4C0KA

Crystal structure of drosophila miro ef hand and cgtpase domains bound to one calcium ion (ca-miros)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
404
structure length
404
Chain Sequence
ELTSACKKSLVRIFKICDIDGDNLLNDYELNLFQRRCFNTPLQPQILDEVKAVIQKNVPDGIYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGSSTELSHRGQQFLIAVFERYDRDGDGALSPEEHKMLFSTCPAAPWSYSTDIRKSCPINETTGWVTLHGWLCRWTLMTLIDVVKTMEYLAYLGFNVHENDSQLAAIHVTRERRIDLAKRQSSRSVYKCHVIGPKGSGKTGMCRGFLVEDMHKLIGKEFKTNVVNCINSVQVYGQEKHLILRDIDVRHALDPLQPQEVNCDVACLVYDSSNPRSFEYVARIYIKYYAESKIPVMIVGTKCDMDERRQDYLMQPSEFCDKYKLLPPHLFSLKTNKKELYTKLATMAAFPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Coupling of the EF Hand and C-Terminal Gtpase Domains in the Mitochondrial Protein Miro.
pubmed doi rcsb
molecule keywords MITOCHONDRIAL RHO GTPASE
molecule tags Hydrolase
source organism Drosophila melanogaster
total genus 116
structure length 404
sequence length 404
ec nomenclature ec 3.6.5.-:
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
A PF08355 EF_assoc_1 EF hand associated
A PF08356 EF_assoc_2 EF hand associated
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA01
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4c0kA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4c0kA03
2FN4A 2VHCA 3VR5A 4A8JA 3CX8A 5IRCD 4LOAA 4HLUA 4C4PA 3TZ1A 5HLOA 1E94E 1IXRC 1XNJA 1XZQA 4Q1DA 1IJEA 4JYCA 3U44B 1KFUS 5J4YA 1YUUA 4JSTA 1CULC 2L4HA 2ZITA 4LHXA 2C9YA 3EA5A 2HCJB 5FPHA 1XCPA 1X1RA 4M1KA 3UWKA 3IPYA 1GRRA 5G08A 1P9RA 1QIWA 1ZUNB 3MAAC 2V1UA 2H18A 2QSZA 4IDPA 4OQFA 2ZSBA 4JLKA 1E2HA 5TVKA 2CEAA 2GEUA 3FMPB 3ZWHA 1J7PA 1OFHA 1W0JD 1RPZA 2ZAOA 4JYBA 5EQTA 3GLHA 1WRZA 5F6TA 1UJ2A 3QXJA 4DIEA 4HB2A 2WJVA 2ANCA 5P21A 4BASA 4AOMA 5JEDA 2HXSA 3G0HA 2WCFA 2B7CA 2WWWA 4UKDA 5FI1B 4RFSB 3PATA 1XRJA 3NC1C 2G9NA 3AF4A 4DLRA 4W5HA 5LD2B 1EG7A 3SN6A 3WNCA 1S1CA 2J7PA 1ZMZA 5FOSA 3T15A 3JTDC 2GILA 3I8SA 3SG7A 2W6IA 4PHJA 3TJZA 4O3MA 1Q1ZA 4CPVA 2HF9A 1P60A 2DCUA 3K9HA 4JVSB 4QRHA 2JLXA 3NWJA 3SFZA 1L7VC 1QVIY 1N6KA 3DF0A 5E7JA 5BQ5A 3FKSD 3OB1B 1NI3A 4RY2A 1E79D 1S5GZ 1W1WA 2A78A 1OOJA 2F3ZA 4TQ9A 1OFUX 5DIFA 2VRWA 1KI3A 3DVMA 1MV5A 4PZYA 2JXCA 1GGZA 4IOMA 1II9A 3QKSA 1CLUA 4XVRA 1BYIA 2R2AA 4CT4B 2WMOB 3VR3A 2K2FA 1K8RA 4Q18A 2J3EA 4KYIB 4RKEA 1P73A 5FH9A 1DAIA 3U61B 2SASA 1R0XA 2OLKA 2QEQA 1M46A 2LNKA 4IL1A 1W2HA 2CNWA 5EXPA 1RE0A 4ZCMA 4M2PA 2MMCA 1NN5A 2IYTA 1VYUA 1JR3D 3LWNA 4MKGA 4FMCB 1SVOA 1SL9A 4BRUA 2NPFA 3EPHA 1AZTA 1EX6A 2KSPA 3QVVA 3P4XA 1RRCA 2H16A 3UG6A 3WBKA 4MLWA 4QNRA 4DLVA 3K0FA 1KQVA 2CK3A 2VRGA 1FP6A 1VG8A 2R6AA 2IXEA 4ON9A 1HT1E 2RGXA 4NCJA 2OESA 5IK2A 5KHOC 3AUXA 2ZM5A 4XSGA 2IBMA 1VG0B 3DKPA 3PR1A 3ADCA 4Q4JA 1NJFA 2WWGA 3KKNA 1CBUA 1DARA 3EIEA 1VRKA 1YRAA 3L43A 1KO1A 4TSFA 1MABB 1AS0A 2D7CA 3DDCA 1GJYA 3O8BA 4RZ2A 3KB1A 4BFWA 4PC6A 2QA5A 1QLSA 5A4JA 2OLJA 1NSHA 4Q19A 4D6PA 1CMFA 1IJ5A 1YRBA 4F7WA 4PZLA 1JFJA 1TX4B 3GJ4A 4EPVA 1KO7A 2CL7X 2K7CA 1A1VA 2QT0A 2QBYA 2CDNA 3A8TA 2RGEA 2ZS9A 4QBGB 4TQUS 3TGPA 4OQXA 1KDTA 3BH0A 4JBXA 5CM9C 2FCDA 1YR5A 2NPIA 3RS3A 4KYUA 1W4AA 3QKTA 1XXHB 3SJZA 3OEEA 3JVTC 3FMFA 3U3JA 1G64A 1IXZA 4TL7A 1XJQA 4D25A 1H8EA 5K8UA 2BM1A 4G01B 4GAOA 1VTKA 1G6OA 2HCBA 5EP4A 2ORVA 4M1WA 2HT6A 2OFWA 5PALA 1E96A 1KKLA 2GXSA 4Q5IA 1HE1C 1J8YF 2ZRTA 4PSAA 3GLIE 1NLFA 1ZP6A 4TTPA 4B3CA 4KITB 4QHTA 1NMYA 2EYQA 1CLLA 3HU2A 3UWOA 4MYTA 1ZCBA 3EW9A 3K70B 1GP2A 3I62A 2EFDB 4F4JA 3QOFA 3K0CA 521PA 5HZHA 2OS8B 1T5IA 4Q9JA 3VR6A 2CJWB 5JSZA 2YINC 3D31A 5CB8A 1TQDA 1CLMA 1TU4A 2O8BA 1YUSA 2ZE8A 1OXVA 4BZPA 2FJUB 4CDGA 2CXXA 3I5GB 4IVQA 4NL4H 2AD1A 3OIYA 2LKCA 1S8FA 2O8DA 2R2IA 1Q1QA 4EKDA 4Q4LA 3SJAA 4WRIA 3CZPA 2LHIA 1KI8A 2BJVA 4D0LB 2BWJA 3KJIA 3I5HB 3VRPA 5HYDA 3L0PA 3MWJA 1HYQA 4HB3A 2B1UA 4YRUA 4B74A 1PLKA 2RKOA 5FPYA 3AM1A 