4C0JA

Crystal structure of drosophila miro ef hand and cgtpase domains in the apo state (apo-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
molecule keywords MITOCHONDRIAL RHO GTPASE
molecule tags Hydrolase
source organism Drosophila melanogaster
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0jA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0jA03
3J81k 2K2FA 2AKYA 1W7JB 1CLBA 4Q7LA 1G8IA 2BHRA 5DO9A 3SOPA 3RS4A 3L2OB 4PAMA 4MUAA 1KKLA 4MZJA 1SK6D 2L5XB 2M9GA 1SPYA 1OE9B 4KLNA 1YUTA 3A4NA 3NKVA 3EA5A 4DJTA 5IDVA 1J70A 2OSBA 4I4LA 2H17A 4QNMA 3W5JA 2IXFA 3WHUB 5HE8A 5JSZB 5K8TA 1G3IA 3OFND 4JQ0D 3MSEB 3BUOB 3DZDA 2L4IA 5FBWB 3P1JA 2FFQA 4OBEA 1VIAA 1Z83A 2ATVA 3SIAA 3PQCA 1P2TA 4Q9KA 2CLCX 3QKTA 1U5IA 2ZRDA 3BIFA 5FOVA 1C4OA 1KAOA 1OIVA 5D3QA 1QVRA 2WJIA 2EWWA 5JS7A 1G3QA 1RW4A 2O52A 3KQKA 1KDRA 1YZNA 2JTZA 5H1YA 2ZJBA 3FVQA 2KFFA 1DJZA 2QSZA 4OK3A 1W7AA 3RC8A 4LZZA 3WNBA 4AKEA 2GGZA 1N0YA 1YU9A 3RLFA 2H61C 4N5XA 4D4MA 2RGCA 2ZTSA 2ZJYA 1COWA 1MXEA 3VKWA 2KFHA 3ZS8A 1JALA 5K8IA 4ASUA 1E3MA 3FOZA 1S4QA 2FE4A 1ZC3A 3UWOA 2HV8A 1Z28A 2KBMA 4D81A 1KK7Z 3MJHA 4Q03A 1X1SA 2WORA 4TLCA 4DIRA 4V0LA 1G7RA 4B2LA 3CM0A 4MDFA 1O87A 3R20A 4M2LA 1CLLA 3PEYA 3MWYW 2V9PA 3BWDD 4NL4H 5L3RA 4D4KA 4QM6A 5BN3A 1JPJA 4OHYA 1Y3AA 4A2QA 2FX3A 2MRDA 4CYMA 2R6CA 1QHXA 1OH8A 1IJ6A 1SL9A 1TN4A 3HX4A 3TR0A 4DEYA 5DI3B 1UUSA 2LE9B 4ETOA 2O60A 3EIQA 3ADCA 2QNRA 5AR1A 2QL6A 5M04A 1E2MA 3QSYA 2R8RA 5SZIA 1J99A 3H84A 3T34A 1I4TD 2PL3A 3GLHB 1T9HA 1TCFA 1BO6A 2IC5A 3SEAA 3CF6R 3FKSA 4DRWA 3EA0A 3X1XA 3ICQB 4B6EA 4M1MA 1DGUA 1M46A 2BBOA 1KTVA 1XJ0A 1OXSC 1IH0A 5F6TA 1EX7A 2K8MB 4NDDA 1MABB 3BJIC 5HCIA 4XWOA 3X1DA 4LCBA 4LBYA 3PUVA 1DT7B 3NBXX 2VEDA 4HZUA 3QXJA 1F4OA 3RAPR 4P4UA 3CGAA 1Z06A 1CKKA 2KAVA 2D7CA 2FPLA 1SY9A 2CE7A 1GL6A 1M8PA 2MSEB 1DJWA 3QQ5A 2KWIA 4Q19A 1CIPA 3HR7A 2QP9X 1KI2A 1E2QA 2M1UA 3SHFA 1CRPA 2AD5A 2NO1A 4D0GA 3G0HA 1KI7A 4FWTA 3CKLA 2H2KA 1B4CA 2GBLA 4PZZA 3VX3A 2MHHA 1E9SA 2A7QA 2EHBA 1G17A 4Q4HA 2GF0A 5ANRB 3T06B 2WOOA 1C1YA 1N6RA 3OHMB 1RIFA 3E2IA 4JMPA 4ZDIA 3KF9A 2DR3A 2C77A 2WPDA 4EKDA 2LVJA 1XU4A 5D3MB 3SBDA 4F91B 4TZ0A 3CX6A 1LINA 3O78A 4NYIQ 4ZO4A 2G77B 1FPWA 1J55A 2ZRGA 2KQYA 2BM0A 1E94E 4BY4A 2F2PA 4HB2A 3GJ4A 1OE0A 2W6JA 2ZANA 3MAAC 4D6PA 1QX7A 5DISB 3GP8A 2OCBA 2UVQA 4EAQA 3QKRA 1IJEA 5PALA 2ZI9A 2WMOB 1CTQA 4GAOA 3PUXA 4KSBA 1P72A 2KE5A 1TTTA 4BEBA 1NBMA 2RCNA 4CVNA 1G291 4I5JA 2LCFA 1ZOTB 4DB2A 1T0JB 3GK2A 2ECKA 2GA8A 2I4IA 5HLVA 3AV0B 5GQQC 4QGHA 1JJVA 2ZYVX 1DS6A 1JXMA 2OT3B 2BCAA 2BJWA 4LBVA 1QIWA 2QTVB 4B3XA 5DN6D 1WMSA 2ZVQX 1ZM4A 1N6KA 1Z6XA 3JZMA 1RRPA 1IN8A 5F2EA 3AF1A 1OB5A 1VYTA 2XNSA 1DJIA 5J3XA 3K0EA 3N70A 4Z1MA 3GMTA 5J47A 2ZRJA 2KI6C 3B1YA 3CBQA 1CM1A 5FTJA 1NMYA 1FL9A 3R8FA 2A5FA 2GCNA 2BEKA 3IBYA 3PR1A 5TV2A 2O8EA 3PENA 2QT0A 1W47A 2WZQA 3U4QB 3TUJC 2WOJA 1BYIA 4L4UA 4I1SA 1A4RA 4QKQA 1XCMA 3B1ZA 3KKPA 3NH9A 3CH4B 4M1OA 2O8DB 2FU5C 4JJKA 4A8JC 2KBIA 3RS5A 1IN6A 2YOHA 2HUPA 1QF9A 4R7ZA 5C46F 4MKFA 2VSOA 1NKTA 4C7OB 4YLGA 2PCLA 2OTGC 4LJ6A 2EC6C 4C0LA 4ZIRA 3KKMA 5E3HA 2GKSA 2LP3A 3ONWA 1ZM3A 3ZIAD 2ZIAA 3RM1A 2O0HA 5E7IA 2R6DA 1C7VA 2LM5A 1OQPA 3RANA 3VU9B 1YJ5A 2GF9A 4D1EA 5EXTA 4CEJA 2KGBC 2FGKA 5CSIA 4FIDA 2QROA 4LJAA 3I5GC 1Q20A 4XJXA 5KSPA 1VIYA 1U81A 5FBRB 4DKXA 4ZCIA 4GPTA 1G5TA 4MQBA 5FOWA 2AX4A 1S6JA 1DADA 1HEIA 2A78A 1NVXQ 1KK2A 4LHVA 4A8JB 2V7QA 1XFXO 1WDTA 5E95A 1S6CA 3KJGA 4AK9A 3EVVA 4LJ8A 1CFPA 5FBVB 3ZZUA 5J4LA 4C0KA 2BOVA 1NX0A 5AJWA 3B78A 2EC6B 4N1FA 2YV5A 3VR3A 4D4JA 5AJZA 1OH6A 1IY2A 4FMDF 3SJAA 3PLFB 2NO0A 3A8TA 2XNDD 4KBFA 4F4CA 1YRTB 1XFAA 2IHYA 3VRRA 1YZQA 4UJ5A 4AG6A 3BOWA 2X8AA 2YWGA 1VKJA 4EFNA 1KDTA 1G5PA 1RRGA 3BOSA 2NO7A 3I5GB 3IILA 4D80A 1P9NA 1U8AA 4P32A 3EPLA 3TH5A 3ADDA 1BT6A 3A6PC 1S5GZ 3WNCA 1RTP1 2O8CB 5DNYB 3U61B 4ABYA 5JJKA 1KJZA 4KAXA 1HH4A 2QORA 2ZSAA 3NSLA 1X1RA 4HLUA 4LRWA 2JT3A 1W46A 4PC3A 4AYWA 3GOFA 1AQUA 3LV8A 1G18A 3RS2A 4AIIA 2REBA 2JJ2D 4DRZA 1OLOA 1M45A 1ZNZA 4XVRA 1FP6A 1ZVQA 1S1CA 1S3GA 3VR2A 2KB0A 2JNXA 1YX8A 1AHRA 1PULA 1XA5A 2CT9A 1OXUA 3DKVA 1R0ZA 2P67A 4TYWA 5EE9A 1CEEA 4UNRA 5TY0A 2R6AA 1OOJA 3BH7A 1NN0A 1W5SA 4MRXA 2C78A 4NYJR 2R65A 3D0YA 3DM5A 3I3SR 2ZSFA 4KHZA 3AKYA 3SG3A 2ZQ5A 5EZ5A 5C2JB 3CIOA 1RFJA 2DWQA 2J3EA 2ZRCA 1FP7A 3ZWHA 3X2SA 2ZUDA 1U9IA 1SL8A 1S1EA 2CDNA 1BG1A 5JRJA 1CJMA 3B1WA 3GJ0A 5EP2A 1Z6YA 2DWOA 3DVMA 4DUGD 2OAQ1 2EGDA 1XFVO 2NCOA 1H4BA 3KXIA 3ZLJA 5I2OA 3GQBA 3PATA 4PSAA 1Z6GA 1F48A 2IF0A 2CCMA 1YR9A 2XOKA 4JBWA 2Q3MA 1JR3D 3T1QA 4M0LA 4HUQB 1B47A 4I99A 3UG6A 2GAOA 2B7CA 1G8GA 1XEXA 3BD9A 3GPLA 3D8BA 5L3SB 1E2FA 2AL7A 2LLUA 2ZROA 1NVVR 2CK3D 2GK7A 1LB1B 1TEXA 2EYQA 5LB2A 4DZZA 4RCYA 821PA 1G4YR 1JBAA 1BOFA 5KSOA 2QACA 1DGVA 3OP0A 4DDTA 2EW1A 3UG7A 3LCPC 2EQBA 5HZKA 1SXJD 3K21A 1M7BA 2IX3A 2IWHA 1GM5A 3FIAA 5G53C 2M7LA 3GLFB 2BKUA 3F0TA 3HDTA 4F0ZB 1R8SA 4M1SA 2VSFA 4Q18A 2ZJ2A 1ZUHA 1N6HA 1FQJA 4JKIA 2XSZA 3SU8A 3FHCB 1U0HC 4CFRA 4HDCA 1KI1A 1G4UR 2RKOA 1DAEA 3SJZA 1Z0IA 1M39A 1UWOA 