 1GEEA 1JPJA 3A9VA 1UOQA 1JT2A 1CEYA 3PTAA 3CUUA 3IUNA 2F8YA 2Q9CA 5DOZA 3BE8A 4R01A 4R9NA 1O0SA 5G04C 3WQBA 2JI7A 1MXFA 2N1MA 2YBDA 5TR9A 4MKTA 4BDSA 3KLBA 5LVAA 4WZAA 3SK0A 3BFKA 3GY0A 5LD2B 3T4PA 1AF4A 3HACA 4C03A 4TN5A 3V8BA 3N3AC 2X7JA 4A0FA 2Z6QA 1UZUA 3VUEA 1Q0QA 3L0BA 2IIVA 5DXAA 2C42A 5IZ4A 3C4QA 3TD2A 4YCJA 3KEAA 2OCDA 3D8HA 3IEIA 4I66A 4IH4A 1X7XB 4FHCA 1MH1A 3UUXA 1PLKA 2JEYA 1J09A 3CZCA 2WTNA 2IYTA 4ZYTA 4MQFB 3GLIA 1JRLA 3EDQA 4CKWB 5TGDA 2I2XB 5FOQA 3F4BA 1A4RA 1FX1A 4M3NA 1ETHA 2IPAB 3W6NA 1DC2A 1EDZA 2KE5A 3MIIA 5L3SA 1X0VA 4UUQA 5J4VA 4KKVA 1TK9A 1TQ2A 2G1KA 4CMBA 2P4HX 1OGYA 1PJQA 4QXQA 1YS6A 2PMWB 3NU1A 4ISCA 2L2QA 3MX3A 1GEGA 4YRSA 3QE3A 4QBIA 2RHHA 1N6IA 1EG7A 3IMFA 3F3SA 1CJTC 1KZGB 2AN3A 2P0AA 2QTCA 3OH8A 1V6SA 1W2HA 2HADA 1CWUA 4LGYA 3MSXA 4EB6B 4EQFA 4CIYA 4H4EA 4ABYA 5F4ZA 1UDWA 1W44A 2IHYA 4IDGA 3TECE 5EP4A 1Q50A 1OLSA 3L7BA 4UCFA 4F3VA 3OO0A 5EZYB 5LP6B 2YL2A 5JRDS 2V6BA 3TCXB 3NBKA 2HD4A 4RAOA 1KBOA 4PRLA 1GITA 4XX0A 5D5QA 3UATA 5EESA 4EQ6B 2OHVA 5K3AA 1SC9A 2ZYTX 4M0EA 1WUYA 1Y3BE 2P9IG 2QS9A 2JBWA 4TXQA 1G17A 1H23A 1DU4A 4GDMA 1XUOA 4DY4A 4DCSA 2AW6A 2CDNA 4KOAA 4REQA 4AX8A 1MZCA 2QE6A 2FWIA 4EP1A 5HF9A 2FWNA 2YS7A 4BYMA 3QKSA 4UE3S 5C46F 3HVIA 5DFAA 1N5OX 3ZLTA 3TSZA 1SZAA 1WD5A 1RAIA 4EHLA 1EX9A 2AR7A 1L8LA 4N9WA 3EH1A 1S9DA 1RLJA 2VDNB 2VDMB 2OFPA 5KTPA 4RH3A 2IW3A 4KVFA 2KM1A 3D2LA 3EHMA 1P9LA 1RZVA 5GJCA 2AKAB 3OJ0A 1YB4A 2MSLA 1N9AA 2DBAA 2LUOA 2QEQA 4PN3A 2ZRLA 4TOIA 2X8AA 2C0MA 2II6A 4X54A 2YV5A 4L75A 4ZP1A 2OESA 4IINA 4BQEA 2Z1NA 1H2FA 4JT2A 1P5RA 3VLFA 1H2XA 1DRVA 4FIDA 3ROEA 4WL0A 2HWKA 4BVGA 1MKYA 2D8AA 1NX6A 1JR3A 2BEJA 1KK0A 3MCTA 1OR8A 1BGVA 4BTAA 1N0UA 2PXAA 1NJ5A 5AI9A 1SG9A 3B1VA 4TWRA 3FYDA 5KWEA 5A0FA 2JAQA 3A1VA 3KV1A 4AM8A 4HVLA 3A4IA 5IJAA 2QTLA 2IHKA 2ZBEA 5I7EA 2PT6A 4MR9B 2R5SA 1FYFA 4IN3B 5BOSB 3KL2A 1ULTA 2YC4C 3PTLA 1U80A 1GRCA 3D7RA 5C2YA 5IULC 1A1SA 3DH0A 5IDWA 3UJ9A 2D54A 2IEIA 5AW8A 4JVOA 3HBFA 2JJ1D 1FFEA 4BTLA 3TDNA 4MQ4A 1SBTA 1KEEB 4CRWA 1VRCA 1H2HA 4D41A 1WG0A 1W5SA 5CUQA 3PPXA 4B2PA 2NU6A 2Y0EA 3KEOA 1H5QA 1UDRA 4IQ8A 4MYRA 2XRMA 4BNKA 4PE5B 1GNVA 4KQGA 2I6SA 3QB2A 5IYZF 4YEDA 2GNAA 1BX3A 3ABOB 3RS0A 3R9IA 2H1FA 3W1WA 5DMXA 2MINB 5T4FA 4C2BA 3UKOA 5BT1A 3EGIA 1G8YA 3LD9A 5K3SA 5K0SA 1T0PA 3RGGA 4V2IA 4MWSA 4GOXA 3HMQA 3C16C 4MGEA 3P2EA 4IXDA 1EZ4A 3OTIA 2XCCA 3N8HA 1JJBA 3K0FB 3AY6A 5B1YA 2DUUA 1TJFA 5BR8B 1PD1A 1RE0A 4BERA 4LHSA 2WYWA 1XZLA 1PX2A 1AJEA 1GILA 4ERXA 2WVHA 3VJLA 3EGXB 1QS0B 3HCCA 1LK0A 3AJAA 1MRSA 2PLRA 4TLLB 1DTSA 3IEMA 2X5KO 4YDHB 4ZGWA 2EFJA 2I54A 1B42A 1JIVA 1GYQA 1W30A 3IIEA 3A4YA 1E79A 2D5AA 1I1NA 4FBGA 1GPUA 4U6SA 3D4PA 3UWPA 1HE2A 3KB1A 4F5DA 5ALTA 3VPSA 5J2UF 1YZVA 1GFZA 3GLRA 3B1YA 2WA1A 2Q5EA 2G4CA 3GJYA 1IEQA 3S68A 1ZW6A 4Z54A 4BJ6A 1RNLA 1PGQA 3NZSA 4DDHA 1RQLA 3PZ1A 3EQ6A 4DCTA 1IB6A 3ER6A 1D0VA 2I66A 3FFWA 4W1PA 2PLNA 1K66A 2CHGA 3K9CA 1KSGA 4LEUA 3ZV7A 1RZUA 4BKRA 4Y2YA 5BW8C 4YDSA 4QECA 4E7PA 5K5EA 1GHTA 5IN4A 5FWXB 3BORA 2IUSA 1NG9A 3E70C 2GFIA 2ZTHA 