1YZQA 4Q1FA 4MYHA 3HX4A 1KQMC 1QZXA 1YZNA 1Z47A 2HEIA 2ZJOA 3VR1A 1U81A 1CXZA 1OFTA 1W4CA 2QP4A 3AKEA 4TZ6A 4KV9A 1QV1A 1IQ3A 1ZD9A 2VHTA 3B1ZA 1FMLA 2KSQA 2V55B 3Q5DA 2HYIC 1BMFA 1NVXQ 4AWXA 1MKYA 4NMMA 2ISDA 4DKXA 4YMUA 3I5FB 3F5FA 1R10A 2JT8A 4WQ3A 1VG9B 1XD8A 3L82B 4O2RA 5KO2A 1Z83A 1DJHA 2PBRA 1DS6A 1PSRA 5L3RA 1C1YA 1E79A 1GSIA 5FOTA 3NDBB 2DFTA 4BFXA 3U4QA 3OZXA 1K9KA 1ZRHA 2CNPA 5CLQA 4C0BA 2GZDA 1WLMA 3ECCA 5I8NA 4B2PA 1Q80A 4I1UA 2A5DA 2H61C 1KJWA 1FZQA 2ODBA 2IS4A 1L4YA 1UBGA 3DEFA 2H8KA 1OLOA 1XCGB 1UADA 2REXB 4LYAA 4X8LA 3W5JA 2JATA 1ELOA 4LHZA 1XTRA 2DWOA 2IF0A 4FQOA 4M9SA 3GLHE 4CT5A 3I3SR 3ASYA 1G7SA 4DT1A 3M0WA 1MHOA 1AJEA 1US8A 1Q44A 2KNEA 2EYUA 1OSAA 3RM1A 3I5IB 1IG5A 3WYFA 3IILA 1JAIA 1OZOA 2BMDA 4G5SA 1XEWX 4JZKA 1H4BA 4MKFA 5AWFC 1B23P 4RD3A 4TYNA 1KDRA 4XTRA 4MEWA 2NZ0A 4UNPA 3SBDA 2N46A 4D26A 3SG4A 1YZKA 4Z8YA 2NZJA 2W6JA 4Q21A 1KCYA 2LVKA 4Z1MD 1KWOB 2FFBA 3LW8A 1LINA 2M1UA 4MZJA 1KO5A 1W7AA 1B9AA 4HUTA 1NP6A 2GETA 3PEWA 2EC6C 4KFSA 2O0HA 1XPOA 4FWTA 4X8OA 3PVSA 1S2MA 3MLEA 1DELA 1KSGA 1R4AA 4PSKA 3RLFA 3ZNIA 1DVIA 1VECA 1VMAA 2JQ6A 1X86B 2W0SA 2Z4SA 5JJGA 4JLAA 5CB6A 2IK8A 1SVLA 1Z6GA 2Q4UA 2EHBA 2OTGB 2JAQA 2VP9A 4RD1A 4DC9A 2N1BA 4JLDA 4PCWA 3U7GA 3VNUA 2PLRA 3NXSA 2OPOA 1JJVA 1G7TA 1OSNA 3KFVA 1TADA 1RJ9B 3F8TA 2KGBC 3V00A 5FUWA 1E1QD 4J0QA 2A9KA 4FWIB 4DDUA 1EX7A 2RH5A 2G9BA 3VX4A 1EJ3A 1FPMA 2RGIA 5FTNA 1GL9B 2B8WA 2XNDA 4G1UC 3RNLA 4M2OA 2MA2A 1XVJA 5DGXA 4V0KA 2HXYA 2QGZA 2ZI7A 1YZUA 1AQYA 4DLZA 5FBVB 4QC2A 5F9HA 1KI1A 1NF3A 2QRZA 4B2IA 4KFRA 4LSGA 4US1R 4WXRA 5DN6A 2CMKA 5HE8A 4GMXA 3Q3JB 1K94A 3VROA 1C07A 2OCYC 4BEJA 2QRNA 2JWWA 4OHXA 1QHYA 2EQBA 4GUKA 1UKVY 3VKGA 4WVFA 3THWA 2ZU0C 4P4TA 1F6BA 1GKUB 1OIXA 3TW4A 1L4UA 1YX7A 2GCPA 3E1SA 1G6HA 1Z0DA 1P2SA 4L4UA 1KK8C 2GGMA 2ZRDA 4LJ6A 3LLUA 3U3KA 3I61A 1BO6A 2RGDA 4GZLA 2ORIA 1JJ7A 1U8AA 2ZS7A 4XWAA 1VDZA 1UAAA 5G3ZA 3LDAA 721PA 2BCAA 2A30A 1FQKA 2LKDA 3O47A 1F4QA 1JR6A 3QF4A 4OI2A 1RRPA 2QN6A 2COLB 1AKEA 3MD0A 5JJLA 1UURA 2YYZA 3EK4A 1MQ1A 1HY3A 2LE9B 2Q9BA 3B78A 5JHHB 2D8NA 5FL3A 1YX8A 2LV7A 4B48A 2WSSD 3O78A 4F0ZB 1MO5A 4DLTA 1XA5A 1TIZA 3C7KA 3W6NA 3AVTA 1RWYA 1IM2A 2CBLA 2EGDA 4UJ3A 3T12A 3BORA 4I81A 2CHGA 1CRQA 1R5OA 4RKFA 2HJVA 1PLJA 4GP7A 2YWHA 1NLYA 1YKSA 1LS1A 3S1AA 4I5NB 1J7OA 2ZRFA 2J0QA 4IOJA 2JASA 2GK7A 2L50A 1NG1A 4PHHA 3CW2A 3D7MA 3QXCA 2AKAB 4LC0A 2IYYA 1XTSA 4MDEA 1XP8A 2XOKD 2YNMA 1G17A 1WQ1R 3W3AA 2ZNEA 4BLSA 3ADBA 4C7OB 1LB1B 3WHLA 4CEJB 3QRXA 4DS7A 1NP8A 4V0MA 2KJQA 2OHFA 1SBJA 4C2TA 3THOA 3AAJA 1E9CA 1E9RA 4HI0E 3O2PA 1DTLA 2F1IA 3GLFB 1YR9A 4B75A 2L51A 5AEQA 3B1VA 3LAWA 1IN7A 4HEJA 4MDFA 1GFIA 2BECA 1E2GA 1MRSA 2FV8A 4C3ZA 3B1XA 3KXIA 5AUPB 2PJRA 1FFHA 1QHHA 4CEIA 1CDLA 2GVDC 3SYLA 4PE1A 1U0HC 5JCZA 1M8PA 2O0KA 2X8AA 2ZJAA 2DBYA 4PAMA 4ACBA 5JI3E 1CDNA 2WV9A 2MLFC 4A0RA 3QG1A 4EFLA 5AJWA 1XMIA 2HDNB 3AVUA 2VEDA 1SL8A 5CDFE 2F55A 3EPKA 3Q9LA 2QMHA 3TBKA 3RRZA 5KDDA 1QDEA 1LA0A 2QG6A 2PEYA 2GEVA 2OCBA 4JLOA 4LHYA 4WXPA 4DDTA 5GJVC 2VPPA 4AIIA 2QACA 5H1YA 1E0AA 5HZKA 2IYQA 3FKQA 1NMZA 1IRJA 1K95A 3FYHA 4BRWA 2P5SA 2VHJA 4OKHA 4YQFA 3VRRA 2QSYA 4OVNF 4C0AC 1FMJA 2Q91A 5AUQA 2BKHB 1FX0A 3SG3A 3KQUA 2KGRA 4ZPXA 2YWEA 2ZSFA 3WNDA 4B71A 3E5HA 2G1KA 2CL0X 2VP4A 2K5UA 2KI4B 3ETLA 3ZVNA 1W7JB 3R7WA 2A5GA 4OQNA 2V8OA 3D0YB 1XFUO 1R6PA 2WOJA 5B57C 2AN9A 1R0WA 4QXAA 5LD2C 2OCAA 2P2LA 5FOVA 3EVUA 1K2HA 3AVPA 2XB2A 2FOLA 1L2OB 2JJ1D 1BH2A 2J45A 1RK9A 2RB4A 3MJHA 1G8GA 2QAJA 4LC1A 1N0VC 1MR3F 3DOEA 3THYA 2ZPTX 2Q3HA 2M8UA 4GSYA 3VX3A 1OHHD 4IDOA 1SXJE 2XXAB 5HKKD 1FOEB 2QROA 5GQQC 1CU1A 4H9GA 4P3YA 2CT9A 2LHLA 3A58B 4KBGA 1IWQA 2B92A 2UZIR 1I4TD 2VH5R 3B2EA 4O2LA 2Z83A 1TPZA 3AAKA 3WY9A 4OI1A 2ODWA 3LD9A 2C9OA 3GK4X 3TDZA 2H57A 2I7AA 4IDHA 1KK1A 3H1TA 1V1FA 1NKSA 3W3ZB 4L8GA 2ZYVX 1BOFA 2B21A 1UBEA 2ZSEA 