5FH9A 4HB4A 3BQ3A 2PRUA 2FA9A 1W7IB 2F1JA 2WTUA 1TNQA 2LMTA 3WXMA 2YC4C 4QOSA 3BXKA 3MWKA 3CRQA 1YZKA 5CSJA 3Q3JB 1IN4A 2PX0A 3W3ZB 2GHIA 2ZRNA 5I2LA 5AEQA 1DVIA 2PMKA 1U8ZA 3GFPA 3NVAA 1QATA 4TLAA 3L0OA 4LI0A 4AKIA 3EXAA 1NKSA 5KSYA 1JB1A 4OQNA 2GXUA 4PO8A 2FEOA 721PA 3HPRA 2ORIA 4LJ5A 4DHEA 3IQOA 2Z4RA 3R7WB 1GGWA 1R2UA 4TLDA 4ESVA 2XB2A 4N1GA 1SKQA 1FUUA 4KVGA 4EPYA 5AUPB 1UHJA 4B32A 1DJHA 1U5IB 4Q4JA 1OFHA 4N0DA 5CM8B 3A4UB 1X02A 3CO5A 4MITA 3FWYA 1E1RD 2RGEA 3I92A 1EFTA 2GJSA 5DI3A 4E07A 5TDHA 1DARA 1SGWA 1W4CA 1ETUA 2G0TA 3PEUA 1B8CA 2QPAA 2Z43A 4RVCA 1JAHA 3AGPA 4WZBE 1RE0A 5GADl 2QMEA 1KO1A 2JEOA 4ZI3A 3WBJA 1K9PA 1WDCB 3VGOA 1WLZA 1M31A 2ASEA 4WZAE 5B58C 2IS1A 2ZE8A 4XH9B 1XRJA 3GLHA 3RWMB 3NSKA 1C9KA 5EQTA 3ZQ6A 5BN5A 2F9MA 3MSXA 2QPTA 1G7CA 4KITB 3TUYC 1JEEA 2QY9A 4UNQA 2XZPA 1IWQA 1PALA 2PMYA 1G3MA 1M7GA 3DPUA 4GMXA 3OX6A 4LYFA 2ZI5A 2W00A 3L0PA 2M7NA 1MABA 2VRWA 3AVQA 4LHZA 1WP9A 4CT4B 1XTKA 2R6FA 5HZHA 3LNCA 2CLDX 2BMEA 2FOLA 1SW8A 2QENA 2LP2A 4BFVA 1J8YF 4US0R 1LY1A 2LWIA 4DC9A 1AP4A 2P6BB 3BFKA 1XFWO 2I94A 2CCGA 4USLA 1Z63A 1T91A 1Q1QA 1RRFA 1S36A 2CBLA 3RABA 5FUXA 1XEWY 2X1VA 2GDJA 3OFNA 4LYJA 1OIWA 2J1LA 3VR5A 1DG3A 2E9SA 1R0XA 4TTRA 1OXVA 1P60A 1GAJA 2BMJA 1FI5A 1G21E 2WCFA 3E5HA 3UMFA 1UBGA 3DOFA 4ON9A 2YJTD 1IG5A 1JBKA 2WMNB 3T61A 3TUYB 4IVPA 2GBLC 3EPKA 2ZPTX 1PSRA 4LC0A 5JFGA 2F1HA 1A2XA 4MUBA 1WQ1R 2ODNA 5D3MA 4JLMA 3W3AA 2C5LA 1KNXA 2RGNC 4B2IA 1YX7A 3AP3A 5FOXA 2ZI3A 3HJNA 1OMDA 4DSUA 4YMVA 2QMHA 2JT0A 3C41J 4Q7KA 2K0JA 4IVQA 5L8VA 2ERYA 1VG0B 2A9KA 1YE8A 4MRPA 3BS4A 2JZIA 1E0JA 2GNOA 3F5FA 1CDLA 1A4PA 1NIJA 2RHMA 1MQ1A 3PUWA 3QXHA 4FCWA 4QGAA 5FL7D 1WY9A 1M34E 3ND8A 1FQKA 1XWIA 1JJ7A 2V54A 5J4VA 1J7RA 1KFXS 2CCJA 4CRWB 3CX7A 2WHXA 3EIHA 4O2LA 4BFWA 1EESA 1KI6A 3ZVLA 4TMTA 4NZYA 1K90D 4A4BA 4Q4HB 1OFUX 2R62A 4QFMA 4LBWA 2LMVA 3AKBA 4KJZA 4DXAA 1R7RA 1CRQA 4FWIB 4MZKA 3EZ9A 4LHYA 4PSKA 3VHXA 4P33A 2WJGA 3BE4A 4YI8A 2R6GA 1SKYE 4CFQA 2EFEB 2IYZA 1EG7A 4S2EA 1GRNA 2JIZD 2FDCA 2NO6A 3U4QA 1I4LD 5DKRA 3LVRE 3WMFA 2V55B 5JLJA 2AN9A 1ZNYA 2IYXA 4PQRA 1VDZA 2O8DA 2B1UA 1GDDA 1ZUIA 1X3SA 1Q1ZA 4LC1A 5GJCA 2ZITA 5BYJA 4X8OA 2KSPA 1DG1G 1E6CA 1TX4B 2HCBA 1CFFA 2VHUA 1DO0A 4JT4A 3TLXA 5P21A 3PJRA 4RZXA 1QIVA 2BWJA 2FCDA 4FQOA 2X2FA 4Q9LA 1G3UA 1PLJA 2KGRA 1FTSA 1BF5A 3KKNA 1AJEA 2JLVA 3DO6A 2KBEA 2WICA 1OFTA 1W2HA 2GAAA 1XPUA 4FMDB 4DDVA 1LF5A 2IA5A 4Q4LA 2OS8B 4WBSA 4OCIA 4JLKA 1XTSA 1L2OC 3K9LA 2C95A 1GIAA 2OCYC 3VU9A 4PHJA 2CXXA 3Q5EA 2GJKA 2QGNA 2SASA 2HLDD 4PHMA 4OJKA 1NUBA 2JC2A 3OB1B 3B1VA 1VHTA 4NBSA 2O8EB 3VRPA 3ZQJA 2LLTA 3AAKA 1BKDR 1G8HA 3JZAA 4P2YB 5HPYB 4V0MA 4BASA 3RS7A 4KLZA 2JQ6A 4B3GA 1YR8A 4RD0A 5IHPA 1E98A 4A4DA 5CB8A 3QG1A 1GNPA 5K8UA 4B34A 1Z47A 3OIUA 2BCJQ 3TQFA 1E0AA 1MRNA 4I81A 4M9QA 2ORWA 3OIYA 1P2UA 3CRW1 2Z0MA 5FTLA 3TUIC 1KNQA 5JCZA 4E03A 3ZNIA 4TQUS 4B6FA 5FTKA 1FW4A 1AJ5A 1G33A 1JC2A 1QHNA 3NHAA 1NPQA 2F3RA 4DLSA 1L2OB 4L9MA 5CLQA 1Q21A 2W0SA 1JXOA 4PO9A 3REFA 2MA2A 1HV8A 2ZRKA 3QVUA 1BODA 4OQLA 1SR6C 4NYJQ 4CGZA 4CZ2A 4LPKA 1NN3A 1GKYA 2ZI6A 4AQIA 4KSCA 1W0JD 4CEJB 2O8BA 5EP4A 2O8CA 5DN6A 1PK0D 4PAQA 1D2NA 3UWKA 3OB2B 5C4MA 5FUWA 4JS0A 3A8RA 3KEVA 3CNNA 4OI1A 2X19A 1S96A 3B9PA 2DB3A 1OIXA 2WAXA 2BKIB 4TTPA 4UNPA 3THYB 4AURA 3Q7QA 4OHWA 4E22A 4V0KA 3LVQE 2CMKA 2FEMA 2IYYA 5CSFA 1IONA 3W34A 3BUMB 1BMFD 1XJQA 1QV1A 3ZDQA 3BH0A 5DH9A 5FI0B 1MO6A 4L15A 3FMOB 2NGRA 2K2AA 2ZM5A 5B8IB 3A4MA 2J0QA 1D8TA 4IOLA 5EUMA 5FYXA 3CONA 1DMOA 5A5GA 4BFZA 5KO2A 3PFVA 1WRZA 1QVIZ 2PEYA 4NHOA 3EC1A 2JXCA 5LPNA 1KO8A 2JGNA 3KX2A 1SR6B 4Q00A 1NRJB 2WM9B 4TWZA 1NVVQ 1KO7A 2CBZA 1Z0AA 2ZAOA 1PUJA 2B92A 2BE6A 1TOPA 3FKQA 1ZINA 3LXRA 4GOJA 4Q01A 4XTRA 1E9RA 4ZCMA 2OG2A 3UPUA 5BW8A 2NOAA 2YINC 1JNYA 4ORBB 2NIPA 1XTQA 3ETLA 2HJGA 3EZ6A 2XTMA 4UNSA 1X8KA 3FGNA 3L0IB 1NLZA 4HAXA 4RD2A 5TARA 3SG2A 2IUUA 3I1FA 4YMWA 3ZIAA 3RWOA 5CK4A 3QXCA 2GTPA 4PR0A 2FCEA 3AQ4A 2WCEA 3WYAA 4YGCB 3PUZA 5ER4X 1UDXA 4JLDA 3K0FA 3W9YA 4DEXA 3GJ3A 4DLXA 3LK1A 1UM8A 2J45A 1IJ5A 3I72A 1HQVA 4QJ5B 1HURA 4AWXA 5L3SA 1Z0FA 2GZHA 2LUXA 1CR2A 1CTRA 1ONBA 1JUOA 1RJ9B 2ISDA 3EPHA 3PSRA 4Q1AA 1ZRHA 5CIQA 3RYTC 1TQ2A 1BIFA 2CNWD 1DOAA 4TMXA 3LRPA 1TNXA 3OAAD 2ZR7A 3Q7PA 3S1AA 3IBGA 1AVSA 1ZW6A 2LVIA 2LUCA 2AMIA 2FOTA 1RKBA 1V5WA 1E9BA 3CF2A 3K1JA 1MHOA 4LHWA 3GLFA 4R71A 1OB2A 5A0FA 1N5JA 2XNDA 1GRQA 1PJRA 3FPAA 1CDMA 4PFSA 5DYIA 5GVRA 3SDZA 3EARA 1XMIA 4YMSA 3DM9B 4DUQA 4BLRA 3ZVRA 1Z5ZA 2JDID 3CX8A 1QVAA 1BH2A 2AUCA 2NCPA 3W5IA 1RK9A 1A75A 2FJUA 2IYSA 3UKDA 2WCBA 1XEXB 1FPMA 1AQYA 4EDHA 2N1BA 5EP3A 1MO5A 4P31A 3EG5A 3LH5A 3PFIA 1E9AA 1UKYA 2O0KA 3AF0A 4CEHA 1E32A 1WA5A 4FMCF 1PRWA 4LJYA 2JJ2A 4NTZA 5GVSA 2EU8A 5EUQB 2A2ZA 4OV2A 1TF5A 1NBME 3NEJA 5EXPA 4NDCA 4HAWA 3TKLA 4RD6A 3R7WA 2LCPA 1CFCA 1EK0A 4HUTA 1OMVA 2JLZA 1GUAA 4KU4A 3I5IC 3SJSA 2M3WA 4DDWA 4MA4A 3CS1A 4M4SA 3U7EB 1NX1A 1OT3A 2JLRA 4KFUA 3P27A 4HI0E 1CXZA 1E2NA 5LDDC 5JOLA 3LLEA 1PSBA 3EVUA 1IJFA 1MOZA 4A0RA 5BPJA 1XTIA 5LB4A 1SCVA 1H8ED 4YQFA 1A2KC 1NG1A 