4BCCA 3LS2A 1XCGB 3IOMA 3OMXA 4BQQA 1ITZA 3TGWA 1UXHA 4JFRA 1EZ1A 3EIEA 1Q84A 1FYWA 4IQ4A 3JWEA 1XJ0A 1LDGA 4G1EB 3UTDA 1Z4OA 4CN9A 4B4VA 4NL4H 1U3DA 3QEMB 1MD9A 3KZMA 2JLQA 5B3JA 4B3SB 2CXXA 1KU0A 3PR2B 1ODLA 3PGLA 1PTJA 1D8EA 2O2YA 3P0IA 4DARA 1SK9A 1TOAA 4F2GA 4NSNA 1RPNA 4UCQA 3B3AA 5C37A 4F96A 2WJHA 4A5SA 1ISRA 2WSMA 2W93A 5JHBA 3EVAA 5CB4F 4CQMD 4ZVOA 2NO9A 3EJNA 1QGAA 1KXZA 1I51A 3KQQA 4G8DA 1GZVA 2WU8A 3E3AA 5CYGA 4LMRA 2CL7X 4IIGA 1VGVA 3LGSA 5C4GB 2H29A 1B2LA 5AQ7A 1QQEA 4UU1A 2JFUA 3O31A 3I2YX 4O8CA 1LX7A 2WEKA 1Z7GA 3ZE9A 5F64A 3K5IA 5A4FS 5BV2P 1Y9DA 3D2AA 3E7DA 3JX9A 4I81A 5K0FA 1MF7A 3LWDA 1ZGAA 4E08A 1YUNA 5ESRA 2NUTA 4JA2A 1CQZA 2I3BA 3DVAB 5DXFA 3M6WA 3FH7A 5CITA 4GL4A 4LTDA 3EQZA 4EABA 4GYYA 2BFDB 3GZNB 1NVEA 5DXJA 1UDAA 4D43A 1IUNA 2Q1UA 8AT1A 1IXZA 1P1RA 1L8AA 1NBOA 1XTVA 2ZDGA 4K86A 4PSCA 5I9TA 8GPBA 2CFZA 1ELKA 2NN3C 1TTHA 4A82A 1U1CA 2IYZA 1HH4A 3WRYC 4BO5A 3H7IA 3V7YA 2CV0A 5ESDA 5CMLA 3AM5A 4L8VA 3K1YA 2V3CC 3ZWAA 3KSLA 1Q83A 4DKJA 4I1SA 2AWIA 5EHXA 2C82A 1GA1A 3A4VA 4I2VA 4E5MA 2IXBA 2I6FA 1JHOA 1PQWA 3VZSA 3MAGA 2XY4A 3H8VA 1K7XB 5KU7A 1SXJD 3GD5A 1SH7A 1XMJA 4L5AA 4MKZA 4R4JA 4IW3B 5FTPA 4YONB 1G8MA 3A6ZA 2VNKA 5FWQA 3NJ4A 1Y3IA 4AKEA 1OWOA 4RKQA 1G3MA 3C6QA 3DJFA 1FNMA 5IVPA 3FH5A 3ULEG 4K46A 3HBAA 2PVSA 3B6KA 2YWEA 4D26A 3MINB 3PQ6A 3Q47B 2DUNA 3ZU4A 4HDOB 3SX2A 4HNAD 2JJQA 3GWGA 3Q9NA 3Q1LA 2R0QC 1Y6JA 1RDFA 2HH9A 2QA5A 3VH4A 7MHTA 2PMFA 5MN4A 3AWIA 2REQA 1J56A 5AJHA 4ZO9A 4U95D 1ADJA 1B0UA 5JQWA 3ANSA 4LJ6A 5CAEA 4M21A 2J6IA 4GPAA 3RM3A 3S2GA 1N8TA 1W0CA 3ENZA 4I4LA 4HVCA 1I2ZA 1BWSA 1R8XA 1SULA 4YAOA 3LSTA 4WBNB 1QF9A 3ESRA 3OHPA 3ZNQA 3S2IA 1KYTA 4K40A 4PLCA 1Z73A 3VC3A 3RPEA 4ZI7A 3DKVA 2H7YA 1B23P 5IN5A 2Z5LA 4TKUA 5IYZB 6REQB 3KUXA 3QXHA 4BNZA 5AKYA 4RPIA 4KQMA 4EY8A 2HBYA 2ZUEA 4G97A 1K7YA 1NUTA 3O4VA 3T4UA 3WICA 4OJKA 3L06A 2X9NA 2PX4A 1QRDA 1VDMA 2NXCA 4KVZA 5K8UA 1P7ZA 1JHYA 2H00A 1RIIA 4BESA 1FSPA 4L23A 2X6FA 1UUFA 2WXHA 1WP9A 3SC4A 2CNKA 3Q7TA 4HI8A 4B2LA 5EWMB 5K0JA 4UAVA 2OZLB 2PFKA 4PH4B 2WM9B 1YL6A 4OQQA 1IPEA 3N2IA 1S8AA 2IYEA 5I7UA 3CN9A 3ZWMA 3CWCA 5FJJA 1HFAA 1Q0PA 2A1TS 3PFFA 5F52A 2XB2A 4CHTA 5J2UB 5TQ2A 4YJ3B 4FYVA 3B5JA 3CK8A 2LCIA 4HMPA 4YX9A 3KQUA 1VHQA 4HAOA 4LWQA 1XKLA 5LMZA 4MB2A 2IOHA 2W0MA 4AY3A 3HG7A 3P19A 1EFVB 3GRKA 1OE0A 4LNAA 4PPYA 1KDPA 3PHIA 4GS5A 1J90A 3GHHA 1QC5B 3VFDA 4W9NA 4FIZA 2W8BA 2IXGA 5AUPB 2C3UA 2XPIA 4I0WB 1Q7BA 1JQ5A 4IIYA 1LDBA 4IV0A 5G0WA 2J4FA 3G2LA 4FOPA 3NTVA 2ZISA 3VKWA 3VU9B 4JZKA 4BFXA 2B4YA 2H2GA 4YO8A 2ZLBA 4LNHA 3U60B 3I73A 3X1ZA 3PT5A 3MKRA 1PQ4A 3L7KA 3REQB 4UNPA 2XI4A 5CX1B 3J81A 5JCJA 2PM7A 4QVIA 4DCJA 3RYTC 3H5OA 5JLJA 1GTG1 2XXBA 1NASA 2OPBA 2FF5A 3PUIA 3HFJA 2ZE8A 2OGTA 1GYPA 1XTPA 4Z7OB 4QT4A 1DQSA 3DHYA 4X7PA 1NE7A 1L1EA 2Y1WA 2J32A 4FVTA 2FN4A 4LSGA 2WXFA 4GI3A 5JXJA 1OFHA 1F7UA 1L7MA 3ABSB 5FTWA 3SBSA 1D1TA 4J0HA 2WAOA 1MV5A 5CB4B 3V32A 3B3QA 5TX7A 4UTNA 3QKIA 3R5XA 3PD1A 2A7XA 1UMBA 4FI3F 4NYJQ 1M2JA 3VPAA 2FF7A 4GP7A 1MG5A 1VB3A 5B3SE 1GUYA 2VPYA 