4LJ8A 2XX3A 2BIFA 3LO5A 1XFVO 2OBMA 4GFDA 2VLIA 5B30A 1NCXA 4G5GA 1JPNA 1VHTA 1FTSA 4XTCS 4CF7A 5DI3A 4HLQB 5J4LA 1WB9A 1OYWA 2ZN9A 4HSEA 1BIFA 3EPJA 1E1RD 4AKIA 1MR8A 3HDTA 4PE4A 4OHWA 1Q22A 2IYSA 2YC4C 3AKCA 3BD9A 3DM9B 4RVCA 4A82A 2FSGA 3VRQA 2LLTA 1EWRA 1BOCA 2JNFA 1E9BA 5TMPA 4D1EA 1CRPA 2QUZA 3F0TA 2PVBA 4RD2A 1WBBA 1M7GA 4QJ5A 1TRFA 1X1SA 1G3UA 2BKUA 4P32A 4RD6A 5DYIA 1VIAA 4JJZA 5D3MA 1QS7A 3SFVA 1O87A 4NZYA 1QXPA 2XOKA 2ZI3A 2AK2A 4MN0A 1S0UA 2QMOA 4BLPA 4M1OA 4GOKA 2G6BA 2JU0A 5J4VA 3HPRA 1II8A 1OJLA 1AVSA 2ZR9A 1YZLA 4GMDA 4AG5A 1MXLC 3OX6A 2YKGA 3A4UB 4C0JA 3MGCA 5FPKA 1TNDA 1X8KA 1XWIA 4W5WA 3GJ7A 2XTMA 5AJYA 3PM8A 5FBRB 4A0FA 2WMNB 4Z51A 4MSPA 4BLQA 2LP3A 1BLQA 1J90A 3K0EA 1E9SA 3L0OA 1SQ5A 3ZIAA 4NYMR 3CR2A 4PHGA 4R7ZA 3WMFA 2EFHB 2RGBA 4Y0VA 1YR8A 5FTMA 4HUQA 4FCWA 3RS2A 1N6RA 4NE2A 1KIMA 2PCJA 3SIBA 1DO0A 1MXEA 1SCMB 1G20E 2QAGC 3LX5A 4K46A 1GKIA 3ASZA 4MRNA 3RRNA 1Z8FA 2IL1A 1Z2CA 121PA 4FMCF 1KSJA 3T34A 4A4CA 2W6ID 2J87A 1FW4A 4UPGA 1IBRA 3LK0A 3D6TB 2ZYWX 4S35A 2BMEA 1OIWA 1NPQA 3NEYA 4C0SA 4PAQA 1VIYA 4A92A 3K70C 1GRNA 1NRJB 4CEHA 3BWDD 2BE4A 3N70A 4P4SB 1I4LD 1UBCA 3TLXA 4PC3A 1B7TZ 2OS8C 1LF0A 1ZVQA 2W2VA 4YGEB 5HR5A 1Q0UA 1JFKA 4Q7JB 2JDIA 3T1VA 4A2QA 5HKZA 2V7QD 4LZZA 3A37A 3OEHD 2HQ8A 5FTJA 1NYAA 1EXMA 3BERA 1TNPA 3ND8A 3VHXA 2DOQA 4PSVA 3I5GC 4KCGA 4TMWA 4V0ME 1R5BA 4LYFA 4PHFA 1JEEA 2O8FB 2BBNA 4N1GA 5I2OA 1Z0IA 2AXPA 2AXNA 2CNWD 3LBIA 3K9GA 4PO9A 3QEOA 4BLTA 3VTKA 1A82A 4GPTA 4DWJA 3AB3A 4EPYA 2WSMA 3HR8A 1CFFA 4KO8A 4WZ6A 4XWKA 1YR7A 3VR4A 2SCPA 1ZIOA 1GG2A 1NVWQ 3WBJA 4EIWA 1ZACA 4RSGA 4K81B 1D2MA 5JS8A 1E2MA 2BDTA 5G41A 4CYMA 1VHLA 4DB2A 2JJ1A 5CLLA 5HLVA 3M1IA 2F3RA 4PFSA 2JPTA 1X6VA 4DCSA 1ETUA 4PO8A 2M3WA 4E07A 2HYDA 4XWOA 5H70A 3SEAA 4PO1A 1OHHA 3CNOA 2CVFA 3TRFA 5HKKA 1UWOA 1EK0A 2EFEB 2ZRJA 2V6JA 3KEVA 4I5JA 1ZYUA 1KAOA 2A3RA 4HZUB 1O3YA 1CKKA 1TNWA 2F43B 2GGZA 1SVMA 1XFYO 4NCIA 1W46A 2GKSA 5JCPA 3I5YA 2QORA 3ZS8A 4MZKA 5FYXA 2ZRNA 4EPXA 3TE6A 1OZSA 1DF0B 3U6BA 1DJGA 2DFLA 4Z8XA 4A6XA 2ZRGA 5KPJA 1GZSA 3CF0A 1XTJA 2L98A 5CPVA 4HB0A 1YR6A 5DSZA 4EJSB 5G40A 4TWZA 2WVJA 3PIRA 2TN4A 3DVJA 4U7DA 1ZJ6A 4G5RA 2HF5A 4V0LA 2BBWA 4JLNA 3C16C 5FR1A 4PQRA 2AK3A 2MMGA 3EK7A 2IT1A 3KTAB 3OAAA 3M0EA 5HCIA 1QV0A 3AKYA 1ZNXA 3BFVA 4ASUD 2IYVA 2FE4A 3I5IC 1KMHA 2ECKA 3AP2A 3Q85A 4HAVA 3TNFA 3UMFA 5AUNB 5L3QB 2H2KA 1XFWO 4PALA 4U8DA 1EFCA 2W58A 1XD2A 1W44A 2J0UB 4GOJA 4YGBB 2JRFA 3AH8A 3W5IA 3ZJYA 2CE2X 1TQ6A 1RECA 2Y8EA 3GFTA 3J81k 2FGKA 1E0SA 2VQSA 4P33A 5ELXA 2O8CB 1WRBA 1KWOC 4NH0A 1DT7B 1CF4A 3GJ3A 3MUFA 3G82C 1G1MA 3NTUA 2RCNA 4PPNA 2CLDX 5F9FA 3R9XA 2FNAA 4AKGA 3O4YA 3PEUA 3RS4A 2L4IA 1IN5A 1E4YA 1TF5A 5FUVA 1W4RA 1UHIA 3FOZA 1FBVA 2JTZA 3AF3A 4KJZA 3EX7C 2BE6A 2RGNC 4IEIA 1VCIA 1X02A 4DSNA 2PMYA 2BM0A 1F70A 2BL0B 1SZPA 1Z0FA 2CBZA 2IEYA 2AFIE 2GXAA 1N6NA 2B6HA 3PFIA 3TS5B 2RGAA 4AYWA 3BB4A 5FOXA 4AC9A 621PA 5EXSA 3GJXC 2ZQ5A 3GK2A 4JBWA 1TQ2A 4D0GA 3EZFA 3K53A 2A4JA 3LCPC 1E99A 4XJKB 3OHMB 1SNLA 1SXJC 5SZIA 3BQ3A 4JLPA 4QL3A 3BS4A 4FMBB 4A2WA 1B8LA 2JLUA 1BMFD 2F9MA 2REOA 4HZIA 2BHRA 4OK5A 4URYR 4JPZB 1GNPA 3C5CA 2QI9C 1E2NA 4URXR 4TLAA 3DMDA 4HAYA 4V0NA 4DRZA 3AVXA 4CW7A 1NN3A 3IIJA 3FDIA 4A8JB 1A4RA 2F33A 4XSHA 4B3XA 1OB5A 5AFPA 4BY5A 2VP6A 1D9XA 1NMXA 1N3BA 3UMSA 5IBWA 4D4MA 1J1DA 2PZGA 1SKTA 4JWQA 2V7QA 4RD4A 1Z6YA 3OEHA 3RDPA 2D2FA 1M74A 1TU3A 2J0VA 2OZEA 2PLFA 1T0JB 1G16A 4CRWB 1DE0A 2AX4A 1WMSA 1IY1A 1G4AE 3EG5A 4RZ3A 3R8FA 2Z0MA 2NMVA 1NY5A 1ONBA 3W8RA 1S6CA 3TQCA 1Z6TA 2PMDA 2MLEC 3W9YA 4QJ3A 1MABA 5HPYB 3KDSE 3RABA 4NDZA 4Q02A 1HQVA 3GJ5A 1A7JA 1Q20A 2V4ZA 5KOYA 3C4JA 1QRAA 4N0DA 2MSEB 2QU8A 4LI0A 2ZI9A 1PUIA 1K9PA 3QE0A 4N3NA 1LTQA 2KE5A 2OILA 2QNRA 3GLGE 4PE7A 3FPAA 4UXIA 2M1KB 1KTVA 2XTNA 2LC5A 4II7A 6Q21A 1MWNA 2JJ2A 2W6JD 2EWWA 2FPLA 1E9EA 3CB4A 5FBLB 