1J1DA 2X77A 4DUGA 5KHOC 2PSRA 1E2IA 4KCGA 2IYWA 3VNVA 1W5TA 5BYKA 3FWCA 2VSXA 5K8LA 3ZGXA 1B7TY 3I5HB 4IXMA 1Y1UA 4UJ3A 2QQEA 1S6IA 2O8FA 2IK8A 2CLSA 1MR3F 3RNLA 3VR6A 1V43A 3KQNA 2L51A 1UHKA 2P6NA 5CJ2A 2HETA 1KKMA 1XXHB 3LWNA 1DELA 2VL7A 1V1GA 2L50A 3SYNA 4V0NA 3NTUA 3I5IB 3LX5A 1SVMA 1X8JA 2CK3A 4GGFA 2FPKA 5G40A 4YRUA 1JSAA 3CRMA 4Q9JA 1MO3A 5DI9A 1UKZA 5HLOA 1YRAA 2EVWX 4PHGA 4UPGA 3TSZA 4LV6A 3WP1B 4O3MA 1P75A 4Q4JB 3E70C 3BXZA 3K0CC 3FMPB 3QXSA 2QM8A 3JVTC 1SXJA 2LVVA 2FF7A 1NI3A 1BS1A 2E87A 3QOFA 2VTKA 3DVLA 1N0UA 3SJBA 3UMRA 2Y5IA 1DO2A 2RAPA 4B3FX 1X8LA 3ECCA 3VROA 2H1LA 1QHSA 3CRVA 3GJXC 1XCGB 4CIDA 3TDIA 2GVZC 4Q1CA 3WHTB 3RS0A 4GGNA 2EFHB 2CNPA 5JEDA 2FGJA 3GD7A 3ZJYA 2QBYB 4IL1A 5FTMA 3JTDB 3NXAA 5D7FA 2B21A 2W6ID 2WJHA 3QF4B 5TB5A 3SNHA 5AJYA 4YXWD 5KPJA 1VPLA 3CZQA 2A3RA 3O8DA 3VQTA 4OL0A 3D3QA 3KPXA 3JVTB 3DMDA 2CL0X 3K9GA 3RRYA 5JWOA 5C1BA 2KSQA 1F60A 5CDFA 2QTHA 4GMDA 2VP6A 3CR5X 1WRLA 3QKSB 3WHKA 4MYUA 3FB4A 3REGA 1G8PA 4M53A 1SYMA 4DBLC 1AS3A 1G20E 1RROA 3VNUA 2BDTA 2I1VB 1YVLA 2IYRA 4TLBA 3TS5B 3F8TA 3P20A 4LPSA 3T1VA 4C30A 1HTWA 4G5SA 3P32A 1QV0A 3I8XA 2XJ9A 4PXAA 2WKPA 4C0JA 4Q47A 3R9XA 2RGNA 4RFVA 1JFJA 1E1RA 2AKAB 4FMBB 2JNFA 4CLNA 1EH2A 1EX6A 1UHIA 4G0NA 1KAGA 1R5BA 1K93D 3D31A 1WXQA 3WXAA 1SVWA 2H8KA 2O5GA 1KSGA 4PZYA 2VP5A 1IHUA 2G0NA 4LYAA 2KBFA 4LHXA 4AQJA 4WQ3A 1LNZA 2KI4B 1KJWA 4MBEA 5HTKA 2OAP1 4RD3A 1TQDA 4ORCB 1NF3A 1Z22A 3ZS9A 1IRJA 4TN1A 1VCOA 1T5IA 1XZQA 5FPTA 2IYQA 1DAGA 4XIGS 4KFSA 2YKGA 1F71A 3BC1A 4JLJA 2FSIA 1M6NA 4F92B 3U6KA 1KI6B 3LXXA 1MXLC 521PA 4TZ6A 4PHHA 2ZNDA 3BAFA 1NP6A 4TYQA 1VRKA 2ZE5A 3X1WA 4GP7A 2QT1A 1CJTC 3KO0A 4B3DA 1KIMA 1G16A 3SC3A 3SE0A 6Q21A 4PHKA 1YURA 1AS2A 5CK5A 1N65A 3QF7A 4C2UA 2GETA 5I2QA 4JLPA 2B7BA 4U00A 1W48A 4ARZB 1AJ4A 1VECA 1XFZO 3IQWA 1CDPA 5KSZA 1OH5A 5IBWA 2Z4SA 1ZM7A 4TQAA 3EAQA 4A15A 3QEOA 4MYCA 1GFIA 2DCUA 1ESNA 4NCNA 3FMIA 1P62B 1TAGA 4DLUA 1D2MA 5FOTA 2QMOA 1AKEA 1YR7A 4DIDA 2YWHA 3HWSA 4PZLA 1XFUO 2RGIA 1ZU4A 1KCYA 1GITA 4JT2A 3AP1A 4M2QA 5FL7A 4JVNA 5JJIA 621PA 4G5GA 4FI3C 2ZSEA 2QA5A 4M1YA 1N0VC 1DVRA 1L2TA 1T8TA 2Z6VA 2GWHA 4URYR 3GEIA 2EFGA 3OZXA 2QQ0A 2D2FA 1QHHB 2ZS9A 3QI2A 1S0UA 2MMGA 2OUKA 2BCXA 4O2RA 4QGGA 1K2HA 2XEXA 3RVBA 4DCVA 1ALVA 1KK8C 1AZSC 3KDSE 3A1VA 4A92A 2F43B 4RSGA 4EIWA 4BWYA 3NSIA 4L16A 1QG4A 4FCTA 1R0WA 1HYQA 3K0SA 2I18A 2WV9A 3THYA 2A5DA 4D0NA 1ANKA 1HE1C 3CPHA 2OM2A 2QGZA 3MMPA 5JCPA 4ZCUA 3WMEA 1CFDA 3P4XA 1TF7A 2JIZA 4M1TA 5LD2C 2ZREA 5J4YA 4JKYA 1RC8A 4M1WA 4TL7A 1LXFC 1EFRD 1I4DD 1N5IA 2NG1A 1YTZC 2YVUA 4IDHA 2P65A 1ZJ6A 4G5RA 5FUVA 4B76A 1MWNA 3IUYA 3BGWA 2BIFA 4KVAA 5FI1B 5J4HA 1IXRC 1XK4A 1Z29A 4QBGB 3OEHD 1HQYE 2VP2A 2GK6A 1W36D 1P9RA 2OBMA 3IO5A 2WSSD 3G5UA 4H1VA 4AD8A 1KK8B 1S3PA 1Z0DA 4JLBA 4RD4A 2O8BB 1KFUS 1CLUA 4XVQA 2XXAA 2ZJ8A 3RSLA 2PX3A 1SVSA 1T5LA 4NCHA 3QKUA 4LSGA 1VCIA 2GVDC 3K70D 3LDAA 1KSFX 2IUSA 2ZYUX 2J0SA 1LTQA 3MCAA 1K95A 2J41A 3GLHE 3EKHA 2FV8A 4BLQA 1KOFA 2OPOA 1S8FA 2A5JA 4K81B 5LD2B 2HLDA 2ZN9A 1RPZA 2PLRA 4WQ2A 4QJ5A 1TCOB 1VG8A 2ZRFA 1RJ9A 1CP2A 1QX5B 1SMGA 3IHWA 4IVRA 2P6UA 1P61B 2IXGA 4HAYA 4OQMA 4XYNA 4PCWA 1Q1BA 2FNAA 1FNNA 3I73A 2B6HA 3RRNA 3W8RA 4TMVA 8OHMA 2H18A 4QL3A 2LAPA 4GRAA 4F7WA 4AKGA 4D4LA 1FW6A 3RLZA 1QG2A 4LV8B 3KKQA 3TDZA 1AGPA 4Q1FA 4TT3D 3SR0A 1WBBA 1ZIPA 4L9WA 1GNQA 5CPVA 1E2KA 1SCMB 2V6JA 3BFVA 4MRVA 2D7DA 5DSZA 2VHQA 1DAKA 1K8RA 1TPZA 1XO5A 2BKEA 2DFTA 2ZJZA 4JYCA 2GJ9A 4KI0A 2D4HA 1DJXA 1NL3A 1L4YA 3C16C 3U7FB 1DAMA 2PT7A 4UXJA 3RS3A 3FFAA 2WWFA 1UBFA 2CL6X 2J7PD 2DWPA 2F3YA 3AVYA 3SJCA 1UPTA 3K0FB 2JPTA 3I61A 3ZVNA 1W4RA 2C9OA 2QAGB 5JBQA 2Y1MA 4DCTA 1W0JA 4EPRA 4NP6A 3U2QA 3GK4X 1CF4A 1NJFA 3GFTA 3MJRA 3U3JA 1ZM9A 2G1KA 4CF7A 3ZH9B 1UHHA 2VRGA 1F6BA 3TUZC 3L8ZA 4QGFA 4FXPA 1K94A 4A0FA 3CR4X 3L0SA 4GZMA 2WSMA 3M4YA 3GLIA 1ZD8A 2OHFA 3S1AB 1BMFA 1NX2A 3BK7A 3K0AB 2L0PA 3TMKA 2VO1A 4OI0A 3VHLB 1N6OA 5CLLA 4DLTA 5TMPA 4BLPA 3UMSA 2VP9A 3GLGB 2RGXA 1SHKA 1KHTA 4OYHA 3ZYCA 1II8B 1JF0A 3GJ5A 1N6PA 4WOPA 4ESHA 2GCPA 2ZETA 3LQQA 2GGMA 3KHEA 2BL0C 2WVJA 1NY5A 3MFYA 5JI2E 2F2OA 2GXQA 3T35A 2Y4QA 1A75B 1GGZA 1TNWA 2FJUB 3BYAA 1XP8A 3SFVA 1Z2CA 1NIPA 2DY1A 2IYTA 2ZI4A 3FYHA 4KBGA 1JEDA 3WNDA 4B71A 4W7SA 2A5YB 2LKDA 3IPXA 4QBFA 4CEHB 3QIAA 4BFTA 1WDCC 2L0XA 4M9XA 4Y0VA 2L4HA 5AJVB 4C0AC 2HQWA 3NDBB 2OLKA 3RHFA 2ZAMA 3TJZA 1MUXA 1UAAA 4PHTA 1AS0A 3FWBA 4PTLA 1XXHA 4US1R 2VPPA 4ITRC 4X8MA 3ICEA 4GL2A 5CYPA 3ZD6A 2OBLA 2C04A 3KL4A 4I5KA 4DDUA 1ZCAA 1T0HB 5DIFA 1DE0A 2FFHA 2WJJA 2CNWA 1E8AA 2ZJ5A 4GGFC 2BL0B 3SN6A 4R2IA 2MMCA 3KJEA 2QP3A 4RD1A 3A1UA 3OAAA 2P0EA 1DF0B 2L2EA 3H4SE 4NH0A 1D1OA 5JHGB 1J2JA 1CR1A 2BM1A 5HKKD 4JLVA 2ZYWX 1QASA 1SXJC 3BB3A 5KNDA 4LGMA 1SVIA 5F98A 1YR6A 3CW2A 5G3ZA 5B30A 2G6BA 2DBYA 4V03A 3CWZA 2WWWA 1ZIOA 3CR8A 1ZP6A 3M1IA 4ZCVA 1KWOB 5HKYA 4JVMA 5SZKB 1FX0A 3P26A 5FPYA 2VHJA 1GWNA 4B3BA 4DLZA 3L82B 2H7VA 3SS8A 2HXYA 1KFUL 2JJ1A 2DFLA 1OF1A 2JDIA 2WWHA 4HB0A 4V0ME 2QPOA 2NPFA 4DCSA 2O8FB 3MUFA 2Q9BA 3AEZA 3MWLA 2ZUCA 1EL4A 