3WIDA 3E5RA 2CLCX 1ZXXA 1NQTA 1XYGA 1QR6A 2DWCA 1WZUA 5CIQA 5E9AA 1Q57A 1RJ9A 3FNHA 2ZUDA 1N34B 2CXOA 4EATA 3CX3A 2PYIA 4G1UC 5DX1A 5ARGA 2C99A 4JMLA 1TJ5A 1E7VA 2PSFA 4TLDA 2RH8A 2ZXUA 4A92A 2FULA 3ZW9A 4GF5A 1B6TA 4M3OA 4YQYA 1YJ8A 2OOKA 4DLZA 4ED9A 2R4QA 4QU5A 3IR7A 3RC8A 2GPJA 3DEAA 4WWPA 3U62A 3NHZA 4A8TA 3VR6D 3HJHA 3USZA 5AJZA 2H6FA 4YGYA 2YXBA 4V3IA 3NAMA 1YS1X 3GXBA 2X15A 4J8SA 3KQYA 3LUAA 1LPPA 3PNPA 2H2HA 5J4LA 3G8YA 3DCYA 3ILHA 5KNCH 1B00A 2FHSA 4QGSA 5HZGA 4JITA 5EEHA 3D6AA 3I39X 4NP6A 4K9PA 4A4DA 4KQXA 4YDWA 3VC7A 3DKKA 5ALHA 1W4AA 5DW3A 3OIDA 1MDBA 1OH8A 1S4MA 4QYIA 1OBOA 4J07A 4HAXA 2UYYA 2SNIE 1DAGA 2WIAA 5KUTA 3L92A 2HMUA 2GO7A 2AG8A 4F6LA 1ULSA 2Q07A 4ENWA 2AXEA 4BZPA 1E59A 4BGUA 2I3GA 2WIGA 3K0AB 1R9NA 5BW4A 1XRMA 1SKYB 3EODA 4Y30A 3T5DA 3KTAA 3AF6A 2GM9A 3P27A 2X6KA 3PXAA 1F8FA 3CEPB 1VLQA 4EPTA 4IWYA 4B0OA 2K2QB 4O1PA 1ZNXA 4B6EA 3RSGA 3BAZA 3GDFA 3D7MA 2FZLA 5HRCA 1VHWA 4HHEA 1H9BA 3B78A 1NOIA 3DEFA 1Y6QA 4HQLA 4U2DA 1B8UA 3UJAA 1ZGBA 3ZGYA 3FU3A 1R7RA 1ES9A 3RUCA 3WB2A 4LXTA 3IO5A 2ZKIA 4U7TB 4FUQA 2RJNA 3BWXA 1TAUA 2H63A 4B0ZA 3HPQA 2BZ0A 2JGRA 3DFUA 1FOEB 2AJTA 3IDQA 2JGFA 1YB2A 2PU5A 1RRPA 2XVAA 1FNCA 1HYBA 4QUEA 4LC1A 1VMAA 3QF7A 4Q0MA 4QPCA 1NVWQ 1C2YA 2J0VA 5EG5A 3TSAA 5H3HA 4EIWA 4HAUA 5DBOA 2HU8A 4D10C 1KSFX 3A3PA 3L6EA 1GGHA 3O94A 4P8RA 3VSCA 4DB2A 1ZHOA 1IY1A 1P0FA 4FC7A 4IOMA 5K3CA 1TI7A 3FCYA 1I4DD 1W4BA 3ZVNA 2YINA 4K6FA 2AH5A 1P1CA 1O08A 4WESA 5FQ6A 1QRAA 4YIHA 5EPOA 4JHKA 4LF8B 2IITA 4R9VA 1NVVQ 2QU8A 3IODA 5AR1A 4IF4A 4LFCB 1L7XA 4P7KA 2GJSA 2RKBA 1J2RA 5EXSA 4GEKA 1OU4A 1UAAA 2R96A 4A6PA 4LZNA 4BHTA 2BMWA 4YJ2A 1ZSVA 4C4RA 1YI1A 1E89A 3DHEA 2NWQA 1LLQA 1GU7A 2FEWB 3QBJA 4ENSA 2W2LA 4L1BA 1DBVO 3IAXA 5B3JC 1VPLA 3FTWA 3FJOA 4BLQA 3OETA 1PTJC 2Q5LA 5KNCA 1RABA 3AZPA 3JR3A 2INGX 2ON6A 1EUQA 3F6PA 1L5YA 4K2AA 2ZQZA 2CNNA 1ZWKA 5F1PA 4RK7A 5JW6A 4RG6A 2NO7A 1SVSA 2FMFA 4APFA 4MGZR 2FLKA 4U7DA 3MSCA 2GXAA 1JSCA 5JJCA 4EY3A 3NFYA 3C5RA 5FWYB 2ZJ1A 4C4YA 3AI2A 4WH0A 3WSTA 2CYBA 2V5VA 4UBMA 3IBTA 3GEMA 1KJQA 3WJ1A 2D5BA 3S7FA 2Z58A 1KQPA 1VYUA 2ZWOA 1IDN1 3RYFB 2VA9A 3TWUA 4GG1A 5TRTA 1IQ0A 1P9WA 1T5TA 3TLGA 2X9GA 1YDMA 2EJUA 4F7DA 3SC3A 3RD5A 3E4CA 1WHSA 3EDYA 1U4OA 4BBZA 3DEZA 3RRBA 1LSUA 1U7ZA 4IKPA 3WZ2A 5T4YA 3ABQB 3RU2A 5F3RA 1P5QA 2G9RA 1YFJA 2YJ5A 3IC5A 2PZGA 3EQ7A 1XKXA 1XKQA 5P21A 1YBMA 3KQTA 1V3QE 3NDJA 1WCIA 2UVDA 1ULAA 2XMSA 3A32A 3IEGA 3DEHA 4UHCA 2R2AA 3G2UA 1N2ZA 2XE7A 1NFFA 4J0GA 4ZKDA 4CZ2D 5TQJA 3V9PA 4EJ0A 1V5WA 4CTNA 4U0KA 4K1XA 3EGDB 3H2JA 2PH3A 4J2HA 4WOKA 1U8CB 2FFHA 2RFMA 3WWOA 1BTOA 2BFFA 1IJBA 1UWKA 1OXTA 1XDDA 3JASB 1FMCA 4PYIA 3X1WA 2OCKA 1DIHA 5EKTA 5CFPA 3KB2A 3EUAA 5JALA 4PBRA 2Z9BA 4WKPA 2NT3A 1G2OA 1PNTA 4P2BA 1NOJA 1WDTA 2R6CA 3V4LA 2P65A 3AB8A 4OXNA 1YL5A 1DJLA 4EVSA 3Q9NC 5KVAA 2R9VA 1G8KA 4B4KA 4M1ZA 4YK7A 3DNPA 2TRSB 3ASNE 1E0SA 3AEXA 5I4BA 4ZT4A 4HQDA 3AHJA 5AKHA 2PNNA 1XTBA 4QTZA 3C41J 1D6MA 5D87A 3IMCA 4XEUA 4XEIG 3EC1A 4O33A 3M6LA 5AD1A 4OFWA 3ACBA 1CU1A 5EIFA 2V7XA 4F11A 