4M4SA 2ZRKA 3WRYC 2G3YA 3DF0B 4CVNA 1J70A 2IUUA 3BUXB 1U2RA 3IBGA 2QAGA 1SXJD 4A6PA 4IOLA 1PRWA 1SYMA 2YWFA 3KL4A 3V4RA 1VCOA 3QKSB 4B43A 2GAOA 3CKLA 3CLNA 2ZRLA 2VIIA 3KKQA 4AQJA 3RC8A 4IFBA 4PR0A 3QEJA 2MHHA 1WCV1 3OESA 2LMTA 1WY9A 2FFAA 3K9NA 2CXJA 3VGOA 421PA 2V54A 3SHWA 3AVOA 5DKNA 3A4MA 1IKUA 1KZ7B 1PVOA 4C30A 2OSBA 1XK4A 3SBEA 5M04A 3A1SA 1E2QA 1XYDA 1A4PA 2GTPA 2M0RA 1XX6A 3K09A 4PHNA 5KSPA 4C0KA 2C2HA 4KHZA 2P5TB 4ASUA 2IF2A 5JS7A 3W8NA 3TAUA 3HU3A 1G3QA 1J1EA 1G8HA 3NH6A 3LVQE 3U3MA 1TNQA 1PUJA 1VG1A 1MO3A 2C5LA 2O0JA 2XNDD 4ZDKA 1U9IC 1W36B 4TT3D 1KK7Y 1KZGB 4AKEA 2PT7A 2FPMA 3QKRA 3CPHA 2K2AA 1V5WA 1CLBA 4Q4JB 2ZROA 1WDTA 1G41A 1OXUA 1GTVA 2CTNA 1JXMA 1KSHA 1YVLA 1H8HA 1GL6A 2A5JA 3HP1A 4NPHA 5DN6D 1IXSB 3NHAA 4MYCA 4KSCA 1A2BA 1IH0A 3VQTA 1OQPA 1CR2A 1XTQA 1WA5A 4ZIRA 3TMKA 1CJVC 1E9FA 4JBYA 1GNQA 1Z63A 5DKRA 4XD7D 3EAQA 3Q5EA 4MGIR 4RZUA 2GJAA 4F4IA 1R0YA 2DFNA 2GNOA 3FIAA 3GD7A 3W6OA 1XFAA 1Z0KA 4BZQA 2QBYB 3C14C 3OFNA 4CGZA 1RKBA 4UNSA 3ZD7A 1RZ3A 1BF5A 2NCOA 2GBLC 2EU8A 2KBFA 2LCPA 4R2IA 1SY9A 3KKPA 1XF9A 5KUTA 1KO8A 4TNCA 4Q9KA 2EFGA 2JJ8A 2BBSA 4KODA 3K0AB 1IJFA 1XJ0A 4RJLA 5JRJA 2C77A 4PQFA 5EP2A 3SIAA 1XEFA 1ZNYA 1DJZA 3TDIA 3B82A 2VA8A 2OE2A 5CIWA 4M1YA 3CRQA 3UANA 3GEIA 5HKWA 2GHIA 2ZSAA 3AGPA 3IQQA 3MWKA 2IWHA 1L2OC 1S1EA 1P72A 1P5ZB 2NO9A 2ZJ8A 1R2QA 5CDFA 3WHUB 2Q21A 2QQ0A 4KU4A 4OCIA 1G21E 1LF5A 3GP8A 2ASEA 4C0QC 5JSZB 4I5LB 5TDHA 2KBIA 2O8BB 4EDHA 5ER5A 2DB3A 1QX2A 1FQJA 1CDMA 4YGDB 4YDHB 1N6LA 4YGCB 1HQYE 1U8YA 2C8VA 2H5EA 2NZ8A 4GNKA 4LX0A 1QLKA 3T06B 4EPWA 2AMIA 2QP9X 5EE5B 2O8DB 4TMZA 4B6EA 1ZNZA 4UNRA 1CR1A 3AQ4A 2LANA 2XJ9A 1ZW6A 2ZR0A 4JVMA 1MT0A 4QHYA 4URUR 3SJSA 3GOFA 1OMVA 3QSYA 2I3BA 1MOZA 2CCJA 3LLEA 2PEZA 2ZE7A 3IUYA 2GAAA 2RGNA 1FF1A 1CJKC 2ZVPX 1FL9A 4OI4A 2ERYA 4Q1EA 2ZS8A 4Q4AB 1CM1A 3BXKA 3CNNA 2KDHA 3D10A 3RRYA 4P5OE 2GXUA 4Q1BA 5E4FA 2FEMA 4GT1A 3ND9A 4KVAA 1Y63A 1SCVA 1B4CA 5BPJA 4PHKA 1DAFA 3FWYA 2E1RA 1QVAA 1CB1A 1LV7A 1VKJA 4N1AA 4B2LA 2DPXA 3U7HB 3TUJC 1R2UA 1TN4A 3TQFA 1E8AA 1OE9B 2HV8A 3TW8B 1GAJA 1RJ9A 4EAQA 3TSOA 2I18A 1CJTC 1SXJA 2PCLA 4RD0A 3U4QB 5JWHA 4HRHA 1E2KA 2QTHA 2WWXA 4MRRA 5IHPA 2DWQA 4TL8A 3RANA 2XEXA 4LV6A 3I32A 2JT3A 3VU9A 3ICEA 3X1DA 5KDLA 1FW6A 4M9ZA 2F2PA 4LYHA 3TUIC 4JLBA 2TMKA 1NX2A 4JQ0D 1N2DA 2L2EA 2NTYC 2QTVB 4LPSA 2CLCX 5BN3A 2ORWA 2ZXUA 2F3TA 2YVUA 4JKYA 1EL4A 1CR4A 1DO2A 5B58C 1TF7A 3B7GA 1G3IA 2IYWA 1JPJA 5EXXA 3T1TA 3REFA 1NWDA 1FUKA 1US8B 3IQOA 1WE2A 1Q1EA 1UDXA 2I1QA 2JCSA 2OFXA 3MFYA 3P26A 4M2LA 3IEVA 3AVYA 2REBA 4YC7A 3GEEA 2JLRA 3A8RA 1R0ZA 4XH9B 1IQPA 1XB2A 2L0XA 1CDPA 4TT3A 4LY6A 4QJ4B 1KSOA 5KU1A 4G5OA 2MRDA 2KFHA 1Q3TA 1XXHE 1ALWA 3EKJA 1M2OB 4UXJA 1UKZA 1TEXA 1Q21A 1AHRA 3VNVA 5FI0B 3KPXA 2LMVA 1Z2AA 2ATXA 2IHYA 4LYJA 2O52A 5GJWC 3NXAA 3IQWA 4JT4A 1UFQA 2C95A 3DPUA 3DZDA 2JTTA 2XZLA 2V1XA 3CZQA 4FMDF 4XD7A 3RSLA 1KFUL 1G8FA 4B47A 4ABYA 2ONJA 1QX5B 3JTDB 1FI5A 2MSCB 1GKYA 1Z07A 4ZDJA 2KAVA 1E2EA 1LNZA 1IJ6A 1X8JA 3GFPA 4S2EA 1GVNB 2VYFA 3PUZA 1A5TA 2G0NA 3FE2A 2VP0A 2XB4A 2XSZD 1BS1A 1Q1BA 1FI6A 1EFHA 1DAKA 4B34A 1HEIA 1Y3AA 4F91B 3B13B 1K5GA 4OI0A 1TF2A 4NP6A 4TLCA 1ZM4A 4HYYA 4LBWA 5JI2E 4GL2A 1JUOA 5DNYB 1S5GY 3JVUA 2VL7A 5CK5A 4ZI2A 4HREE 4IW3B 1BR1B 1NLZA 3M6AA 4HSZA 2QPTA 3BB3A 1P7CA 2KBEA 2V6IA 1H8BA 4PPGA 1NX0A 3BFKA 4BFSA 4IOKA 1CNPA 4MUAA 4KFTA 5JWRA 4OJKA 1R6BX 2ZRAA 1AK8A 3BIFA 3IO5A 3P4YA 3PEYA 1RC8A 1OMRA 4D80A 1P4SA 2DHRA 4BZXA 1A75A 5A5GA 5TB5A 1E98A 4B3DA 1PULA 1S4QA 1QVRA 2CCKA 1DPFA 2FF7A 2JIZA 2R6DA 4NKRA 2F7SA 5SZHB 1AJ5A 2CLSA 4TYQA 4TMKA 1Z6AA 3NBFA 3KQHA 4N5XA 1GL7A 2ZETA 1SR6B 1G8IA 3AF0A 4A2PA 1KJZA 1JAHA 1U9IA 2DWPA 3PALA 3DZ8A 1G4YR 3VFDA 3THWB 3EZ2A 2QTFA 2WJHA 2VP2A 3PCRB 5DO9A 3IIKA 2IUSA 2IS9A 2K7BA 2YHSA 3H4MA 4EUNA 4QM6A 2XAUA 4Q7LA 4D0NA 3IDQA 1NIJA 2GJ8A 2PH1A 4ZDIA 1CMGA 