3W6OA 1KGDA 3GJ6A 5KDOA 2GXAA 2GXSA 4DSNA 2PLFA 3QF4A 2CL7X 2XTNA 3K0CA 2JASA 2COLB 1A2BA 2P5TB 3QPUA 2WKQA 2UZ3A 4JSYA 4GNKB 4R98A 2H57A 1G6HA 1SXJB 4C2TA 1K6MA 1E2HA 1K5GA 3QKSA 2OZEA 2RGBA 4OI2A 3SG4A 1YQTA 1M1YE 1DEKA 1SVKA 3D10A 5E7JA 1XEFA 3TBKA 1E2DA 1BLQA 4U02A 1II0A 3W8NA 1ZACA 5HYDA 1YZGA 3BERA 2GV5A 3QPWA 3HYTA 2AD1A 2YWFA 4B75A 2BECA 2AAOA 1N6IA 2D62A 4IXNA 4MSPA 5H68A 4IW3B 3TIFA 3DVJA 3T1TA 3LFUA 1FF1A 2DFKB 2BBSA 3HCMA 1G3RA 4RFSB 1H8EA 3DZ8A 4YMTA 2KJQA 4MRNA 1PVBA 4DLVA 1R2QA 2WIAA 4OHVA 3D7MA 2ZRSA 2PBRA 4QC2A 3CRRA 2ONKA 3NIBA 1QRAA 1R10A 2ZYTX 4NONA 1MR8A 3EWSA 3RC3A 3SZRA 2QZ4A 4ORAB 1RVDA 2XGJA 4JL5A 4XVUA 2KDHA 1CULC 4J0QA 3WP0A 4RKFA 1GQMA 1P6XA 2YHSA 4JZKA 1MO4A 3AKDA 2J87A 3NH6A 1BU3A 1ZD1A 2RGDA 5BXQC 4M8NE 1U98A 2F3ZA 4Q02A 5FR2A 1VTKA 4G5QA 1M2OB 3DKPA 1XNJA 1KK1A 3AUXA 1ZNWA 4N3NA 1E99A 3TSOA 1CKEA 3B13B 1E9FA 1XEWX 1SVOA 5HKWA 1J7OA 3UIEA 4URXR 4AYTA 2OS8C 1KYIA 3B85A 4NU0A 5BN4A 5KTYA 4AG5A 2PVBA 1A82A 2G83A 4W5WA 1QLKA 4GOKA 3LY5A 1Y63A 4ARZA 3KQUA 4TNCA 1I2MA 3NBYC 3RRMA 2OLJA 1F4QA 1J1EA 4AC9A 3QXXA 1NCZA 2HT6A 3GJ8A 4LV5B 4Q5IA 4IEEA 1PLKA 4ILEA 5CYOA 2AFIE 3PEVA 4LOAA 1E79D 4A9AA 2WWIA 3PIRA 2RHDA 2ZSDA 2W6IA 1ZUZA 3GEEA 4M9ZA 4YXWA 4YMUA 2HJVA 5FPSA 1RZ3A 4EPXA 3THWB 1MH1A 4DCUA 5AANA 3GLFE 4BY5A 1XCPA 2K7OA 4DS7A 4LUCA 3FDIA 1G41A 2W2VA 1LFDB 4TMKA 2BBMA 3C14C 4EFMA 4B44A 5FL3A 4I1OA 3R9IA 4Z51A 4YONB 1NP8A 2YOGA 1NIWA 1VCNA 4P5OE 2CEAA 3V4RA 4YDSA 1IXSB 2ZE6A 2W58A 1QHHA 2EYUA 2ODWA 1NCXA 1GOTA 5JHHB 3EZ2A 2M49B 4FTGA 1E2GA 4RKEA 4LBZA 3C1VA 3FFBA 2F43A 4K8OA 2PALA 1A7JA 3A1SA 4MGZR 1HT9A 4O0MA 3Q9LA 4GFTA 1QDEA 4MRSA 4A2WA 2ANCA 1CR0A 2LLSA 2DHRA 1XDBA 3QUSA 1JFKA 2IHBA 3UATA 1XFYO 5F3WB 3FMFA 1XTRA 1Z6TA 1JI0A 2YWEA 3AKCA 1YRUB 1GP2A 4KODA 4Q48A 4KYUA 1N5KA 5CB6A 1KY3A 4Q7MB 2M97A 2W2XA 4NKRA 3VRNA 2K61A 1NMXA 2CHGA 3IPYA 1ALWA 2ZXUA 4AY2A 2Y1NA 1YZTA 4TMWA 4BFUA 4DVGA 4LYHA 5ELXA 4B43A 1QHIA 2OESA 2IUTA 3EASA 1ODFA 1U8YA 1KSJA 4NMMA 4PHFA 4TQ9A 3K8YA 4K46A 1ZCBA 2PASA 4NE2A 4FCVA 2QM7A 5CJPA 3V4FA 1TMKA 4E5UA 1TRFA 1XK4C 1QX2A 1DAFA 3KZ1E 2LHIA 2HCJB 4FW9A 5JWHA 3LK0A 3ICBA 3TE6A 2EWVA 1Q3HA 2LNKA 2NXQA 2IT1A 3DVKA 1OHHD 1ZFSA 1FI6A 1OPXA 4TSFD 5HCNA 3U3RA 4A82A 1J7QA 1IY1A 4DLYA 1BR1B 1EG3A 2YC2C 3KJIA 4GDFA 1QJTA 5BWMA 1R5NA 2JWWA 4JL6A 3NEYA 3EK4A 4R2HA 1Q3TA 1N2DA 1Q80A 1TU3A 2BJVA 1OXTA 2HYDA 3CLVA 4IDNA 4W5HA 3VMFA 4KFTA 1EJ3A 4UKDA 3A1TA 5J40A 3EK7A 3QEJA 4P4SA 2WWYA 1SULA 2F33A 2JA1A 4X8HA 1W1WA 1L8QA 2IWRA 4XD7D 1XMSA 3K09C 4MRRA 2MJWB 3SI7A 5TNCA 1SXJE 2QAJA 4GBMA 2H16A 4WA7A 2V3CC 5KNBA 4JPZB 2C9CA 5CITA 4HSZA 4JLNA 2XXAB 2QN6A 1AKYA 4BLSA 1KFXL 2NZ0A 2RGGA 4ZI2A 1GZSA 4IOKA 5KDDA 1U99A 3B6EA 2JAQA 1MT0A 4ZV4A 1KZGB 3AVUA 4PANA 4F38A 1US8B 3H0KA 2CE2X 1P4SA 1X6VA 4LJ9A 4TL6A 3LW7A 3K53A 2QAGA 2XITA 2P6RA 3BUNB 3EIEA 1FNMA 1TEVA 1YR5A 2NQ2C 1R4AA 3F45A 2QG6A 3Q5DA 4PPNA 4WXRA 4AOMA 3TR5A 4ERNA 2KYCA 2VQSA 2IS6A 2E30A 5L3QA 2VBCA 4IEIA 5KNCA 4IJMA 2CXJA 4QJ4B 2DPXA 3DMNA 1ZD9A 5EE5B 3AVOA 2E1RA 2LC5A 1EGAA 1ESMA 2D06A 3CNLA 4DLWA 1H8BA 3K0AA 5GJBA 5CDFE 4JYBA 4GBAA 4E68A 1AN0A 1B0UA 2ZS7A 4PO1A 4MKGA 1OZOA 2W2TA 4LDJA 4M9SA 3GLGA 3DEFA 1EFRA 2J0VA 2IYUA 3CB4A 3ADKA 3T5DA 1II8A 1E69A 3TW8B 1GJYA 4DCKA 5G41A 1XYDA 3C15C 3IO3A 1BR4B 3A1WA 1S9HA 4TMZA 3ZZ0A 4YGDB 1AK8A 3OEHA 1XX6A 2DYKA 3WBKA 1NX3A 3PN7C 3Q8XB 2DFNA 2QRNA 3TRFA 3VX4A 3TVTA 2LANA 4UNNA 3THXA 4NCJA 4A4CA 1GL7A 3KJHA 2KQ6A 4Q4AA 1B8RA 4OJQA 2PZEA 3B8HA 2ZRMA 1M63B 3MG9A 1OKKD 4RZ2A 1IY0A 2Y8EA 1XF9A 1E0SA 1F2UA 4WVFA 1RRCA 3EWAA 3I5HC 1XD2A 2CHQA 1NMZA 3T15A 3GLIB 4OQFA 2D2EA 3PG5A 3W90A 4EPWA 2W83A 4MN0A 2QSYA 3VTKA 1DPFA 3EVRA 4QJ3B 3KXLA 1VG9B 4KV9A 3AVXA 1NWDA 3IEUA 4HREE 2GESA 2F1RA 2OBNA 2AK2A 3OEED 1U0LA 2QP4A 2JRFA 3F3YA 5L3QB 2F55A 1DF0A 4YBHB 3AUYA 2SHKA 3PN7B 4TT3A 4CT5A 4GOXA 4ZDKA 4PX9A 5TVKA 2AWOA 4EQ6B 2ZNEA 2C2HA 1J7KA 2VP0A 4ACAA 4CPVA 2XAUA 3QNUA 4JBYA 1NNEA 2BC9A 3TK1A 4IHQA 1I2DA 5DE3A 1KMHB 1VG1A 4Q1BA 3ZD7A 2J7PA 2C99A 1VCMA 3NHBA 1EWRA 3WRYC 4MGKR 1A29A 1DTSA 1JR3A 3CPJB 3O8BA 2Q91A 3I5FC 3Q72A 4IDOA 4QHTA 4NYMR 1IOZA 4NDZA 1GG2A 4AKHA 4US2R 3NC1C 4X8LA 3K9NA 4PE1A 1Q57A 1U90A 2OXRA 2ZJOA 2HQ8A 3U3OA 3AKEA 3JTDC 4UQOA 2FSHA 4MGYR 4ZKDA 1E4VA 2WIBA 4A0HA 1FBVA 3LX8A 2ZRPA 2WNDA 1HY3A 4GNKA 3SYLA 1CMFA 4HAUA 2JOJA 1GILA 1OXXK 3BB4A 5GJWC 4BLTA 1P7CA 4I1UA 1G19A 1G64A 421PA 5DKNA 4OVNF 5AUQA 4EJSA 3FE2A 1IQ3A 2PMDA 2VHCA 1N6LA 1CJUC 2IXEA 5EXSA 5JRZA 3AP2A 2IS4A 1QBKC 2YZ2A 2JCSA 4GI7A 3TS5C 1FX0B 2VH5R 2WKRA 1FMLA 2ZR9A 3I5FB 1T8UA 1C7WA 1R6BX 4NCKA 1WE2A 5B2ZA 4XSHA 1D2EA 5FPKA 4QHSA 4BPBA 1JF2A 4RFSA 3GFOA 4HAZA 1S1MA 3DL0A 1LA0A 1NVUQ 2A30A 2RGAA 4D0LB 3CZTX 3PV0A 1ZUNB 2ZRBA 4MYTA 1UKEA 4POAA 3B60A 3U44B 1ODBA 3A4LA 1CB1A 4U8DA 2IBMA 1Z0KA 4BFYA 5AFPA 1UEIA 2FZLA 3FHTA 3WY9A 1UURA 4F4IA 1TIZA 1P2VA 2PH1A 4MH0R 1H8HD 3OESA 1JPNA 3SQXA 1ZNXA 4TL9A 3TSWA 1NSTA 1D6JA 2QMUA 3KXKA 4OHXA 3WRXC 4TTQA 3SG5A 2KI4C 3IQQA 3CR2A 1CS4C 4MEWA 4MLWA 2DOQA 4WRIA 3WNXB 1UFQA 2CJWB 