2DB3A 3TTTA 5JWHA 3PFGA 2FRXA 5B1IA 4CGYA 4XQ9A 3K1AA 5BSEA 1GSHA 1NN0A 3PNSA 4Z0NA 2EW8A 1HDYA 3RKRA 4WLUA 3AKCA 2HA4A 2QAGA 4P4SA 1G41A 1M2VB 1S2DA 1UBMS 3DZCA 2IOFA 1M67A 1DRKA 2B25A 3CNEA 5E9WA 4WA7A 2IPXA 2C58A 3UAWA 3FH0A 8LDHA 3ROKA 1KH3A 1NMXA 5J63A 4F7AA 1Q7CA 4Z86A 1QK4A 2Y1KA 3PHLA 5DHAA 4LE0A 3HCPA 2A94A 1OZHA 3UMMA 1F5NA 4BB5A 1ZGGA 2LDXA 3QELA 5AKZA 2H2FA 2YXPX 3RS4A 8OHMA 4M53A 1FFXA 3L0SA 2ZB7A 1JECA 4K9NA 3BJIC 4WI1A 2WNHA 3CPJB 2DWZA 2JLXA 4HG2A 1DKOA 2VSNA 4KO4S 4ZYUA 1E3WB 1TPZA 1II8A 4ENPA 2X8WA 3PD0A 2LDBA 1FU4A 2HK6A 4YV1A 4Q9DA 2D74A 3H9JA 3E3OA 1DCFA 3GLUA 4Y6GB 3QX3A 1FMJA 3SQXA 3VSEA 1JTVA 3OJXA 2Y0PA 2O57A 1MX5A 1Z5UA 4GI7A 4RF2A 1KXJA 3G1UA 3K30A 5GV7A 1NW4A 2VBCA 3ES9A 1FZTA 2DHCA 1NL4A 5G05C 2GCOA 2Q99A 3KR2A 1R0LA 3DONA 2PL5A 5FUXA 3MVEA 3OPXA 1KZYC 2E4WA 1EDDA 1PWYE 3NR2A 2Y27A 1PKXA 4HNUA 3CK7A 1EM6A 1OV4A 3I5UA 9MHTA 4LXUA 4HDNB 2KCKA 1XYYA 1EWVA 3KOMA 4BAGA 1CUXA 3UC5A 3TXYA 4JLVA 2L82A 5KCMA 5CLIA 3HN2A 3ZPXA 2OHOA 3WL4A 3S27A 1XCJA 5A4AA 2OXRA 3KS9A 3CHRA 2J85A 4GXQA 3M9LA 5FFNA 1OCEA 2JGJA 3EF1A 2V3VA 1Z0ZA 2KX7A 5I8ZA 1OZFA 1H6DA 4D9EA 3SYRA 2OWEA 4NEHB 2XODA 4FN5A 2V6JA 4X8MA 4W8HA 5LWQA 1X1AA 3HB0A 3QFFA 4JIMA 1F0PA 4QO7A 2Z6UA 1MC8A 2D1TA 1XALA 1LPOA 2YJZA 2XLCA 3A27A 4CT4B 2P0EA 4UAJA 2IYLD 3L1JA 2EIHA 2FB9A 4YPVA 5G40A 4BNGA 2V4UA 2ZB3A 2AT1A 1VDYA 3FUVA 3IURA 2Z5GA 5ERXA 2E5WA 3H86A 2AVNA 4R8KA 5J9FA 4Z5XA 3ZJ4A 1VLLA 3H8SA 3AHGA 1N0VC 2HGSA 1RW2A 4B3TB 3I2GA 2WKWA 4FCWA 5G1OA 3SJZA 4O02B 1FFAA 4YDOA 4HR7A 4R7LA 4FWIB 5JROA 5KYYA 1OC4A 2RK3A 2RI0A 4LPSA 1FDUA 2PX3A 4BNFA 2QRVB 5EYLA 3FWHA 3WGYA 2WFLA 3IAS1 4IQFA 1PQYA 4GFDA 2O8BB 2P9QA 5B7GA 5JY1A 1M1NB 1E8DA 4NRDA 1U2VG 1J2YA 4HVAA 1CJBA 2X40A 2HQ1A 4DYDA 4FZRA 2B1RA 1AXRA 4R7ZA 3LNCA 3UK6A 2AG0A 3GEBA 3JYLA 1MU0A 3ENQA 4LUCA 5AXDA 3TZCA 5L51A 2NV2B 2ZRGA 3TZ6A 2SCUB 2PUHA 3HJFA 5A4JA 3F1LA 3L84A 4MW0A 1W8DA 4CNBA 4JJ8A 5ICSA 2QZ9A 1YCHA 2X2EA 3L7MA 1KC3A 4Q1FA 1UIMA 2JIDA 3RC1A 4W8OA 3ABME 3MCAA 5JG7A 1TRKA 4JGBA 1HYGA 5BYKA 3LX5A 3HK2A 2ZXFA 4AJKA 3ONWA 1J7KA 3MTIA 5H9VA 3P2BA 4B7UA 3ZDDA 4TS1A 3BK1A 4FUTA 2VBIA 4ARCA 3U4IA 5LZ2A 3W4IA 1GOTA 4EDFA 2EIKE 4LOJA 4HWRA 5H3CA 3TL5A 3SSMA 1S3SA 4GXNA 1ZM2A 4M1TA 4ZEWA 1W25A 5DGXA 5AVYA 2OG1A 2KW5A 4G09A 5KKNB 4OUDA 3BG0B 1NFRA 2DQYA 2BFCB 1ULHA 2JH8A 2FMXA 4K5AB 2Z2KA 2F3QA 3K6KA 3FSRA 5HKBA 4D9FA 2FEZA 5BSTA 4OKSA 1UEJA 1RIFA 4EY4A 5AOBA 2JABA 2IOQA 2OQIA 4K9OA 1Z2DA 1JEOA 3JQBC 1DQNA 1B14A 1P4AA 5BNWA 4RMNA 1JVBA 3N5KA 1LU9A 1YMVA 4HBZA 4NONA 1ZBQA 2PLFA 4FKBA 3P9RA 4YMLA 3ND7A 3LGAA 5F98A 1CD5A 5DHQA 5FQ7A 4P0PB 2V8BA 3GCWA 3NHYA 5FUVA 2QJTA 3DBLB 3KPWA 2CVHA 2RI1A 2COUA 1TFRA 4UTPA 2MIIA 4YBRA 4B73A 4L8FA 1RS0A 1CQJB 1ZUIA 1M10A 3WFJA 3BJRA 4KGVA 4M8NE 4JJZA 1UZAA 2OTCA 5BW8A 1BVRA 4GI2A 4ZRMA 4JI4B 1O5IA 2CLIB 3AETA 2QRLA 3CA8A 1IXSB 1F3LA 3UB4A 1NJ8A 2ZJ5A 4JROA 2N3ZA 3CE6A 1CUDA 4U2BA 5DCYA 4MZDA 2FEMA 3EMDA 1JQAA 3R7LA 1S0PA 3NV9A 4PS8A 3KXIA 4IIJA 4GGOA 3JRWA 2EYUA 1RHRA 2H5JA 3GEPA 5LJIA 1U5BB 4ZYYA 