1W5TA 4M2QA 1Q12A 1WRKA 1I2DA 2YC2C 2ZTSA 5LB4A 1D2NA 1NBMA 3NH9A 4EJSC 1GITA 4DDVA 2WAXA 1BKDR 4PHMA 4DSUA 3SG2A 2BBOA 3QF4B 1KY3A 4PAOA 4TL6A 3RS7A 1JEDA 2KWIA 4URZR 3ZIAD 1DJIA 4IVPA 1AN0A 1II0A 2KAYA 1DGUA 1RROA 2D7DA 1AKYA 3W6PA 5DYGA 2IC5A 2NG1A 3KUCA 3OB2B 3CUEF 4M0LA 1CEEA 3LW7A 4M53A 4WZAE 3ZVRA 5L8VA 3A1WA 1J7QA 3JVTB 3CX6A 2J41A 2JLYA 3QKUA 3TVTA 3KHEA 2BEKA 4CFQA 2M9GA 1F71A 2ZRIA 1CFCA 4Q48A 2R9VA 2BCBA 3PV0A 3S1AB 1HE8B 2WOSA 3ADKA 4YXWD 1OV4A 4XVUA 2IYLD 2ZUDA 1TNXA 1XFXO 5E95A 1MUXA 5FPTA 3ADDA 1S9DA 1SK6D 2I4IA 4PQYA 4QFMA 1CM4A 1ZBDA 3D3QA 5EP1A 5J5CA 3LNCA 1CJMA 2IWRA 5BYKA 3X1XA 1R8SA 1G5PA 2FWRA 2JDID 5AJXA 2IS1A 4F92B 1E2FA 4B35A 4LBZA 1JQJC 2QZ4A 3QXSA 4CZ2A 2M29A 1F2UA 4PDZA 2HJGA 3QIAA 4O25A 4QGAA 1BU3A 2BL0C 1ZU5A 5L3SA 4FIDA 1J7RA 3U5ZB 1P61B 3EXAA 2EFCB 3BGWA 4AI6A 2ATVA 3AKAA 1TCFA 4KBFA 3RHFA 4QM7A 2XXAA 3TS5C 2H61A 3QPUA 1Q57A 4U5XA 2K7OA 1UF9A 1X8LA 1MRNA 2ODEA 1WXQA 1JSAA 4IHQA 4L15A 4TYWA 3G5UA 4WIAA 2OXCA 4CEIB 3EZ7A 3IHLA 5JZVA 1QHHB 4GDFA 2ZRSA 2X2EA 4TZ0A 2GF9A 3I8XA 2M97A 3OIWA 1NX1A 1NSFA 1F8HA 1IHUA 4CLNA 4ZI3A 5F98A 1PVBA 1YU9A 1DVRA 2PJZA 2H7VA 3T5DA 5AK0A 2FX3A 2NGRA 1Y1XA 3HWSA 3CH5A 3WYGA 3ZZ0A 4ARZA 3U2QA 4OK6A 4Q47A 5EE0A 1QVIZ 2R6FA 1Y1UA 3BUOB 1QASA 1SPYA 2NCPA 4MBEA 4E68A 1XEXA 1YVDA 2ZRBA 3HYTA 4LJ5A 1G8YA 3CIOA 2BOVA 3NDPA 1COWA 3T5GA 3JZAA 3GJ8A 4A8JC 2Q3MA 5AXIA 2BBTA 4MH0R 1JF0A 2C78A 1AM4D 2XSZA 3OIVA 2WNDA 3QPWA 3CRVA 3ZD6A 1EFTA 2XJ4A 4IRUB 5JOLA 2IYUA 4HAXA 4LCBA 5CK4A 5DKQA 1W47A 3DMNA 3TUYB 2GRJA 4HAZA 4R71A 1M31A 1RFJA 3CTNA 3THXA 3NSOA 1DOAA 3KQNA 3RWMB 4NYJR 3RRMA 4XVQA 2ZN8A 4GBAA 1FX0B 3UKDA 1W2GA 2ZAMA 3PSRA 4JL8A 4D82A 3LVRE 5L3VA 1RIFA 1SKYB 2Z6VA 2O5GA 1MO4A 5IDVA 1WBDA 4DLUA 4NYJQ 2VF8A 3OAAD 3VAAA 3MMPA 3R7WB 3IO3A 2GEDA 1T91A 2YV5A 3EKHA 4FMDB 3QF7A 1PALA 2LVIA 1CKEA 3HU1A 5C4MA 4ZCIA 3TR0A 2E6WA 3VKHA 3GCGA 1ODFA 3IPXA 2WIBA 3OF5A 2GJ9A 4GP6A 4PPFA 5F3WB 4EQ6B 3THYB 2NO7A 3RAPR 5HKYA 1U5IA 1GILA 4YDSA 1BYUA 4ESHA 3KZ1E 4HAUA 1KFXL 4ZCUA 3CWZA 5TV2A 3ZS9A 1JI0A 1WDCB 3PXGA 1UHJA 2GVZC 2Q6TA 2IYXA 4DVGA 4C2UA 5CSNA 2GCOB 3NC0C 4U02A 1D8TA 2J7KA 3AV0B 3BAFA 2BEJA 4MUBA 3EK8A 1UPTA 3ZVMA 4FCTA 1KI6A 5GJCA 1DAMA 4LJAA 3UG7A 2XTZA 2WJGA 1IONA 1ZFSA 2FSIA 2ONKA 3O8RA 2FZLA 5ANRB 1G291 5JBQA 1P2UA 4FCVA 4MRVA 5TXGA 2EC6B 3KQLA 4BPBA 2NLNA 2FSHA 1KI9A 3CPEA 1KGDA 3LX8A 4GI7A 4OK3A 4ORCB 1F2TA 4V03A 4WA7A 1XO5A 4DUQA 3IHWA 5LBIA 3W34A 1YTZC 2RHMA 1UKYA 1BG1A 2BBMA 1Z08A 5DI3B 1EH2A 1RYHA 1XU4A 4CFRA 3BOWB 1MF8B 2QL6A 1T4GA 2Z5FA 4Q4HA 1YJ5A 4HRGA 1Z29A 3GLGA 1KNQA 1XEWY 1HT2E 2C98A 3TSZA 2F2OA 3WRXC 5CJPA 1W36C 1JC2A 1DAHA 1U90A 4YXWA 4PXAA 2PT5A 3GLFE 1DGVA 1QHIA 1GM5A 1GGWA 2OAQ1 3FHCB 2KI6C 2ZJ5A 3K0SA 1TEVA 3B9QA 4MITA 1UDWA 2OM2A 4BFUA 4A1FA 1OE0A 1U8ZA 4LDJA 4ZCVA 1T3HA 1OH7A 3SQWA 2AL7A 1OH8A 1F5NA 4ILEA 2KAXA 3PENA 5J40A 1II8B 2CVHA 1F48A 1TMKA 4PPQA 5J4KA 1TAGA 1W0KD 2QE7A 1UHNA 2RGCA 1L2TA 2KOTA 1D9ZA 1Z3IX 3N2EA 1E2DA 4FW9A 4IDNA 4TTQA 5BN5A 1NBME 3WHKA 3MJRA 1WF3A 3HYRA 1UHKA 1KI2A 2BV3A 1M39A 1KYIA 4ESVA 5JFGA 4DXAA 2WORA 3I5HC 3RYTC 5FL7A 1IN6A 3C15C 3LBNA 2A7QA 2IYRA 3A1TA 2KI5A 4DSTA 4B32A 3LV8A 2WKRA 4E5UA 4HUQB 1G19A 1SVWA 3X2SA 3KXKA 2P6RA 1ZM7A 4A0HA 1JBKA 4JLMA 5JJIA 1CFPA 1KK0A 1Z0JA 4FD2A 2E30A 4EJSA 4TMXA 4B33A 1I4DD 4DUGD 5JRZA 2FCEA 1AA9A 3I5FC 2D62A 4B6FA 1S9HA 2NQ2C 1WRLA 3IKJA 1N5KA 2QENA 2JJ2D 4KXFB 4DBLC 2K61A 2D4HA 3SU8A 2BC9A 4TMTA 4C9BA 1TTTA 1ZUIA 3L0SA 3P1JA 4CEHB 4AKHA 2O8EB 1N5JA 4Q7MB 3QPVA 3K0CC 2F9LA 3NHBA 3QQ5A 5DHFA 1OMDA 1RRGA 3FTQA 4WAUA 2A5FA 3BYAA 1ZIPA 4QBFA 4JVNA 4ZCLA 4NCHA 3QI2A 5LB2A 2DFKB 3U7FB 3P27A 4L9MA 4I1VA 1NL3A 1YURA 2WICA 2JA1A 2IXFA 1G18A 2EWVA 3FHOA 1A03A 4GGNA 1DMOA 4TLDA 3K70D 3DO6A 3GJ6A 3LQRA 3U7EB 2K0JA 1N65A 1A2XA 1KNXA 2RGGA 3EC1A 3Q72A 4ZO4A 2N42A 4IDQA 3K9LA 