2HF8A 2ATXA 1HT1E 1UJ2A 2JLSA 2I2RE 4JWQA 2R9VA 4LX0A 4CW7A 2P5SA 4PQFA 5B57C 5I8NA 3GJ7A 5FOUA 3I5XA 3I5YA 1W0KD 3IKJA 3OX5A 4PC1A 2UZIR 1GKUB 1LF0A 4RCZA 4JBXA 3O8CA 1KQVA 3NBZC 3PCRB 4I5LB 3I4LA 1W49A 3OE7D 3VKGA 1F5NA 5DHAA 3D6TB 1IN5A 2FN4A 5AK0A 3W6NA 3WYFA 5HKKA 5SZJA 3PEWA 2GEDA 2ZFDA 4MRYA 4YI9A 3KFXA 4OQXA 2KI6D 5EP1A 2J46A 3LA6A 4EFLA 3M0WA 1F55A 5C4GB 1NYAA 2F9LA 2ZRAA 4GZLA 1KI9A 1JWDA 1DBSA 2ZRHA 221PA 1EFHA 3SYKA 4B35A 2G2BA 1O3YA 1K8UA 3M0EA 1U2RA 1AZTA 2BMFA 3VR1A 5JEEA 1E0KA 1G7TA 2M29A 1EG4A 3PM8A 2AR7A 4LK2A 2J5XA 3THOA 1IGVA 1ZC4A 2H92A 5IK2D 1GSIA 2V6IA 2QU8A 1E2EA 4PE0A 5SZHB 1YUSA 1TADA 1X86B 2GJAA 3ASZA 4C4PA 4DLRA 5JS8A 3THWA 1CBUA 3K9HA 3FTQA 3I8SA 2D8NA 3IGFA 1EXMA 1G8FA 4MKIA 4HLDA 4XWAA 1A5TA 3EW9A 2WWXA 5J5CA 2BV3A 1FOEB 1OFIA 1IQPA 4L8GA 2BEJA 2C9YA 4WIAA 4TYNA 2XX3A 3C5CA 4PPQA 3PXGA 3LQRA 1A1VA 3SIBA 3LBIA 3R9WA 2WAYA 2PZGA 1G7SA 2CVFA 4PDZA 5JWRA 1E96A 1PVAA 3AF4A 3UK6A 4BRUA 2ANBA 2GCOA 1TNPA 3A36A 4Q21A 1XVJA 4QBHA 4B73A 1OSAA 1Y1AA 2HPSA 1QHGA 4IOJA 3SG7A 3PITA 1TF2A 4XJKB 3B9QA 3H1TA 4QM7A 2B8WA 2MAZA 1GTVA 3Q85A 2KHNA 2AHOA 3CZPA 1FUKA 3GLIE 4OKHA 3EZFA 4C0BA 1UBEA 3JVVA 2JATA 4A6XA 4QNRA 5FBLB 5FPHA 4KXFB 3EPJA 2ZEJA 1XPOA 4KYIB 2IEZA 2MBXA 1FFHA 1S26D 1KK3A 1CMGA 1L7ZA 1UEJA 2Q9CA 2FFAA 4II7A 2WOSA 5FBQB 2OEPA 3G82C 2EFCB 1LVGA 3GCGA 3DDCA 2G88A 3B1XA 3MRSA 4Z8YA 1Q1EA 2LVKA 3SQWA 2OO7A 4Q1EA 4RY2A 3VKHA 2IW3A 2ZN8A 1OZSA 3EK8A 2G1JA 2X2EA 1F8HA 4JL8A 4H9GA 1K96A 1KSOA 1BOCA 3KFVA 4HYYA 4HLCA 1D5CA 2PCJA 2JLWA 5J4KA 1QZXA 4XSGA 4BZXA 4AYXA 4PC7A 5KUTA 1K5DA 1YVDA 3E1SA 1YKSA 5HR5A 4LWZA 4ACBA 3TGPA 3BUWB 1TQ4A 1XXHE 1WRKA 1LV7A 4JJZA 5UKDA 1KO5A 4CEIB 4JIMA 1E1QD 4QHYA 2IL1A 1XTJA 3NG1A 2GEUA 4ZPXA 2Q0HA 4BECA 4A36A 4Q7JB 3ZVMA 2KYFA 4QBIA 2NZ8A 2HF9A 5ER5A 1IBRA 2NO9A 3QY0A 1GVNB 3QG5A 3BH6A 1E79A 1KMQA 1Q0UA 2KOTA 2I1QA 2ONJA 5BQ5A 3AM1A 1NN5A 1Z08A 4B2PA 4PAOA 3KKOA 3BRWD 1E4YA 1QVIY 2F3TA 4P4TA 1UP5A 3KTAB 4Q1DA 5C18A 3UXMA 1SCMC 4Q04A 4JSTA 2OTGB 1K9UA 3BBPA 1NCYA 4C0QC 4KFRA 1Y6WA 2WJYA 1US8A 4HSEA 2ZI7A 2M8UA 2ODEA 2ZRIA 5DGXA 1KJYA 2KAYA 3NXSA 3HR8A 2NMVA 2QBYA 1R5OA 2EFDB 1ELOA 2QAGC 4XOIA 2V53A 3ADBA 2QE7D 4N1AA 5KU1A 1MRSA 1OV4A 3U6BA 4TYPA 1R8QA 2R44A 5FFMA 3IHLA 1ZAKA 2FWRA 4ZKEA 2JXLA 1PLLA 2KAXA 4YC7A 4QJ4A 3K09A 2O0JA 3IIJA 4P4SB 5EZ6B 3WYGA 1E2JA 1ZMXA 2D74A 4IKEA 5KYKA 5IRCD 4DT1B 1Q12A 1RYFA 2MSCB 1AA9A 4FMCB 2ZE7A 3B5JA 3O8RA 1PV4A 2ZS8A 4FINA 4WXPA 4I1VA 4EPVA 3SG6A 4OK5A 3GEHA 3EC2A 4PPFA 3SFZA 2BBWA 2Z5FA 3IIKA 1NG9A 4WW0A 1LW7A 4G3XA 2JTTA 1YVHA 4GUKA 1MV5A 1G9XA 3V00A 1SQ5A 1BJFA 1RJVA 3L8YA 3QENA 3CWGA 1M7HA 2J0UB 2Q3FA 2WBLC 4HB3A 4B33A 3U60B 3BUXB 3MGCA 1XBTA 1J90A 4BFSA 2YYZA 3A58B 1Z6AA 1KK0A 4B47A 2JLXA 2QTFA 4TLEA 5KOYA 1W4BA 3AH8A 1NSFA 2GEVA 4HRHA 1W36C 1E9EA 1KZ7B 2ORVA 2R2AA 2IS9A 2ZVPX 4RZUA 1OHHA 3CTNA 4TSFA 5EXXA 4C3ZA 1C07A 1B8LA 1LVCD 1T4GA 3NWJA 4P3YA 4S35A 2GZDA 1SL7A 4YGEB 2A5GA 5G3YA 1Z3IX 1G1MA 1KY2A 1RFLA 1Z07A 2F8PA 1COWD 4RJLA 2QI9C 3H86A 3K70C 121PA 2IS2A 1ZYUA 3N5CA 1F2TA 4ASUD 4MVFA 4Q66C 1CLMA 5EE1A 4CDGA 3U7GA 1P3JA 3DF0A 1KSHA 3AF3A 3HU1A 1GL9B 1SKYB 5FOSA 4OHZA 2G9BA 4M2OA 3U3KA 4QJ3A 3LO5A 2KFGA 3CNOA 4NYMQ 2Q3HA 1S9DA 2ZUBA 1F54A 1NLYA 2MLEC 2ZRLA 3MD0A 3UANA 5JZVA 1S2MA 1AK2A 2Q21A 1NLFA 1QS7A 1II9A 1HA3A 3OIVA 4XD7A 3AGQA 1Q44A 5H8WA 2K7BA 2F7SA 5HKZA 1J7PA 4LJ4A 3U3MA 4EQ6A 1W36B 4Q9IA 4PE7A 1XJCA 3DOEA 1IM2A 4BQSA 5JSZA 1EXRA 1YUUA 2OFWA 2HT1A 3THXB 1E2PA 4Q4AB 4A0GA 2GZAA 2FSGA 2FSFA 3K70B 1KMHA 4D26A 1KWOC 1G4AE 1YRBA 1LS1A 4FD2A 3QRXA 3IEVA 1F2UB 1XD8A 4BEJA 3CWQA 5AWFC 4JVLA 1XD2B 4MDEA 1R0YA 2GJ8A 1AM4D 2JLQA 3N2IA 3ZZTA 2YOFA 2D3WA 3NBFA 4XTCS 3HP1A 3FKSD 1IQ5A 1SKTA 3HU2A 3M6AA 3U7HB 5A4JA 2NTYC 4MYHA 4Y0AA 1K9KA 4PC6A 2GILA 4PE4A 1KI4A 5KDLA 1XPRA 3LLMA 3BFXA 4UXIA 1KK7Y 2ZU0C 4ICBA 1TUEA 2UKDA 4C0HA 4R9UC 4BFXA 2AXPA 1CU1A 4IDPA 5JMTA 1OJLA 1YZLA 4TL8A 4D82A 3AVPA 4AI6A 4B48A 4F4JA 1KI3A 2FH5B 4PSVA 2HEIA 3CH5A 3EX7C 3NDPA 2V1XA 2W0MA 1WLMA 2K7DA 4EJSC 3PUYA 1N5LA 1W44A 2VHTA 1ZMZA 3TQCA 1HT2E 1KQMC 4OKSA 2FMXA 2XZLA 1IAQA 4XWKA 3SHWA 2YNMA 3C5HA 4Z8XA 3P4YA 3V9PA 2RB4A 4D25A 1NJGA 3QBTA 1FZQA 4DSOA 3QJYA 2WPDD 1Q22A 2WJVA 5D69A 2JJ8A 1JQLB 3U44A 2H61A 1T3LA 1W2GA 1HE8B 3I32A 1B7TZ 1EFCA 4GT1A 1OKKA 1VYVA 3RSOA 1Z8FA 3LBHA 5DLQC 3CLNA 3T12A 3TAUA 3LL8B 3FS7A 5E4FA 2W6JD 1R6PA 2HF5A 2IEYA 2C98A 2BVNA 2CJWA 4BE7B 4HDOB 2LHLA 3IIMA 2REXB 1VHLA 4BUJA 3O4YA 4OR9B 3FHOA 1NBMD 3MLEA 3L43A 3MWJA 3CR7A 3QBVA 4EJSB 2JU0A 4I5NB 2AXNA 2NZJA 2BBNA 1KQMB 2TN4A 2QEQA 5FR1A 3OEEA 1SNLA 3CPEA 2C03A 3BORA 2ERXA 4F93B 4GPLB 1KO4A 1SVLA 4G5OA 5CM9C 2VF8A 4WAUA 1WB9A 4NQGA 4BRWA 2QUZA 1JR6A 2CHVA 3IF7A 2ZKMX 3LLUA 5HE9A 5H70A 4Z1MD 3LAWA 3TW4A 2JLYA 3H2YA 5CSNA 1OSNA 4WZ6A 3T1OA 5B64A 4JVSB 2BMDA 1JQJC 2J9RA 1UBCA 1DAIA 2ZU6A 3LD9A 2QRZA 5AJXA 4IFEA 3QVVA 3OHMA 1EWQA 1HUQA 5DKQA 2I3BA 5DYGA 1QHYA 1G6OA 1S3SA 4L9SA 4OK6A 4PALA 5GJVC 1QXPA 3EKJA 4DB4A 3I62A 1DTLA 4MZLA 4V02A 1VMAA 3TZ1A 4A2PA 2E6WA 4YGBB 1T3SA 