4IFTA 1UBHS 2YINC 1G9XA 1BCRB 3KUCA 5FL7A 4YROA 3FDZA 1LGYA 1QVWA 3P2MA 3FSEA 2CB0A 4J6EA 1Q0TA 3Q7IA 3NF1A 4KSYA 2POQX 1L7RA 1P29A 4M1KA 4HB5A 1UK6A 3OFKA 3R7DA 3TZQA 4F93B 2OB1A 1KAGA 2OXIA 4D0LB 1N4DA 1P2UA 3NJ8A 4U6NA 1HYHA 1WCWA 3VX4A 1F3OA 1RVV1 4OMCA 3D9KA 3WLQA 1ISIA 3BICA 5H68A 3V4FA 4UBLA 4XQCA 2I7VA 3OO1A 3FROA 3ZY4A 4W4TA 3D0KA 3B82A 1W52X 1JQBA 4DOMA 3IEKA 4F9FA 5ELXA 2XZLA 1CNFA 4QBGB 2I6UA 3RFTA 2YW2A 2QVXX 1W85A 2ZULA 1ECLA 5I3CA 1GSAA 2Q1TA 2XTZA 2ZU0C 2CNLA 4GYWA 4ROTA 3ROZA 4CXMA 2XTNA 3O95A 4KMRA 3SVTA 2JASA 1VL0A 4IZIA 3W5BA 2XT6A 4ZEXA 1XZNA 2CDBA 3UUWA 1SA4A 1G8PA 3ECCA 4WY5A 2RHOA 1OV6A 5CB8A 4ZQBA 1RBQA 4QJ4A 3ENEA 1DRJA 2R6ZA 3M33A 4N5CA 1KI9A 3JYHA 4X95A 4E1VA 4TMFA 4O2BB 4PBSA 1KDYA 5IABA 3A2LA 5CXQA 3GFGA 1H0AA 3R5HA 1H4QA 4BIMA 1KVQA 1N3LA 4TSFD 1BD8A 1SFRA 2H1WA 2EJTA 5FTLA 4HZIA 4ISBA 5JSUA 1N2GA 2W83A 4R1PA 1D6JA 1N9GB 1A2KC 3QWWA 4C7VA 1X13A 1JYFA 5ES4B 1ZP6A 1AGRA 5GAJA 1OB2A 3W5SA 2P6OA 4AJEA 4C0JA 1FTSA 5DI9A 4BY9E 3DC7A 2VLIA 2GRLA 5IM5A 5JV5A 1WU7A 2J5QA 4C14A 1FK8A 5LBTA 4ZXFA 1CE8B 2Y1CA 4UW9A 2CLFB 4WCFB 4C07A 3U4QA 5THQA 2BFBB 4NACA 3HZHA 4C87A 4NBSA 3V4RA 5TXGA 5KSWB 4B3XA 2QLBA 2QRHA 1ECFA 1WXHA 3PUZA 2G70A 1ZN7A 5KREA 3N7TA 3KUUA 3HRIA 1HQYE 4UREA 3MWFA 4R0MA 1O1SA 3FDHA 5THKA 1KI3A 4ZO6A 1QAOA 5L40A 4NENB 4K81B 5H1YA 3H99A 3AFOA 1PJLA 3UB3A 1SBCA 2A1TR 5J43A 5DF1A 4OX9B 1AS3A 3QU5A 4Y2UA 1TECE 2XBMA 2JEZA 5C8VA 2HHCA 2BV3A 4GYKA 3IJRA 1AUQA 1Z6PA 3C3KA 4HSGA 2FUNB 4RDXA 3QUBA 5E1BA 2O7SA 1JXQA 1CIVA 1AQJA 1ZAYA 3WKEA 3JV7A 3D9QX 4II2A 1NKVA 5TMBA 5A5FA 3UB2A 2QUJA 4WK2B 5AJUA 3R7SA 3BCHA 1U7OA 1A8HA 4G0PA 1GL6A 1UC8A 5AENA 2EWMA 2MSEB 1Y8QA 2QAGC 1IWPB 3GBPA 5LIPA 1JT9A 5LXTA 1E8WA 3ADKA 2I87A 1QKIA 3AEKB 3KE8A 1YRBA 1II9A 4JY7A 2QN2A 4ONEA 5IVIA 2JH9A 4RD3A 3CPEA 1ODSA 2V7EA 3RWBA 4BNDA 1EJ0A 3E1GA 4OQLA 3Q79A 3ZJVA 3MNFA 4O6FA 3VAYA 3EZFA 1E8ZA 5F12A 2XA1A 3H2KA 3NCHA 3AI3A 4IO0A 4AZSA 3HV0A 4X93A 3LJNA 4RGVA 4N3AA 1Z5SC 1Y81A 2EGUA 3ZHQA 3COPA 4MMYB 1EUZA 1FYDA 3Q7SA 3ZU7B 2W2OA 1Q21A 1PN3A 1UFRA 1LVGA 3CK9A 5SY6A 4UI9J 1CDOA 1SD1A 3C15C 4XCXA 2PXHA 5AM2A 2J0QA 3COVA 4TL8A 1N33B 2OBBA 4CMIB 1Y9JA 1HL7A 4QYTA 4F4FA 3UM1A 3RI3A 2ZS8A 1NBMA 2YIDA 2GAJA 3VI4B 5LWHA 3CZ9A 3X1XA 2Y99A 1Z4IA 1DELA 3NIGB 1KZ4A 2KCLA 1K1BA 3ZE0B 3VOBA 2QRMA 3SEAA 5ANRB 1EFPA 3NBNB 4C6TA 3FYHA 5IPFA 3LP6A 1X1EA 1P3DA 1UCFA 2OXFA 1YJ5A 4RUKA 4Y2VA 3PDUA 4KN9S 3N74A 4DMFA 1BJRE 3QX9A 3NRJA 2C2HA 4E6EA 1NURA 3E34A 5EMLA 4Q24A 1EAYA 4FHFA 4PNEA 5SZKB 1L7NA 4X6UA 3SF8B 2DPXA 4XUGB 4KTTE 2IQCA 2WXNA 1K1AA 1NAHA 4XTCS 1WMDA 1O1TA 2GSDA 1S5PA 4MKFA 1WZEA 3OCJA 3HYNA 2M6SA 3DE7X 3GZTB 4XZ4A 1VPEA 1J8VA 1R88A 5CEDB 2IU3A 4YDYA 3QZUA 5G1PA 1RWXA 4D02A 3BSSA 1OASA 2EFYA 4JEUA 4D3YA 1VLZA 1T36B 1LFDB 1THGA 3GLTA 4RU1A 3LRTA 4GR5A 5IDVA 2DU8A 1TJPB 1P5FA 1ZPDA 4LMAA 5JAZA 4PLWA 3AUJB 5IJ9B 2P6NA 2LCFA 3IQGX 1ZL2A 3PXDA 3B7PA 1A8SA 2WVIA 2VAXA 1I4EB 1NVBA 2IEYA 3ABZA 3THYB 3AR3A 2Q8PA 5H5JA 4MUAA 4HNVA 1GV0A 4TTQA 3UPTA 2A9QA 4K6CA 3W3AH 1YZTA 