3LK1A 3L2OB 3U44A 5I2LA 4NDBA 2VSOA 4PC1A 5DH9A 2OUKA 5EUQB 2FZ4A 2W0MA 5GJBA 4HB4A 1OYYA 1YQTA 5FFMA 1DJYA 3BUWB 2JLVA 1G8PA 2ZEJA 4M21A 1E4VA 5CYPA 3GLIB 1QHGA 3OE7A 3H2YA 3L0IB 5BWMA 1NN1A 2J5XA 1DAGA 1NCZA 4IVRA 1CP2A 1ZC3A 1EWQA 1DADA 2G83A 3WHTB 4LJ4A 1K90D 2ERXA 1H8HD 3KB2A 1TUIA 3WP1B 3CRW1 2DR3A 3TUZC 5KPDA 3BOSA 4RFSA 3OHMA 1SRAA 1DAEA 1VYTA 1RTP1 3NBZC 5EP3A 3RLZA 2ZR7A 2M7LA 1P2VA 2XZOA 1T5LA 2FU5C 3SG6A 2WWFA 3GQBA 1AUIB 3WXAA 1E32A 2ODNA 2PMKA 4JL6A 4B44A 5H8WA 3NVAA 1JNYA 3OFND 4YBHB 2E87A 2OTGC 1QHXA 1WP9A 2OBNA 3MG9A 5C18A 2OXRA 4QBIA 2FOTA 1CS4C 5I2QA 2OO7A 5HCNA 2X2FA 5KYKA 4XYNA 1F54A 5DISB 3ZH9B 3KX2A 1KY2A 4ZKEA 2LCFA 4AK9A 2YOHA 4BLOA 2AWOA 5TARA 1J55A 4CIDA 1HA3A 2BCGY 3L8ZA 4MA4A 4BGDA 1S3PA 2BKEA 1NKTA 1W4BA 2CCGA 3AP1A 4LWZA 1YRTB 4B3FX 1KMHB 4R98A 3M4YA 4QBHA 4UXHA 1N0YA 1K9UA 1GWNA 5LDDC 3PN7B 1E0JA 1XD2B 2J59A 1S26D 1KAGA 5C46F 2HPSA 1IGVA 4Q1AA 1BR4B 2UVQA 4TYPA 2AWNA 1S1MA 4E09A 3EIHA 3OP0A 1L8QA 1ZM3A 2GZHA 3CONA 1A29A 1HT9A 1T8TA 2F6RA 3CR7A 5D69A 4UJ5A 2OEPA 2GZAA 3ZQ6A 4D4JA 4TYYA 4QHSA 2JOJA 4RCZA 1NIPA 2FEOA 1Z22A 5CSIA 4JLJA 1GUAA 3CF2A 4XJXA 1W0KA 2NO6A 3JZMA 1ZNWA 3BBPA 4E22A 2ZVQX 1E0KA 2X19A 4A15A 4ORBB 2R44A 3GMTA 1SMGA 1ZAKA 4M1MA 1DJWA 2Y1NA 4ICBA 1M7HA 1AIPA 1PLLA 1TL7C 3ZZUA 4DRWA 4E03A 1XD9A 2R6CA 3DVEA 4LHWA 5FTKA 2PRUA 2FFHA 2GJKA 3TSWA 4BECA 1Z0AA 3SR0A 2JEOA 2ZE6A 3GLHB 3ICQB 3FWCA 1ESNA 3HPQA 3NG1A 2QT1A 3IQXA 5D7FA 4OBEA 3UMRA 3PG5A 4C0LA 4OHVA 4ACAA 2CHVA 2YJTD 3BH6A 3QBTA 2JULA 2XITA 3Q7PA 1XJCA 1T3LA 2O5VA 4X8MA 2WJIA 4D81A 2CCMA 4DUGA 3ZZTA 1EG4A 1DJXA 1SULA 1UBFA 1KSFX 5F2EA 1ESMA 1FUUA 2QGNA 1XXHA 3AGQA 3GPLA 4LJ7A 1RYFA 3UK6A 3EIQA 3SHFA 1B47A 2QMUA 2L0PA 3V9PA 3CO5A 4NHOA 2D74A 4QG7A 5CIQA 2ZYTX 3T1QA 2ZI4A 4Q9LA 1LA3A 3EWSA 3EZ9A 4YONB 1YZTA 4Q1CA 1IN4A 4DB4A 3T35A 4GGFC 4YMVA 4EPTA 1GRQA 1SR6C 3SC3A 5CJ2A 4OR9B 2HF8A 1I2MA 1IOZA 1IY2A 4TMVA 2BCJQ 1UEIA 3GJ0A 3B9PA 4LRWA 3ZLJA 4DCTA 3DD4A 3AP3A 4ORAB 4JL5A 1TTXA 3B6EA 1AGPA 1GDDA 1N5IA 2X1VA 3NBXX 3QY0A 4UNNA 3SDZA 4A36A 4QJ3B 2CJWA 3AVVA 5ER4X 4AURA 1N6IA 1K96A 4D2IA 4FN5A 1K6MA 1JF2A 3C1VA 1X3SA 2VHUA 2FJUA 1OFIA 3K0FB 2WHXA 4LV5B 4DJTA 5BYJA 1KHTA 2G1JA 3LXXA 2QQEA 2HLDD 4F38A 2H92A 4QNMA 3FHTA 4BFYA 5AJVB 5H68A 4DLSA 3SJBA 4Q9HA 3U3RA 3EZ6A 4L9SA 3FB4A 3LBHA 1J99A 4LK2A 2NO0A 1QTXA 4JKIA 4B73A 4I1OA 1M63B 3K0AA 1OB2A 5KNDA 2IUTA 1E9AA 1OF1A 3ZGXA 2QAGB 2RHDA 1P6XA 5CYOA 3K8YA 3KFXA 3MWYW 5FOWA 821PA 3F3YA 1OH6A 1OXTA 4AD8A 2NXQA 2BJWA 5E3HA 1ZU4A 4NBSA 1JB1A 5JMTA 3DVLA 4QOSA 3RVBA 2QM7A 3AKBA 4M1SA 1OKKD 2VHQA 4Q7KA 3JVVA 1F60A 4JMPA 4LV8B 3NSKA 2KFGA 4BY4A 1XCMA 2C96A 2WJJA 2BMJA 2GCNA 3CRMA 4PTLA 4MRYA 1KOFA 4JVLA 2FSFA 2PALA 1KO4A 3PUWA 1IN8A 4GFTA 1KI7A 3KJGA 2J0SA 4BQSA 3PITA 2MAZA 1K8UA 1G33A 1VPLA 1KDPA 3CX7A 1B7TY 2DY1A 4KSBA 1XPRA 1OXXK 3O6BA 2ZANA 2JT0A 4IJMA 4TLEA 1JWDA 3ZDQA 4TTRA 2IS6A 3I1FA 1AJ4A 1Q3HA 2KI4C 1R8QA 4PZZA 5CITA 5GVSA 4AY2A 3EC2A 2I94A 3BFXA 4PANA 5FPSA 3TK1A 1F3OA 2IEZA 3A1UA 1LW7A 2W2XA 5E7IA 1W0JA 2QPAA 3RC3A 4V02A 2Y4QA 2F1RA 2FDCA 3C8UA 3QKRB 2V3CC 4WBSA 1ODBA 4KVGA 3K21A 3BRWD 2R62A 4WW0A 4RFVA 2JIZD 5E7MA 4Q4AA 3UATA 4AYXA 3UPUA 4RCYA 2P65A 3B8HA 4ZIRB 5AANA 4MRPA 5KDOA 2MBXA 3B5JA 1VCNA 3PUVA 2JNXA 1SW8A 4HLCA 3SE0A 3V4FA 3CF6R 3GFOA 1V43A 1GOTA 1AS2A 1UEJA 3MWLA 2NO1A 4MGKR 1XMVA 3FKSA 1JXOA 5FR2A 3A36A 3X1YA 5EZ5A 3TUYC 3QXHA 1LVGA 4ZKDA 3W90A 1NBMD 1KFXS 4F93B 4F4CA 1RRFA 3WMEA 3CWGA 4US0R 3FS7A 1E69A 1Y6WA 1ZCAA 221PA 1UUSA 2HQWA 3FGNA 4QGFA 1C9KA 1QF9A 1BMOA 2GJSA 5K8LA 3DHWC 4DZZA 1S3GA 2ZJZA 4LPKA 1G7RA 2ZUCA 3VR2A 4DLXA 1LKJA 2QP3A 3QNUA 3N2IA 4MGYR 1EG3A 2AHOA 1M6NA 5JEEA 1E2IA 4PC2A 1OT3A 4IFEA 1JR3A 5HTKA 4ERNA 1OH5A 3B1WA 2BCXA 1NNEA 1M45A 1QBKC 1T9HA 2MSDB 2IS2A 4Q01A 1TCOB 3KO0A 3GK1A 1ZOTB 1DBSA 3H0KA 3U6KA 5KNBA 1N6PA 2SHKA 