4URUR 4YDHB 4HEJA 1XD9A 4MKHA 5L3VA 3TNFA 2WC8A 4P0TA 5IF9A 2AK3A 3NSOA 2C8VA 4HZUB 2OFOA 3AVWA 3KB1A 1IKUA 1TU4A 3JVUA 3SBEA 1TUIA 2WWGA 3C4JA 3AAJA 2FFBA 2PJZA 1N0WA 1UKVY 3BB1A 1AIPA 1UF9A 1JAIA 4W5JA 4W9MC 4M1KA 1KSMA 2ODBA 4URWR 1ZU5A 5E7MA 1H65A 3H4MA 2BBTA 2MLFC 4HRGA 4G01B 3LBNA 4BZPA 5EE3A 3HU3A 3AF2A 5IT5A 2IYVA 1GNRA 2AFHE 2ZR0A 1Y1XA 4XJKA 1D9XA 2IYLD 1OYYA 2MSDB 1OMRA 3VFDA 3TDUA 3LW8A 3O6BA 2FG5A 3DD4A 3PALA 2VYFA 1CNPA 2HXSA 1F3OA 2V7QD 4G1UC 1Z2AA 2B8TA 2V1UA 1OH7A 2CCKA 2OCPA 1G5RA 1SZPA 3CF0A 1CDNA 1BYUA 1H8HA 3GLGE 1QLSA 1T6NA 2KNEA 2HDNB 4A6PA 3C7KA 2KI5A 2M1KB 2OE2A 2PZFA 1E2LA 2XB4A 1WRBA 2LKCA 1PUIA 3OF5A 3O2PA 1UDWA 3QKRB 5FUYA 2CVHA 2OFXA 2XTZA 3E3RA 1KI8A 4HZIA 3B2EA 1B1GA 1JECA 1G8YA 1MF8B 3C8UA 1Y0VH 4GFDA 2JULA 1W0KA 3KUDA 5G08A 2XJ4A 2P2LA 4Q9HA 1LA3A 1TNDA 1J8MF 2GCOB 4QG7A 4ZDJA 5F9HA 4C7OA 1GKIA 4DSTA 4V0OA 1WCV1 3OE7A 1SHZA 2O5VA 1FTNA 1L7VC 2OXCA 1P2SA 4URVR 1CR4A 1P73A 4NYIR 4PQYA 1N25A 1B9AA 1CJKC 1XB2A 1XMVA 5AUNB 3AVVA 1M74A 4CEIA 2M0RA 2G9NA 2V4ZA 4OI4A 1T3HA 1U94A 5CIWA 1F70A 5EE0A 3GK1A 5FTNA 2Q9AA 3W6PA 1UHNA 1VYUA 2OV2A 3X1YA 3PVSA 4LJ7A 2C96A 4ZDWA 5IK2A 1GRRA 1V1FA 2GRJA 4A8JA 2PJRA 1EFUA 5TXGA 4UXHA 1IXZA 1N3BA 2N42A 2F1IA 3KTAA 4HAVA 4N0EA 2NLNA 2NPIA 4DWJA 2CTNA 4C9BA 3B7GA 5DHFA 4DCNA 1P9WA 3RDPA 2ZRTA 2SCPA 4HLQB 4C0SA 4PPGA 1OW3B 4BLOA 1ZM2A 1S5GY 5AXIA 4ZIRB 3KB2A 1TQ6A 4JLOA 1MKYA 5KPDA 3B82A 1LS6A 1PZNA 1JR3E 2H5EA 3CUEF 1UADA 4NPHA 4EUNA 2XOKD 4ZCLA 4GP6A 5JECA 2REOA 4M2PA 4NDBA 5AERA 5JJLA 1Z0JA 4H1UA 4HDQB 4URZR 2XZOA 1B23P 2VA8A 3N2EA 1AGRA 1SBJA 3U5ZB 5JJGA 4DT1A 1DAHA 2I7AA 2K7CA 2A4JA 1RYHA 3AB3A 2VP4A 4HLUC 2RH5A 1CJVC 2LV7A 1XMJA 3WMGA 2ZJAA 4U5XA 5LBIA 3WHLA 4IRUB 3AKAA 1DJGA 4BZQA 5EJEA 4Z54A 4BGDA 1OYWA 1DJYA 2P3SA 3X1ZA 4E09A 2BCBA 4TYYA 1RECA 2K5UA 2ZSBA 2J0UA 2J59A 3QPVA 1TL7C 3RRZA 1PVOA 2HYIC 5K89A 1D9ZA 1KDPA 3NC0C 2XSZD 4HATA 4L5BA 2N46A 2PT5A 3IDQA 4R1EA 2PEZA 1XZPA 3BOWB 3A37A 4NCIA 3IQXA 4A1FA 4B74A 3TVDA 1RWYA 2RMKA 2Q4UA 2FPMA 4KO8A 2FZ4A 3EZ7A 1ZBDA 3QE0A 1LKJA 4GSYA 4M22A 4YGAA 2L98A 1E9CA 1BMOA 1U9IC 2BE4A 1AUIB 2BKHB 3OIWA 4D2IA 4IOMA 2LMUA 1HQCA 1YHNA 4PHNA 3R8CA 1FMJA 3AVTA 4B3CA 3HYRA 2VIIA 2J7KA 2JT8A 1E1QA 1NY6A 4FN5A 3KUCA 4HUQA 2VLIA 4QXAA 3KQHA 2Z83A 3DHWC 1QTXA 4IDQA 2AWNA 2IF2A 3TAHA 1E9DA 1NN1A 2Q6TA 4EPTA 4O25A 2V8OA 2F6RA 1SRAA 4U7DA 2TMKA 1L4UA 1NVWQ 3T5GA 5F9FA 3D0YB 2JLUA 1W4AA 2WSSA 4IFBA 5JI3E 2R2IA 4M21A 4PC2A 3O47A 3VRQA 1IN7A 1N2CE 2G3YA 2VF7A 4MGIR 2OILA 1NSHA 1A03A 3ASYA 1WBDA 4QRHA 1KDOA 1YZUA 5AUOB 3HPQA 4LY6A 3VAAA 1WF3A 3ND9A 3KQLA 2OCAA 1P5ZB 1F2TB 2BCGY 1TTXA 1CM4A 3DVEA 4DIEA 4RZ3A 2JJ1D 1N6NA 3DF0B 2QE7A 3VR4A 4JLAA 1U0JA
chains in the Genus database with same CATH superfamily
3E3LA 3LWBA 3FI9A 4JEUA 3IXLA 5GAJA 5A1JA 1GNTA 2A35A 3VU3A 2ATVA 4KIUA 4IDBA 1GPKA 3NYIA 4C08A 2WJIA 5FIUA 3KQKA 4HPXB 2RGCA 4XRRA 4LRQA 4RIHA 1KEWA 4OYLA 1EGQA 4EHJA 1KRXA 2D7JA 3HHPA 1X1SA 1G7RA 4N5LA 4NS1A 1U1FA 1KS2A 3VA7A 1UUSA 5KX5F 1NP3A 4ZJUA 4M7OA 4QUJA 4JXZA 2XBLA 4CODB 3VC7A 5HCIA 1OXSC 3AIMA 1DT7B 2VEDA 1EHYA 1NHGA 4ND4A 1SZJG 3ZZMA 4JYMA 2MSEB 1MENA 3QUCA 1OA1A 3ZBUA 3HJBA 3FSGA 5ANRB 1DJMA 3OHMB 4JMPA 3KF9A 1AY0A 4PX5A 3CX6A 1EFDN 3ZZ1A 1E94E 4DIUA 1BD3A 4XWWA 3UMMA 1QX7A 1NVGA 3QKRA 3CE6A 1C7FA 1HETA 5NLLA 3PUXA 4BEBA 1K08A 1G59A 2P5UA 1R0RE 1NYRA 4UQLA 4B3XA 1Y6RA 3CT4A 4RA9A 4B09A 3LKBA 2VNKA 3D2LA 4LAFA 1QM5A 5ALYA 2O8EA 1Y6ZA 4P5EA 1UMCA 3KKPA 1YJQA 4JJKA 1IN6A 1C4KA 4R7ZA 4MWOA 4LJ6A 3GIWA 1HKUA 5BURA 3C3JA 1OQPA 3R74A 4LJAA 1VIYA 5FOWA 2RBEA 3DZKA 4BKPA 1M2EA 1CFPA 2BOVA 1H1LA 2PD3A 1YZQA 4FLEA 3E61A 3K6KA 1Z4JA 3ROTA 3PR3A 1KEPA 1AQLA 4H1TA 1HH4A 1X1RA 2SICE 4CLEA 1VLQA 3TQTA 3PHJA 4YRLA 4WCFB 1DBVO 1GADO 4IP0A 4RA6B 1FW8A 3RVNA 5CTAA 2C7QA 1VKOA 1TAQA 5A6SA 3IMKA 4GUDA 2EG9A 1EVEA 1UPFA 5LIPA 2FP4A 2AG1A 1R3UA 4NIMA 4PO3X 2Z6UA 1EP3B 3ZWKA 2JHCA 1VL8A 4JY7A 3TZLA 2J9FB 4OMDA 1YL7A 2V74B 3FHCB 4CFRA 2RKOA 1G4UR 1Z8DA 1WXXA 2ISCA 4A03A 4XWGA 1C30B 2LMTA 3UT5B 3BXKA 3CRQA 3LPNA 1QE5A 1DQEA 2B8JA 1NKSA 3ZU2A 3CSDA 4H60A 5ECGC 4NRDA 4KVGA 1DKMA 5BO5A 1X02A 5K0BA 2WHQA 4NENB 4AN1A 5KQSA 1ZN9A 2QMEA 4DR3B 1UR5A 4S2UA 3GDWA 1XRJA 1RM5A 5EQTA 1Z18A 5BN5A 3MINA 3UJDA 1NPDA 3TUYC 2PMYA 4WKCA 1R3DA 2ISSD 4N3CA 1SW8A 4B3IA 1A9TA 2XD4A 4HYEA 4GR4A 1XKTA 1Z6PA 1GTMA 4D99A 1LVUA 2X15A 3SLKA 4TTRA 4L3WA 1G21E 2GBLC 2NU7A 4HNSA 3VTAA 4F3CA 5L8VA 2ERYA 3ZWWA 4Y9DA 2RHMA 4FCWA 4I5DA 1WY9A 1U7TA 1N3LA 1KFXS 2EJVA 1OXKB 4ND7A 3EIHA 4RJKA 4ENTA 3ZVLA 4TMTA 2ZT7A 1FFXB 4P33A 4YJHA 3FVRA 3BFHA 1QMPA 1WMBA 1PV1A 5JH7B 1QOPB 1VPTA 2WD9A 1YJCA 3WNZA 5EZYB 1OFTA 4L5IA 2GYYA 2B35A 4NZMA 2BZ1A 5SYNA 4RAQA 4NNOA 3DZCA 4P2YB 4V0MA 4HGPA 1Z47A 1VGQA 4I81A 1L9XA 1O5TA 5BSWA 5DHSA 2F8LA 1I6LA 3QFRA 3BZUA 1HV8A 4OQLA 1IBMB 4CZ2A 1OBVA 1GSHA 1XQXA 3A8RA 4OI1A 3PFWO 1MW8X 4AURA 1NJ6A 3SM9A 5A5GA 1EVYA 1ZI8A 3HVUA 4QYWA 2JXCA 4BIMA 4TWZA 1O96A 2B92A 4ZCMA 2NOAA 1T26A 3ZY3A 3GT4A 2P75A 3RWOA 4GYYA 1RPNA 3BIXA 1TLFA 3W9YA 1QZ3A 4BVKA 