4OQYA 3J5QB 1RRGA 4ER3A 3HWRA 3FZEA 3QEJA 4XWAA 3JTMA 3QVOA 1ZICA 4AJIA 4Q66C 1UBLS 3KCQA 1TCBA 2RKKA 3QA9A 3SQVA 4I1IA 2HFJA 1JAYA 4EB8A 4BASA 1VRVA 4P4TA 1XVAA 3ANNA 1M1YE 4QX6A 3TGPA 2OYRA 3K4HA 1E2EA 4EJ2A 2JEOA 3AIOA 1XAJA 1YONA 1D2EA 3VO1A 3H16A 3V2IA 3E7PA 4YXWA 1WTAA 4GWGA 3T9FA 5E38A 1ZRSA 3L7OA 4PO1A 1FF9A 5EZ5A 2JBAB 3ZLJA 2HRDA 5KPDA 1QO0D 3W2FA 3WFZA 1ORTA 4QLAA 3DPDA 3C39A 2ZCVA 2PV7A 4YAFA 2DHEA 4BX8A 4YAKA 1WBBA 4NMLA 3N8NA 2ZWPA 3AR8A 4BCBA 1WMBA 3CG0A 1QZTA 1L4NA 3K35A 3R1IA 3STTA 3UM9A 3G49A 2FWMX 3M1IA 5D1HA 3WDKA 5LA6A 1E66A 4K2HA 5IDYA 3EA5A 4YNBA 1UOOA 4MGYR 1NN3A 1WM5A 4PRZA 5CDYA 2ZSAA 3QC1A 4YI3A 2K7ZA 1QCCA 2QM3A 3UWKA 4LWOA 4L85A 2A0UA 1ULBA 5FPHA 2VGEA 1SCAA 3K5WA 5TSDA 1GTSA 3D6NB 1H3EA 2VDWB 1J8FA 5EKSA 4OQ4A 3FTYA 1RHMA 3D3EA 4N8SA 5K01A 4MW5A 3GUUA 3B1XA 4JI0B 2UZ3A 2O5VA 2C78A 2RK4A 5FR2A 1VCMA 3CZRA 4DK5A 4CFYA 1VBFA 3UJHA 3RRMB 3G89A 5EJ5A 1GTJ1 4JODA 5JD5A 3KELA 3OLVA 3CVPA 1O4WA 5D01A 4EG5A 2HYZA 4UMFA 2QTTA 6LDHA 3KUDA 1KZOA 3D0RA 2E85A 4MUMA 4TUYF 3I12A 4XUEA 3W3AA 1GCUA 2BH2A 2A0WA 2X5JO 1OWMA 3A1CA 2AF3C 1T4CA 5KX5A 4Q3NA 4IRUB 4KQ9A 3I6ZA 1LVUA 2NYAA 4BB0A 2XECA 4ZFNA 4PS7A 4F2DA 2GJAA 3TR6A 2AK3A 1U8XX 1DL5A 4QUDA 2YHSA 2QHXA 3O90A 4L6CA 5DX8A 3TW8B 1UBTS 3TUZC 1FP7A 1DMRA 2G67A 1KYYA 3DQPA 1NJGA 1FPMA 3OY7A 4CKXA 5AW0A 2RG7A 1XZBA 2I6QA 3LQKA 4MR8A 3N2YA 3DLBA 3BGOS 2FV8A 4IJQA 2I71A 1O87A 2ESRA 1B15A 3OIFA 1K98A 2NO4A 2QRZA 4WN9A 2H18A 3KKNA 3LEWA 2DUMA 3EDRA 3ZV5A 2NTEA 1ZZGA 3ISMC 1XL1A 5AM4A 4RSGA 5BYAA 4AY4A 4PYKA 1YQUA 3CQCB 2R7KA 4EZJA 4K9SA 4E13A 2PS1A 5MF6A 2IU6A 4EG7A 3P9YA 2XDWA 2I03A 1ZLYA 1N0RA 2XNDD 5AKIA 5HGJA 4QVGA 5JSZB 4AD8A 2B69A 1VHLA 4TS9A 4Q6BA 1K2VN 1EMDA 4CI0B 2YHCA 4GT1A 4ES6A 1G7CA 4HP8A 4LGMA 3IJPA 4TXLA 4E31A 2ECKA 4NI5A 1J8MF 3P9ZA 3H4VA 4J0DA 2VWPA 3BEDA 5D3KA 4MBGA 3ELYA 1NWHA 2ZRBA 1IBSA 3Q4AB 4JNCA 3H13A 2I3AA 4LUNU 4ILIA 3WI7A 4R05A 4H2DA 4UARA 3JQFA 1EESA 3CSDA 1DIGA 2AZMA 1L4UA 5KSOA 2YXNA 1LDNA 5L53A 4REOA 3UIOC 4KXFB 1RPZA 1OLXB 1XIVA 4DWVA 3KSQA 1GPKA 1SR8A 3G0CA 3RBXA 4PTYA 3PSHA 4H6PA 1F4VA 4G5YA 4N12A 2B7LA 2EDAA 4JLUA 2R65A 1LC3A 4G0YA 1L9XA 3KZVA 4W6ZA 1I4OA 3DR3A 2WD7B 1ETUA 1GAJA 1UDBA 2C9BA 3JVDA 2I2FA 1F2DA 4DPRA 3TK1A 2I2DA 4FGJA 4QIHA 1Z75A 5ITWA 3G7UA 1OREA 5D3MB 3M4NA 1RKBA 2X2FA 2WHRA 2GCIA 3DV2A 2J46A 1ULUA 1WDKA 2HSEA 4ZJUA 1PR9A 3LYHA 1Y42X 2NPOA 1D3AA 5IZCA 2DUJA 3MJCA 1W5EA 3ZIDA 3IQWA 4CLHA 1SY7A 1A27A 2C4UA 1VXOA 4RY2A 1XRQA 4N0DA 1W5TA 4Y6SA 2V5AA 1Z82A 4V0OA 4RKYA 3MJVA 5HZMA 3QI2A 4DIDA 3WGMA 2ISSD 4QJ3A 2VDUE 1FS6A 4F4JA 3A14A 1W88B 2WJYA 3K15A 4Y0VA 3U56A 4RANA 1NVKA 1GUDA 3UM3A 3O3CA 3TWTA 2AJAA 2OGUA 2PHZA 3Q3JB 5AHWA 5BQFA 3MELA 2YHIB 4RLYA 1V35A 1XWWA 1XZDA 4WNCA 4LZLA 1RAAA 3NUZA 3U4TA 3SZ3A 2DFPA 4AP2A 2R6JA 3CZAA 3APDA 4LOAA 3PPIA 4LJ8A 2BMFA 2P9KG 2R8ZA 1DLJA 5DNDA 1A04A 2X4DA 2ZRIA 3NZUA 2IYXA 1XMVA 3AEYA 3WLSA 5CK5A 4H4CA 1JU3A 1YZYA 1K06A 5E6UB 3ESDA 1TX4B 3O4HA 5IM4A 3E3NA 3MWDA 5JHGB 5DX0A 3G3EA 3N6RA 4DM3A 3IQFA 4RMIA 4BQNA 4L16A 