2ZU6A 4MGZR 2X77A 4BFZA 2ZUBA 3TH5A 4A4DA 1KJYA 2JLWA 1JALA 4Q04A 2F1HA 4UQOA 2C03A 5DHAA 1WDCC 2GA8A 1M7BA 4QJ4A 3PLFB 3VMFA 3WYAA 5C1BA 4GNKB 2G2BA 4UNQA 4DSOA 2L5XB 2ZRMA 4YI9A 2PASA 1P62B 2LP2A 1MH1A 2F1JA 3UXMA 3K1JA 1H65A 1WLZA 4IXMA 1NN0A 3CNLA 1C7WA 3A4NA 4YMSA 4W9MC 4DT1B 4EPRA 1SVSA 5JLJA 1N0WA 2ZIAA 5FUXA 1QHNA 1ZUZA 5DE3A 3L8YA 3O8DA 4ZDWA 4NDCA 1P9WA 2HLDA 1IQ5A 2GDJA 4Q03A 3DOFA 1NJGA 3DM5A 4KLNA 4W5JA 1KSMA 4MRXA 1C7VA 1EFRD 1SCMC 1OXSC 2I2RE 1Z6XA 4FI3C 4LBVA 1ALVA 1FPWA 1ZD1A 4A0GA 4M9QA 2GV5A 3BE4A 3KUDA 4WOPA 1LXFC 5TY0A 5BXQC 3LL8B 4LJ9A 2JXLA 4YI8A 1SXJB 3I73A 3KJEA 4HDQB 4LGMA 1OW3B 2XGJA 3E70C 4BLRA 1K93D 3LXRA 1COWD 5HE9A 3VU9B 2JZIA 1D5CA 4MRSA 5J47A 1OKKA 1KMQA 2G77B 2FGJA 1EFUA 2YZ2A 4BFTA 2BKIB 2WOOA 3I5XA 1N6HA 3BUMB 2LWIA 1XDBA 2OBLA 3FVQA 5EE9A 2KYFA 4Z54A 3R9WA 2FMXA 3ZVLA 1XMJA 3EPLA 1S6JA 1TQ4A 4OHZA 3SZRA 2GESA 2OT3B 2ZSDA 1HH4A 2VF7A 4OQLA 2WKPA 5IF9A 4GGFA 2WWYA 3A6PC 1AZSC 1XFZO 4URVR 1F4OA 2KFFA 3I92A 3CWQA 5JWOA 4C7OA 3BJIC 1N5LA 1JBAA 3AUYA 3FFBA 4CEJA 1U0LA 3IF7A 2ZKMX 3PFVA 3AEZA 4FTGA 2NIPA 2D2EA 4XOIA 2JGNA 3RS5A 1G9XA 2O60A 3SQXA 3SG5A 1FP7A 1LVCD 3LLMA 4TLBA 5JECA 3KJHA 1ZINA 4BUJA 2BVNA 2EVWX 4P4UA 3RWOA 3E2IA 4NONA 3GLFA 4I1SA 1KI4A 1KK3A 4W7SA 4DEXA 4DHEA 4RZXA 1Z06A 4PE0A 1E9DA 5KSOA 3O8CA 3MRSA 1NSTA 4I4LA 2J46A 1T6NA 4NDDA 1PZNA 4DDWA 3T61A 3MCAA 4MZLA 2GK6A 2PX0A 5FOUA 3R9IA 1UHHA 2OV2A 3PUYA 3ICBA 2W83A 1XPUA 1B8CA 5EZ6B 2WCEA 3C5HA 2OFOA 2AR7A 2UKDA 4QGGA 3QENA 4NCNA 5BW8A 1DEKA 2VSXA 3D8BA 1G4UR 3DVKA 1YHNA 4M8NE 2ZNDA 1N6OA 4PHTA 3EVVA 3PQCA 3TDUA 1CFDA 2OCPA 3Q8XB 5FUYA 2JC2A 3KKOA 4XIGS 1U98A 1SHZA 4JS0A 3VKWA 2HETA 2ZI6A 2KBMA 2KYCA 2GBLA 1E2PA 1E2LA 4US2R 3AKDA 1G7CA 2WTUA 1A75B 1AGRA 4YMWA 2I1VB 2KB0A 1NVUQ 4KLZA 5CSFA 4BWYA 1J7KA 2PZEA 2J1LA 1UKEA 3HR7A 1S96A 2PX3A 3ONWA 4H1UA 1EXRA 3FMIA 4HATA 4R2HA 3NSIA 3TAHA 4KI0A 2G88A 4ETOA 3CR8A 4BEBA 1AP4A 3AVWA 3B60A 2A2ZA 4D4LA 1D1OA 2VBCA 4LUCA 2ZI5A 3E3RA 4MKIA 4P0TA 2ZFDA 3D0YA 1DG1G 4HDCA 1PSBA 3QXXA 5G3YA 4GOXA 1SVIA 3WNXB 3FMOB 1HTWA 3TVDA 4BE7B 4Z1MA 1S6IA 2LLUA 4TQAA 4YLGA 1Z28A 1N25A 2C04A 4M9XA 1YRUB 2KQ6A 3HCMA 1IAQA 2QE7D 2IXGA 3QBVA 1U0JA 2IW3A 3SJCA 1E3MA 3VRNA 1W48A 5A0FA 4R1EA 5AERA 2P6NA 2PZFA 2AAOA 1KKMA 1QHSA 2Z43A 3T1OA 1RFLA 2LAPA 4NTZA 1GIAA 2W00A 2Q3FA 2IX3A 4EFMA 2RAPA 4I5KA 5J3XA 2OG2A 5FL7D 4DCNA 5KSZA 5KTYA 1EFRA 3PJRA 3QJYA 1DTSA 3CS1A 1XBTA 4DCUA 4P2YB 1JR3E 1IY0A 2FG5A 1KQMB 4QKQA 2DYKA 2P3SA 4POAA 1ZUHA 1SVKA 3PN7C 1E1QA 3WP0A 1F55A 2LUXA 2Q9AA 1GNRA 1PVAA 1RVDA 5EUMA 3N5CA 2ZJBA 3BK7A 5B2ZA 2WIAA 2Z4RA 1ZM9A 4HLUC 2K8MB 4JSYA 1G3MA 2AUCA 2D06A 4HDOB 1GQMA 2K7DA 5J4HA 2WKQA 3LH5A 1C4OA 2WPDD 2UZ3A 4TN1A 5LPNA 4OHYA 3KQKA 2KHNA 1D6JA 4G0NA 4Q00A 4X8HA 5K89A 1XTIA 3TKLA 4MQBA 4G3XA 1F2UB 3A4LA 5L3SB 4EQ6A 4FXPA 4C0HA 2VP5A 3X1WA 1Y1AA 4DIDA 4IXNA 3AF1A 5KSYA 2XZPA 5GVRA 1KDOA 4DEYA 4L16A 2QY9A 3IEUA 4LBYA 4URWR 1FTNA 4OV2A 1QX7A 2JLSA 4LJYA 2LM5A 4A4BA 4NYIR 3SS8A 2F3YA 2GCOA 5JHGB 1LFDB 2FA9A 3OX5A 1G5TA 1CR0A 2WZQA 3P20A 4H1VA 3SYNA 5K8TA 4M22A 1YVHA 2IYZA 3DKVA 4NYIQ 5CM8B 1UM8A 3UIEA 2H1LA 2RMKA 1NVVR 4KFUA 2QM8A 3OE7D 4GPLB 1B0UA 1PK0D 1EGAA 4WQ2A 2FPKA 3AVQA 1Y0VH 4OKSA 1LS6A 5EE3A 4ARZB 1RW4A 1NIWA 2JLQA 1E2JA 1K5DA 3EWAA 5BN4A 1AK2A 2HUPA 4MYUA 2AKYA 1NVVQ 1YUTA 3EVRA 2E9SA 2ZRHA 1W7IB 4R9UC 1XEXB 1QG2A 2WSSA 3CM0A 3EARA 1J2JA 1W49A 3BH7A 2ANBA 2ZYUX 3BOWA 4K8OA 4AQIA 2CL6X 1Z5ZA 1AS3A 1ZM2A 2WWIA 3NEJA 3WNBA 2LLSA 3BC1A 2C9CA 3THXB 3MSEB 3A1VA 2HT1A 5EJEA 2GF0A 2P67A 1BODA 2Q9CA 5D3QA 2PL3A 4P4SA 1EESA 3MSXA 2IA5A 3TR5A 1S36A 2B7BA 1XTKA 2Q0HA 2ZREA 4Q9IA 4V0OA 5IT5A 3NKVA 4B3GA 1J8MF 2FH5B 4L9WA 3RS0A 5B64A 3GEHA 2XNSA 1E6CA 2NOAA 1NX3A 3EASA 4N1FA 1M1YE 5G53C 5B8IB 3VHLB 1P75A 2LMUA 2V53A 2Y5IA 3CR4X 1T3SA 1KK7Z 2EW1A 2WM9B 3H86A 5EXTA 4AG6A 1CJUC 4ITRC 