3DE0X 1ZRHA 4R9VA 4IV0A 4MAFA 1JT9A 3OAAD 3OT4A 3S1AA 3AJDA 5BR7A 1O89A 2QAIA 4BDSA 1BX3A 2CJPA 1GPMA 3CX8A 4M55A 2V5VA 4ZK6A 5CVVA 2WCBA 1PFWA 3I2GA 4H7HA 4TS9A 1NU8A 4J0JA 5EPUA 4DOMA 4IG4A 3EOZA 1IEQA 5DXFA 4NDCA 3GT3A 3CLUD 3WFZA 4BATA 1S2GA 2JW5A 3P27A 2DHCA 1TZCA 4BO9A 4CMKA 1ADCA 2XD9A 4YQFA 1J1DA 5KHOC 4BVAA 1G9TA 1B7TY 4RKWA 3D6JA 3CX3A 2P6NA 3COPA 3PDWA 1QNFA 2I1WA 1YRAA 2EVWX 3TSZA 2Q2VA 3DMTC 4TV8B 2FF7A 2CMFA 1WTAA 3QOFA 3DVLA 2VDMB 2RAPA 1JIVA 4YV2A 1CE8B 2OG1A 3EXHC 1O9GA 1E3WB 4UM7A 1NAIA 2GO1A 3TZKA 3SNHA 3O8DA 2MOKA 4J7XA 1P44A 3GMDA 3P97A 1WRLA 3QU4A 1IOVA 1SYMA 2PL5A 1PG0A 2OVFA 3F8TA 5HILA 4PXAA 3R9XA 2RGNA 2I33A 3L8HA 4ESEA 1SVWA 2FKAA 1LNZA 2YWDA 4MBEA 5HTKA 2PU5A 5FPTA 5TVGA 3VYWA 4EKEA 2JEYA 3BC1A 1TJ5A 2YJ4A 3LXXA 4QOJA 2JBAB 4JQZA 4M8SA 1CY7A 1BZYA 2FSUA 5DGDA 4U00A 3IFSA 1NC3A 3SLGA 4Y1FA 3UTCA 3ZUPA 1V4NA 2AGVA 1QQ5A 5FDFA 2ZB8A 3IDOA 3IUEA 1GITA 1RHUA 5ED4A 2IELA 4O8CA 1XLTC 2ZBVA 3CT6A 2F17A 3UFBA 4BWYA 3R1PA 4F7DA 4I14A 1ANKA 3CPHA 3OQMA 3BHNA 4ZCUA 3GL9A 4OJYA 3KYBA 2HPZA 2YVUA 4E3ZA 5EESA 3TIGA 3BGWA 3DBOB 2ICAA 4IRMA 2GK6A 3G5UA 3MGBA 4EI9A 3NRJA 1IM8A 1KFUS 4PLYA 1OAKA 4NCHA 3TPCA 1RHJA 3U40A 3JD1A 3IS3A 2OP1A 2J41A 1OR8A 4QJ5A 4MULA 4OQMA 4HAYA 3ETGA 4ZI7A 3N0VA 3T0IA 1QG2A 2OHJA 4I3FA 1ES9A 4GLLA 3BFVA 2BKEA 3LUGA 3K1EA 1DJXA 2RK3A 4G9GA 1H3EA 2QAGB 3GFTA 1JF8A 4EO9A 5ITWA 3UJ3X 2B69A 3NT5A 3GLIA 3S8MA 1PJZA 3K0AB 3BK7A 4R3WA 4S1VA 2XODA 5IZCC 1LLCA 1OZGA 5CG1A 3DOUA 2Z4TA 3D2AA 1N6PA 5HTOA 4CDRA 3KHEA 2WUDA 2Y4QA 4HZGA 3ZU5A 5ALSA 3IB3A 2LKDA 3LCJA 3PHLA 4HXFB 3RAGA 4KZPA 1L4NA 5CYPA 2OBLA 3KL4A 2ZWAA 1DE0A 4GGFC 1PVVA 2VNIA 4LXYA 3N86A 3DHYA 3CW2A 5HBGA 3GUVA 3WA6A 5I9LA 4K28A 4KL8S 3EGXA 2DFLA 1OF1A 2O8FB 4V0ME 4V3CA 3AEZA 4ALNA 3PQ7A 4QATA 4GYWA 4WNIA 4R98A 3GLKA 3N7HA 3W2IA 2DOKA 2YWFA 2GYUA 3QLTA 2CNKA 1Y8AA 1VB5A 1PSZA 1FF1A 1ZJ4A 5KYYB 3G1UA 3Q12A 2GM5A 3JARB 4ORAB 4IL5A 5B53A 3LX6A 3ZJTA 1YOVA 3WLMA 3DKPA 2OQIA 3I39X 3NAZA 5HKWA 2BM9A 4NU0A 4EJ2A 1VL5A 1RI1A 3WL4A 1SBHA 3T7KA 2QJWA 3VNQA 3RRMA 1KFBB 1V1RA 3SG0A 1DEAA 3GEEA 1XJ5A 1QH8B 4EKGA 2W2VA 4JB2A 3RU9A 1R0SA 3RVRA 3BJRA 4NC9A 1GOTA 1STOA 4RKEA 1UBUS 2WD8A 3BULA 3C1VA 3AESA 4BCBA 1ZJYA 2LLSA 3PJGA 2P6PA 5HIKA 1XTRA 3AKCA 4KYUA 5ALKA 3FJ1A 1TJYA 2K61A 3NVDA 5DJ5A 3JAMA 4FSXA 4FR5A 1KPIA 4PGFA 3AHCA 1RBMA 2Q49A 3D75A 5H7XA 3W7AA 4JH0A 3HCBA 2Q7OE 2XBMA 2HJHA 1MRZA 1R5NA 1WNTA 4EI7A 4IGIA 5B1YA 3A9VA 4LCEA 3VMFA 4U7FA 2FQXA 3QEJA 3HYSA 1MUUA 2DVMA 4CMIB 3HDJA 4JLNA 2XXAB 3KJQA 2XRZA 2AHRA 1JQ5A 4IOKA 3NOVA 3NBQA 2X4LA 4YJFB 1FDRA 4D6YA 4RU1A 1Z0ZA 3RE1A 1GZ7A 5DX0A 1YZFA 3M33A 1YDWA 1LSOA 1T43A 2W2TA 5BQ3A 1ENOA 4F1JA 2X3UA 4ZVQA 3C15C 3IO3A 3ZZ0A 4HF7A 3SQMA 4XIJA 2DFNA 2BL4A 1X3LA 1YIDA 1F2UA 3IUSA 4MN0A 1QGUB 5DDIP 3OTIA 2GESA 2EIHA 3KEMA 1MC5A 4GECA 4KR3A 3W1EA 1WQ3A 1YS2X 3GNLA 5HS6A 3ZQ4A 1HT0A 3WRYC 5L51A 1MIOB 1FK8A 3K9NA 3S28A 2DF8A 3P9CA 5FNVF 4JKTA 1TUBA 1Z0SA 3RHSA 1HO3A 4DLZA 2JCSA 1B14A 2ZR9A 2V7BA 4QHSA 4R8VA 1L7NA 1JDPA 1U7PA 2FZLA 1UURA 4F4IA 2PH1A 3H9JA 1SQ6A 4OATA 1ZNXA 4B6QA 3FWNA 2G9QA 1HT1E 4JWQA 4UUAA 5I8NA 5AW5A 2QX6A 5EN4A 3LCMA 4G5HA 3OE7D 4UASA 1IN5A 1UBTS 5JARA 4WN3A 3BWCA 4URHA 3D6FA 1CQIB 2Q2OA 5AW4A 1G7TA 2BF4A 2QLBA 3THOA 2V4MA 3FTQA 4MKIA 3ZG6A 4BWFB 4JROA 2QVXX 1AHHA 3DT9A 4C4XA 4E0BA 4O5AA 4HWPA 4XX0B 1JEYB 4YQEA 4ADSG 5JATA 1FUKA 3GLIE 4TKVB 3K73O 4KXFB 3HR4A 1TK3A 5C3MA 3W3AH 3G82C 3DDCA 1RFGE 4RY2A 2IW3A 1QLWA 1D5CA 5D3KA 5J4KA 1S2IA 3PCTA 3VOSA 3NPMA 5HR5A 2XMPA 1T4BA 3DOIA 1HPLA 3NG1A 1Q0UA 4MKZA 3O3OB 4MLPA 4JSTA 5E8RA 4EKIA 2ZI7A 2P62A 5ERXA 1JHUA 2KAYA 1UPUA 1B0ZA 3H0EA 3HR8A 1R5OA 2GASA 5KYKA 4WBNA 1QQ6A 3O9VA 1U0OC 4K9PA 2BGRA 1P4AA 2FWNA 1KOLA 4P35A 4OHFA 4LF9B 1SOMA 1ECBA 3A58B 4HRHA 1Z35A 2PT6A 4QTXA 5EXXA 5G3YA 1LNQA 1T2NA 1THMA 1F2TA 4DMLA 1QGZA 3NVMB 1ZMOA 3KG2A 4PICA 4WOBA 3JPYA 5KYWA 1S2MA 1R00A 5HRAA 5HKZA 4EQ6A 1XJCA 3DOEA 5JSZA 5JSHA 2FUCA 1XD2B 1GCUA 3N2IA 3SMVA 3TR6A 2NTYC 2C4HA 2M6RA 4ICBA 1Y89A 3G8YA 1JHYA 3KD3A 4B4DA 1OZ0A 3NDPA 3IT1A 3W79A 3C3KA 2VAPA 1SOVA 1YFLA 3V9PA 4N5NA 4D25A 3QJYA 1XDUA 3EQ9A 1D8AA 1EI9A 2XT9A 4CMJA 1E4EA 4BZWA 3LBHA 5E4FA 4BE7B 3VBCA 3IIMA 2REXB 1VHLA 3BFPA 1VB3A 3UAXA 2NZJA 2C03A 2FPSA 3RI3A 1Q19A 1Y7IA 4JLWA 2VJDA 3HHEA 3IF7A 3LLUA 3MJFA 2INGX 2K6GA 3T1OA 2COEA 1QIGA 2QRZA 5AI0A 3QVVA 5FWNA 5DNWA 1EUQA 1R9NA 1OYVA 2A92A 3I62A 4PALA 4C5CA 3EKJA 1DTLA 4V02A 2E6WA 4YGBB 4CLDA 2NSDA 3RVOA 4OGKA 1NW9B 4P53A 3KOWA 3HXLA 4FSHA 5KYNA 5MHTA 3SS3A 3WDSA 4DQUA 3D78A 2IYVA 3MTDA 4XJKA 2MSDB 3L7CA 3TLMA 3IBCA 2AOTA 2CCKA 5IM4A 1G5RA 3G0CA 3I6ZA 3VR3D 5CHEA 3FA2A 1RABA 4L57A 3DEKA 3OOWA 4HZIA 5D1NA 1Y0VH 2PSEA 2GCOB 3OCCA 3Q9UA 4QUIA 5JNWA 3B48A 2Y0BA 3B70A 1TVKB 3NO4A 3M6UA 4LQCA 2H06A 5EE0A 3VR2D 1LI5A 4D74A 1NPYA 2IEDA 1GRRA 2XCSB 4F5DA 4DWJA 4NLLA 4ZHQA 4C0SA 1OW3B 3HGQA 3NORA 4NEHB 5EHNA 5JCJA 4JLOA 4G23A 5B3LA 4RVNA 3B7WA 1V1MA 1KC3A 4IQ8A 2VA8A 4HLUC 4BNLA 2MYUA 5LBIA 2Y1EA 4NMHA 5FFNA 1RXIA 4KO8A 1ZBDA 4YGAA 3C6YA 4RSRA 