2HDWA 2CBGA 1V8FA 4UPDA 2Q1WA 1MDFA 2GF0A 3UH0A 5HRUA 2AFIA 5CVEA 3FPLA 1HKHA 4DNQA 3NAWA 2VT2A 5EJ4A 4RHTA 4AN0A 1XTJA 4AX4A 3I4RB 5SY4A 3V7FA 5BUSA 2O14A 3JWIA 4AF8A 2WK1A 5AQ1A 4FADA 3T3NA 2VDRB 4WXYB 5TMPA 2ORWA 4X7MA 4TM7A 3T1VA 3VOTA 2OV4A 1NSYA 2QQ5A 4MQLA 1XDSA 3BS4A 3RRNB 3K5HA 1F8XA 3HPRA 2DLNA 1OY1A 3BUSA 1JQLB 1C7FA 4HQFA 3NYWA 3LW7A 3ZIAD 2EP7A 1T3TA 2EWWA 1K0UA 4MLPA 3G02A 4ZPXA 1N1EA 4TXMA 1GZDA 4TUYB 3G2QA 3EDTB 3UWDA 2B9EA 4P35A 2P11A 3B9RA 1IB0A 2J0UA 2W58A 2P9NG 1GPYA 3B6ZA 2YXLA 1XV5A 1KS9A 1JXOA 1W87A 2IRWA 2O3RA 5CXXA 1ST3A 3LA8A 4I4TA 3F3MA 2NVUA 4PLYA 1ORRA 2E3JA 2DBQA 5KZMB 2BVNA 2VHUA 4HNRA 1QV7A 2WXKA 1T1RA 1SQ0A 4UEQA 4L02A 3TTVA 4Y0NA 4U0SA 2FGJA 3I42A 5BNFA 3DXKG 1FVOA 1XZ8A 3MBOA 3WHKA 5JT1A 4A8JB 3P2IA 4LJYA 4RA9B 5EE3A 1S8NA 2BBTA 2R44A 3MXOA 3UK1A 5EERA 5M2QA 3ONLA 4NNOA 5ELLA 1FPQA 1OH6A 1HOXA 1SOMA 4UEWA 2WTEA 4D6XA 1BSVA 3AEUB 5FNZA 1N6PA 3A0RB 2QXYA 1QHNA 1OU0A 1I01A 2J8ZA 2C61A 1T5HX 3EGCA 3EG9A 2ODNA 2QB5A 5FBWB 3IALA 3RS9A 4KO8A 5IAEA 1N5KA 4NJEA 3LP5A 3UJNA 2QYTA 5JPIA 1OXBB 4S1WA 1XN4A 2D0PB 4KQJA 3NWPA 2Q2NA 3L6OO 2UUAB 4QAJA 5CDHA 3WE7A 3J5PA 1KARA 5CT6A 4DR7B 1JEYA 3D0OA 5DNAA 4E3ZA 4U0JA 4PFKA 2AMVA 1E3SA 1AKRA 3LK6A 1JAXA 2FW8A 2ZPUA 4MRMA 5M72A 1QV6A 3JYQA 2YNQA 2NU7A 1SG0A 3RVQA 2P1RA 4MV3A 4C01A 3CV0A 3AHFA 1ZU4A 3BU8A 4FLEA 1XNGA 4EX6A 3E84A 3UIPC 3LVFO 4GM0A 3OE1A 2PQNA 1RFGE 3ZNPA 1NONA 3BXOA 4Y9RA 5K7SA 2A4ZA 4YECA 4H7HA 3N5CA 2Z9CA 2PBFA 2C9DA 1DWOA 4Q93A 4QQRA 3VNVA 4QULA 4BJ5A 4MVJI 1YCFA 1Y0BA 2ABWA 3RVMA 4O2AF 1DCMA 2ZRHA 4EBBA 4DDWA 3A8TA 2QPTA 2ZI7A 4O2RA 5JMND 9GPBA 4M22A 5ARFA 1AKMA 2DJIA 2XEXA 4XWKA 1U2GA 4CGZA 4G86A 1AQ6A 2XHEA 2IKQA 2HREA 4FLBA 5COQA 2VH1A 3RSFA 4BKMA 3VR3D 1WV1A 3X1JA 2V3WA 3PNQA 3QNWA 4IUCS 3OWXA 2QRPA 2I33A 4ZDIA 5JPDA 3KOXA 5C4IA 3OKCA 5HDQA 4LEIA 1MO3A 2N9UA 2A78A 3X0DA 3OTOB 3LHDA 2DXIA 2LGJA 2W22A 2ETXA 4L7VA 3VO8A 3EY9A 2WP0A 2VXCA 3OQ1A 4TT8A 4CQJA 4YCLA 4IWNA 4E5KA 1PFUA 4NMXB 1DAPA 5A7DB 3MWEA 4E11A 1UMCA 4ZIRB 3TQQA 2ZAYA 1YOBA 3IPRA 1JH8A 1E5TA 1Q0LA 4XPIB 3UI2A 1C8KA 3G1TA 4NATA 4EWLA 1CQPA 1I6MA 4OYHA 1XD2A 3JQDA 3OE5A 2IT1A 1GG8A 4INOA 1SKMA 4LQ4A 1SELA 3NOXA 1A8QA 1YR9A 3JQBA 5DGDA 2PGOA 3FUFA 1V8OA 4KT6B 4L5BA 2G6BA 4EHJA 1DEKA 3GNSA 4K26A 3QVGA 1N6NA 3QEOA 1SPXA 1K5GA 2WWRA 1OX5A 3HBJA 2H57A 4KUHA 3IP7A 2QVGA 3L9TA 4HZGA 3N3BC 2QD5A 4IP0A 2IWRA 4PCLA 5EJ2A 1XKTA 4UU7A 1WB9A 3UJPA 3HNOA 4UI9K 5FINA 3GRZA 5JQGA 2FNAA 1HNXB 3HP1A 4RD2A 3ZDQA 1LEHA 1JZTA 2FQWA 5A9SA 5C3UA 3NATA 3W7BA 1X77A 3UK7A 1M1UA 1ZD3A 4X66B 2OHHA 1AKUA 1E2UA 1KJ9A 5CTJA 4B8WA 5G02A 4FEYA 4C21A 4KSBA 3Q9LA 1E9AA 1UWVA 3PYLA 1N6KA 3DS8A 1BFKA 4RZXA 3WWZA 4UEKA 3ZHVA 2O48X 3S8EA 4S1TA 3GLHA 4QQFA 1INLA 2O19A 3C3MA 3CLJA 1ONPA 4ARZB 1DI0A 2RGBA 4EUKA 1L5JA 4FONA 4LI3X 1WWKA 2WJAA 3G2VA 4HI9A 3SYNA 1Y3FE 4NLLA 3FHTA 1D1SA 1WAO1 5ADUS 2PFGA 1U8YA 1TLFA 5TPZD 1X3LA 5CYPA 3CB2A 4CU2A 2Z95A 1A50B 4LF5B 3JYOA 1HRKA 1NYLA 2R17C 3WLAA 1GAXA 3SF4A 2WC1A 2ZM6B 4M36A 2X6TA 2B4QA 1L4BA 3OKAA 3F6SA 