2IXDA 2JT8A 4GLFA 3E9RA 3CABA 4ZYVA 2EZTA 4X00A 1R6UA 3WIEA 4UUBA 5F9FA 4KSYA 1WDMA 2RAVA 4IFBA 3ROXA 1IN7A 4FE3A 3QEMA 3HPQA 3S68A 2BCGY 2R7LA 1EVKA 4G5YA 1L3IA 2CZGA 1QUEA 3B2NA 2O3SA 3DXLA 4Q3CA 4NJMB 3ZTYA 1NW4A 3JSAA 4E21A 3UB4A 3KEFA 4RVGA 2P69A 1G3IA 2QRVB 3K5WA 2A14A 5ENDA 3ED5A 5KKCA 3Q0IA 1SUEA 1XMQB 2AH5A 2GCIA 2QEOA 4ERXA 1U8TA 1Z28A 1M6HA 4KLRA 1ORVA 2WT4A 4INOA 2O5CA 3CVVA 4MV0A 3T3GA 4V0LA 1KFJB 1O87A 1DRVA 1B6SA 2B20A 1RM0A 1PW5A 3COVA 4DEYA 1M5TA 1EFKA 5FULA 2ZTHA 2KPOA 3CF6R 3C3PA 3DWIA 3ZWPA 2I6QA 4U1RA 3QXJA 2Z9BA 2BFCB 1A97A 3AW9A 1E2QA 5A4AA 1R8XA 1HOXA 1B4CA 2A7QA 1G17A 5BNTA 3SVLA 1DIBA 4UHBA 1LINA 4D5GA 4P4GA 4DMHA 2ZANA 3GP8A 4ENSA 3T94A 1M2GA 4ETWA 3ZIUA 1U9ZA 2GA8A 5DNCA 2HHCA 3QFSA 2HD4A 3UAWA 4IV8A 2BGMA 1U5BB 2C1ZA 3FGOA 1P80A 2KI6C 3B1YA 3CBQA 3PC3A 2GCNA 4PZPA 5EFZA 3STHA 4MPRA 3R4CA 4HFNA 2X8JA 2BP7B 3ZNQA 2XYQA 1FU4A 4I66A 2CBGA 5K20A 4WASA 4YALA 2HUPA 1CUXA 2LTAA 4MKFA 4OXIA 4RULA 1YS9A 2LM5A 3K9FC 4DR5B 5KSPA 4U8HA 2WW8A 3A1NA 1O6BA 1R4NA 1S6CA 5FBVB 3H2ZA 4K9RA 4JUBA 3ODPA 5MGBA 1B76A 1VKJA 5FP0A 3A6PC 1RTP1 3CVJA 4M0FA 4ABYA 2UUBB 4LRWA 2CNNA 3MRTA 2Q5LA 5HJ7A 1ZHHA 1S1CA 4ZCPA 5DCUA 3HN6A 2R6AA 1E20A 1SC9A 3GEMA 5B1EA 3D0YA 1FFYA 2Q4DA 4TS4A 2IHTA 3CEPB 1FP7A 2RH9B 3TRDA 4REMA 3JQQA 1FP4B 2XE8A 1NONA 1UBSB 1E7WA 1V8ZA 3VR6D 3BF7A 3D8BA 1P33A 4QFDA 4PM4A 5FTWA 5AVVA 3L47A 4GKBA 1FSGA 2NSLA 1YONA 4CPDA 2OV6A 3CKYA 3LUJA 1DQZA 1YHYA 1TNQA 4MVCA 1WDLA 1YVUA 1E3JA 2GM3A 5B55A 2C8JA 5T41A 3D4BA 2WYWA 3ND6A 1U2QA 5KSYA 1FRFS 3H7IA 2VJLA 2XQIA 3NJ4A 5KNCH 5GONF 4OP1A 3DOOA 4MITA 2FWBA 1E1RD 2RGEA 2GJSA 4FHDA 1DARA 3HMQA 4UPEA 4TKLA 5B58C 2ZE8A 3KKZA 4N0PA 2VJCA 3NSKA 4EUKA 3IDFA 3L9WA 4QUKA 5THQA 1IWQA 1E5TA 3OX6A 1BGXT 3GPIA 3S2ZA 3V2LA 2W00A 3C5VA 3RRXA 4ARVA 1WP9A 4BFVA 1J5PA 3IVTA 1J25A 5K9ZA 4USLA 3H0CA 4BS9A 3OSUA 3ACBA 3LI2A 1GG8A 1H9BA 2Q1XA 1V11A 3N7AA 3PC7A 4RQTA 2X2PA 1ZHOA 2G71A 1VG0B 1PJCA 4N65A 1YAJA 3WS7A 1R88A 3E1KA 1XWIA 1RJDA 1GN9A 4UHKA 3BTOA 1YQGA 4QFMA 1KVTA 1FYWA 3HKDA 5A4DA 5A3RA 2C7PA 1PS9A 3ZWDA 2YMMA 1UMBA 1K27A 5JAMA 1QO9A 3EDOA 1QIVA 1RQ7A 1EP1B 1G38A 1PLJA 1FTSA 4Q3AA 1SN7A 5IANA 3JW8A 4QEZA 2FZWA 4LYGA 3TD9A 1PZEA 3I6QA 2O8EB 2VAMA 2BSQA 5HPYB 1UMCB 3WAGA 3HGMA 1Y80A 1YR8A 3RBVA 3WLQA 2VRNA 1E98A 4D0SA 1P17A 4UCXA 1O0SA 3GNQA 2H2GA 1NPQA 4DNPA 2ZRKA 2ZI6A 3ESYA 1E5QA 4MVXA 4P4NA 4IIJB 3RUEA 2BKIB 3G79A 3W34A 1IYZA 8LDHA 5DW3A 1IBCA 2ZM5A 4E5DA 1QSGA 3NIGB 3BWVA 1Z2NX 4YNBA 4DMGA 5LP6B 1POWA 3U9TA 3TW0A 1EAYA 3HCAA 5ER4X 3UBMA 3GJ3A 1IJ5A 5KQPA 3CV3A 2GBCA 1TQ2A 2A33A 4RLFA 2ZBEA 3OP1A 4HLNA 2PMFA 1P6QA 1XA0A 3GLFA 2BR4A 3B38A 1VKNA 2A7XA 2Q6IA 3QVJA 4YCNA 3RASA 5CCBA 2JDID 4BLVA 2V65A 1AQYA 3EG5A 1Y3BE 4AS2A 2JNWA 3QLUA 1XTTA 3RYFA 3Q7TA 1Y3HA 4IXDA 1TM2A 1DRJA 1NV8A 3WK4A 5LDDC 5JOLA 1O8BA 3TEJA 2R4QA 5J59A 3GP3A 4E5VA 3I01M 4EHHA 5B7QA 2WU8A 2P9TA 4UHCA 1WW3A 1VE5A 3W7VA 2F1KA 3CTMA 3ZGXA 1S6IA 2YCLA 3HFJA 1JWAB 1NNI1 1KKMA 1VE9A 3F67A 4F11A 2R8EA 2ZQYA 4UATA 3P0RA 4D7AA 2VC2B 4D41A 3UJ6A 3WP1B 3ORHA 2NLOA 2ADMA 4B3FX 3CRVA 2SKCA 1YS6A 5BN5B 2Q28A 4C06A 3BDIA 4FQ5A 3BXPA 3CCBA 2WJHA 2B21A 2ZKIA 5LR6A 3M34A 3D3QA 5AM2A 3K9GA 4D8WA 3A14A 2KSQA 2QTHA 3SQNA 3OQ6A 2BDEA 4AN0A 1ZRMA 1E60A 1XWFA 2W4MA 3T1VA 4P3XA 3N53A 1SZDA 3JQFC 2DPHA 2P91A 3G9ZA 3JQ8A 3D81A 4EMSA 3EMDA 2FMFA 3ZLUA 1NJ5A 1PEDA 4EFDA 4JYPA 6Q21A 2O5EA 1YURA 1GY8A 4JKOA 1JHPA 5EZSA 1P62B 1X38A 3EVEA 2A3NA 3AP1A 4UHDA 1IWPB 3VGPA 2C9MA 5LQRA 2WFLA 1MP0A 1THTA 4URYR 4N5HX 3TVYA 4G1FA 4CN9A 4B46A 2BCXA 4QGGA 2QD4A 1KK8C 4EIWA 3DE3X 3L1UA 1PNTA 5LU8A 4ND1A 4J0CA 2EL9A 1DV2A 4IH9A 4OIMA 4FKMA 3U1TA 5LC1A 4KVAA 3RC7A 2XW6A 1P9RA 2CFOA 4RD4A 1KP9A 1CLUA 3ZYZA 4H4EA 3OZUA 3BAZA 1KSFX 3VI3B 1I4WA 4L0DA 2CDCA 1SSEB 3E0QA 2PV7A 2VCHA 1JYEA 1TCOB 1PI3A 1XQVA 1G8JA 1X9HA 3DSRA 2I4LA 3RRNA 2WIKA 1OFGA 1VE3A 1A9OA 1O96B 2RGUA 2D7DA 4F9TA 2NU8A 4JYCA 2GJ9A 3D8NA 2XVAA 4P7FA 1JIKA 1RYEA 3IP8A 4JI7B 2H4YA 2FPGA 3RC1A 1Q16A 4EPRA 3NHMA 3AHJA 3PFBA 1N0IA 1BE8A 3CQ9A 3K4HA 1XDSA 2CLOB 3S1AB 3AY7A 3FMVA 3MK31 1MX9A 3IRVA 3HSSA 4WOPA 1JSZA 1ISJA 1YS7A 1BXRB 2CUZA 2WSIA 3VZPA 2DY1A 4XEHA 4WNCA 1FJXA 2WJ3A 4M9XA 1WETA 4MR8A 1TM5E 2VDKB 4PHTA 2ZWMA 4PTLA 2H0AA 3T9FA 5K8CA 4TS3A 1YI8A 2I9PA 3T4EA 2HPAA 2ZYWX 3RGGA 4HAOA 2QTBA 1BDBA 1WG8A 3NC4A 2PYZA 1U80A 2AA3A 2APJA 4YBRA 4AAYA 1XF1A 3DMTA 3O73A 4ER6A 1SC6A 1XFRA 1SURA 1Y4ZA 1WMAA 2XUDA 1RBZA 1U3WA 1N6IA 3WQBA 3HCMA 5AVQA 4H17A 3IUMA 3OLVA 3SZRA 1RVDA 3COWA 1RWWA 1UWVA 3AKDA 4PGMA 3I5AA 5J9FA 1QU2A 1MHPA 1QTIA 1S2OA 5FFFA 3UF0A 1KJ8A 2QTWB 2BAGA 4CTJA 1RXCA 3E7XA 1Y63A 4DMRA 4KPEC 4TNCA 3OOSA 1EVZA 1SVUA 4QA9A 1WXIA 2HO5A 3QXXA 4ZT4A 3GU3A 5M34A 2ZSDA 5FPSA 5CDGA 1MH1A 1Y8QB 3GLFE 1VZ3A 5KQLA 4WT7A 2ODWA 4CG2A 2R1TA 5E0KB 3OEWA 4OHMA 1A7JA 3CNEA 2NTJA 4O0MA 3Q9LA 5B12A 3DE4X 2RHHA 4WLEA 1JFKA 5EQJB 4Q48A 4X71A 3SY8A 3L7BA 4LXTA 4BFUA 1EBUA 1A9YA 3F47A 1ODFA 4NMMA 1PDWA 4I9UA 4FCVA 1TRFA 4R2MA 4DLYA 3DVKA 3C1TA 1SC1A 2XCRB 3KCNA 2VAWA 5BWMA 2HCFA 4JL6A</