4FLHA 4RXUA 4TYYA 4GOMD 4RCZA 5AJVB 4F5ZA 3DMTC 3AJ8A 2AEMA 4C0MA 3B52X 3E1KA 4PIPA 1WF6A 1IN6A 4LRYA 2Y1LA 3Q9UC 2JF0A 4WXHA 4CEHB 2BYTA 2WHPB 3LWBA 2AWOA 1RRMA 5E2AA 1UEIA 5LR6A 3HBNA 2G9NA 3ZDZB 2REOA 3QLEA 1A9PA 2HEIA 3RSOA 4L2IB 2A0XA 3R3HA 3G23A 3V8QA 3DNMA 1QVAA 3R23A 3MPUA 3ZD8A 5GVRA 1Z62A 3LBYA 3R8FA 4WZZA 1NRWA 2Q46A 5M04A 1M8JA 2KZTA 2H4XA 3GN2A 1N0WA 4Y9SA 4CM5A 1GCIA 1TUBB 4HC4A 1KP2A 2WLSA 4ATGA 2O8DA 4Q69A 2RH9B 3O84A 4L9PA 1S8OA 5ALRA 2F62A 9ATCA 3P97A 1MEJA 1RZRA 3HYCA 1YBAA 4AVYA 2NUPB 1JI0A 3JQFC 5CCDA 4YLGA 6Q21A 1BDIA 4EO7A 4ZHQA 1KI6B 4BMYA 2QK4A 4AKHA 4PHTA 1Z3CA 4IDCA 3M6XA 3L6RA 4P36A 4CF5A 1FJXA 4ZMSA 4FCVA 1AE1A 1QU3A 2R5NA 3RC3A 4H4DA 2C2BA 2B21A 3DT9A 4BZZA 2XMZA 4H27A 5AXAA 4EY5A 1K5HA 5JS6A 1TEXA 2AI2A 5G3ZA 1DKPA 3TZHA 2R8EA 2P8JA 2CJWA 2Y1XA 3TWWA 2CWDA 4C0HA 1RTTA 3W3ZB 3FDXA 4RJIA 1DFIA 3DGFC 4JR0A 1AS2A 3ZU2A 1QGZA 2RMKA 1RHUA 2CMKA 1Z8FA 4YRGA 3DTVB 2GN8A 4MV5A 2XRYA 1WR8A 3ROXA 4R2XA 2P4SA 2JLRA 3GAFA 3SU8A 1Z88A 3UYLA 3OKFA 2FX5A 5IZCC 5EFZA 4Y8VA 4YUZA 2VR1A 2OFWA 1C7QA 1T0IA 3VH3A 5FUYA 4RJJA 1ZHHA 2E21A 4CM4A 1ZVKA 3VSDA 4FP9A 4D9NA 2QZSA 1MC1A 3UUEA 5ETJA 3RYCA 3IBSA 3SNHA 4PX5A 2PSJA 5B30A 3M34A 4CLRA 4IJVA 3V4VB 2QRGA 1NUQA 1HRDA 2DVMA 4BMNA 2QD2A 3CGGA 2F3SA 1HOTA 4B74A 2VDPB 3NVAA 3H5LA 5E6RB 5CB6A 2XWPA 3ITKA 3DMPA 1T9BA 1K88A 4OHOA 4O4LA 2B36A 3CUEF 4FMCF 2JC3A 1JVNA 4Y3UA 3OQBA 2XSZA 3AR4A 5C34B 3KS2A 1FLDA 5G41A 1CZRA 4EJSA 5GGXA 2ZS7A 4I17A 3INRA 1P81A 3KR9A 1XRPA 3RC2A 3HKCB 4UVDA 3HHEA 1J33A 3BIJA 1W4ZA 1FFGA 1UOHA 3BE4A 3NEJA 2VZ0A 1PZHA 5LL6P 4E2ZA 1WZNA 3MG9A 4ZARA 1AMUA 3FLEA 1IUPA 4J3FA 2HF9A 1BE1A 4C78A 4EL5A 3KWFA 4D4LA 4IBOA 4BLTA 1D4ZA 2QGZA 2IA5A 3MQ2A 4D9BA 5CNIA 1E2KA 4A6EA 1RW4A 4P7JA 3PP8A 4ZCQA 3UGJA 1POXA 4O4IA 4NBUA 1IIRA 4OCZA 3E9RA 4C2TA 3GUZA 5AJLA 5DTRA 2WXPA 4LRSB 4KOEC 4H3SA 1LK5A 1GUAA 3B85A 1EE2A 4YCAA 3RCBA 4CF7A 1EINA 4II3A 1F38A 3BD8A 5EUCA 2ZSIA 2NU8A 4CKBA 2D1FA 4RBNA 5E75A 3B9QA 3CJTA 2EARA 2CJPA 1D2NA 3HLTA 3U44B 2HA5A 2VAVA 2L0TB 2IV2X 3D02A 2PH1A 1I24A 3BCSA 3DMRA 3NTQA 2V1UA 3HVEA 4JYZA 3KQNA 1EB8A 3FUJA 4DDVA 1IXYA 4GL2A 2DMRA 2HA0A 4PYMA 2QTHA 4ZT7A 4X8OA 1DKNA 2B5VA 1CR0A 1IHOA 1EPUA 1MOZA 3AO0B 5I7OA 2G5CA 1XG5A 3RJ9A 4J7UA 4DILA 3CH4B 3SX4A 1OFUA 3UFBA 4KMOA 1Y9AA 2JJ2A 3P9SA 2FPPA 1MVOA 2JI9A 3I32A 5KNGA 5BV1A 3EVZA 3RS5A 2D1YA 5F7OA 5B2FA 4KLNA 4U7PB 1IBRA 4WFQA 1E4EA 2PKQP 1QQBA 2AW3A 5HX7A 3ULKA 1UOEA 4ZVTA 4LYEA 2P7HA 2Q28A 5CDGA 4LECA 4G5QA 4GE0A 4DZTA 2EFGA 1ONNA 4EPVA 1VECA 1TA0A 3PKZA 4ICIA 1WULS 2FW9A 5FZQA 1P39A 1VJRA 5BXYA 3X44A 5ALZA 4DJDC 5KNBH 1GAEO 3H11A 1IN5A 1KHTA 4XB2A 3BWYA 4R2IA 3II6X 3LFUA 2FUCA 2GWHA 1KT0A 2CHZA 2F59A 2CNWD 4MKRA 1JG7A 3GP8A 2J7KA 5K4AA 2EFEB 4LVNA 3SZLA 3HUDA 4FEEA 4TV8A 1PAUA 2PGLA 3BMCB 1Y4DE 5FZSA 4LJ4A 3E5HA 1BI8B 3CWZA 1E1KA 2K7FA 1KRHA 4NH0A 3FPBA 3IPAA 4M7PA 1PCXA 5B58C 4KQKA 1MJ5A 2J6BA 3H19A 2ZTVA 2OZEA 3WP1B 1NYQA 1V4NA 3ZGOA 4OFZA 1C3XA 1X3SA 4WK4B 2GASA 1OIVA 2QSYA 1IEXA 1JPLA 5ALSA 4YQEA 2O2SA 1C7JA 3MMPA