2O8FA 1PJRA 3LY5A 1CTRA 3SYKA 4QJ5B 4WZBE 4DLYA 1U5IB 1B1GA 4GBMA 5D3MB 2CHQA 2QPOA 3LFUA 4DCVA 3KF9A 2WWHA 5FTLA 3CR5X 2LUCA 1R7RA 1ZD8A 4Q66C 3SOPA 4GZMA 3SNHA 4NYMQ 3F45A 4U00A 5FBQB 1M34E 3CPJB 1MO6A 2ZRPA 2LVVA 2B8TA 1NG9A 1BT6A 3REGA 1U94A 2J7PD 2P0EA 5DLQC 3QUSA 1KI6B 2M7NA 2GXQA 1AQUA 2G0TA 2KQYA 2VSFA 2IHBA 2ZJ2A 2H17A 1HUQA 5AUOB 1TOPA 1SGWA 5EE1A 4NQGA 3H84A 3BUNB 1N2CE 4HZUA 4OJQA 3CGAA 5SZJA 2F43A 2O8EA 1XK4C 3AF2A 4BFVA 2WBLC 4USLA 3IIMA 1F2TB 1S3SA 1U99A 2ZJYA 1W5SA 1ZC4A 1KK8B 4JLVA 3K09C 2WCBA 1BJFA 1L7ZA 1DF0A 3R20A 4M1TA 4NCKA 1G3RA 5K8IA 3FWBA 1HQCA 4MKHA 4Q4HB 2VTKA 3C41J 4O0MA 3BB1A 3GLGB 1OPXA 2GWHA 2D3WA 3TIFA 2M49B 2YWGA 3X1ZA 1DG3A 1R5NA 1P2TA 4L5BA 1QJTA 1FNNA 3KTAA 3R8CA 3ZQJA 2Y1MA 4I99A 5KNCA 3CRRA 1SL7A 4FINA 1QATA 3Q7QA 4OYHA 2OAP1 4AYTA 4YMTA 2F8PA 1VYVA 2WPDA 5AR1A 2BMFA 4TL9A 3WMGA 2P6UA 5L3QA 4IEEA 1LY1A 2CK3D 1ANKA 5SZKB 3SI7A 5CSJA 1NY6A 2J0UA 2ZRCA 3GLIA 2P6BB 4PC7A 5IK2D 3NIBA 3U3OA 2YOFA 1W36D 3RSOA 1B8RA 4NU0A 2O8CA 3IGFA 3HJNA 4B76A 4G5QA 4PX9A 3KKMA 2KI6D 3EA0A 4A9AA 1P3JA 3DL0A 1VCMA 1D2EA 1NUBA 1HURA 1XZPA 3PUXA 4TSFD 5FBWB 1QG4A 5GADl 2WC8A 4DLWA 4MVFA 3OIUA 4D4KA 1HV8A 3LQQA 2JLZA 2AFHE 4KAXA 2QMEA 4YGAA 2R65A 4IKEA 3IBYA 5AJZA 3QG5A 1ZMXA 3CLVA 3CH4B 1UP5A 2AD5A 1JECA 1JQLB 2CE7A 3P32A 4OL0A 2WJYA 1T0HB 3B1YA 5C4GB 1A2KC 3H4SE 2W2TA 4EFNA 1G5RA 2V9PA 3NBYC 4JJKA 1SKQA 4P31A 4ZV4A 5JJKA 4OQMA 3CBQA 4LHVA 3KXLA 2J9RA 1NCYA 3I4LA 5UKDA 3I72A 4HAWA 4B3BA 2PSRA 1SKYE 3OEED 2C99A 2R6GA 3NSLA 3PEVA 5TNCA 1V1GA 4DCKA 1T8UA 1H8ED 3ZYCA 4DIRA 1FNMA 3FFAA 1SHKA 1OIVA 1XMSA 2R8RA 1YE8A 4HLDA 4N0EA 8OHMA 2VO1A 4JIMA 4XJKA 1CIPA 1E1RA 5C2JB 1TUEA 1YZGA 2ZE5A 1N0UA 1P9NA 2A5YB 3LA6A 3QVUA 1RJVA 4Y0AA 3WXMA 3BXZA 3CZTX 2LVJA 2WAYA 1CTQA 4JT2A 3B85A 3LRPA 1KK2A 4GRAA 4QGHA 2FFQA 3U60B 2MJWB 1QIVA 5DI9A 2YOGA 1PV4A
chains in the Genus database with same CATH superfamily
4MQ4A 2LUOA 3WRVA 2ZITA 4OOEA 1YE5A 2XB9A 4M1KA 4FFPA 1SOMA 3IEMA 2PX8A 3F2VA 1CSEE 3IBCA 3RPEA 3V48A 1D4ZA 1DUIA 2D1QA 5B7GA 4IXDA 3OJXA 2PIDA 3K05A 3L7JA 4EYQA 5LQDA 3FTNA 5H81A 1L1QA 4QRHA 2HA0A 3NWJA 2Y27A 2X42A 5JAQA 4FOPA 1NRXA 4G09A 3JAKB 5FH9A 2XE4A 4D8TA 2WMDA 1I14A 2O6HA 3OU7A 4IRMA 4R9RA 3FCCA 2IHJA 3R4CA 4C3VA 2ZM5A 4RSHA 2CFTA 2XD4A 5EJAA 2D7CA 3UJBA 1IJ5A 1PRYA 1A4XA 1F0YA 2IQIA 2VZ0A 4JBXA 1CY6A 4UDNA 2NPIA 2XWQA 4I5DA 4TRNA 3CABA 4F3KA 2OZVA 3IEXA 3ROTA 3MXOA 4MYTA 3K70B 1ECBA 4V0SA 1A8SA 1S02A 5CB8A 4P98A 4WN9B 2P2NA 4WCFB 4WGGA 4HX2A 5LJLA 1Q1QA 4YBZA 1Y6ZA 1MC5A 5HYDA 2Q3DA 2IEAA 3DP7A 4B74A 5FPYA 4MYHA 2BFFA 3UAZA 4QO8A 1ZH4A 1DWUA 2HYIC 4ZYTA 1Q0SA 1VG9B 5KO2A 4K7JA 3HN7A 4C29A 2QD2A 4X7PA 4B2PA 1NGSA 4LCJA 4JOBA 5A5DA 1UADA 1WDLA 2NTJA 1YS7A 2Q41A 4BC0A 2ACVA 2ZJ6A 2CJXA 2EBFX 1OQAA 4WJKB 1Q0ZA 2Q3EA 3GPCA 3L0YA 3ZJ4A 3S8EA 2LVKA 5AESA 1MC4A 6LDHA 3IQEA 3BXHA 2OC9A 2Y1DA 5DBOA 5DT9A 4HF7A 2PDAA 1DKRA 2QX4A 2G4VA 1AD2A 1JE1A 2OKGA 4ZT3A 2IK8A 1CRLA 2ZYIA 5IDWA 4YAUA 1EGQA 2EXXA 3DE7X 1EX7A 4Q3EA 1QPZA 5ICGA 4YRRA 3PKJA 3ZCUA 1UMCB 2ZI7A 5HF6A 2CXRA 1R27A 4F8JA 3BSFA 4US1R 5DN6A 2C7PA 3JYQA 4XQ0A 2QRNA 2EQBA 3TD2A 3MHTA 1PFVA 4P4TA 4X54A 1Z0DA 1PR6A 5EJ2A 2I7VA 4BO7A 3GZNB 3WLOA 4BV8A 3U3ZA 5JJLA 3PF9A 2R25B 1KZ9A 4O08A 3HB1A 4JYPA 4Q16A 3MLAA 2JCXA 4E5MA 2DECA 3GG9A 3GD5A 2AKAB 5A9SB 3GHYA 4U0KA 5BPHA 4OXRA 5A6VA 3KQYA 4RA9A 2FN7A 3KYCB 3OF2A 3AG6A 3CVVA 5JNLA 1BMDA 3PGLA 2O2JA 2W2LA 1OX4B 2IYQA 2HO4A 4ZT6A 3ZV7A 2Z9DA 4BRWA 4OKHA 3FJOA 1DQNA 4YQFA 2QSYA 3FZQA 4BNMA 1MAAA 1YMQA 2ZAYA 3DE3X 3JD0A 3ZVNA 2FETA 3ZHCA 1EVIA 1JLLA 1THGA 1U7PA 2QTRA 2ZBEA 2UZIR 3ACBA 2I6TA 4MW9A 5JFTA 4ILKA 4L74A 3TCKA 3VDMA 2G06A 4BKRA 1RQXA 4RVCA 1C1XB 1Z4HA 1IOVA 1E92A 1RDFA 5HF8A 5G4KA 4BLPA 1AVSA 5E6RA 1UBOS 3J81A 3NHKA 3F6EX 4RA6B 2WMNB 3OTQA 1ZWKA 1NRIA 4IQ0A 2MCFA 4NE2A 2BPOA 1SCMB 2MT9A 2ZUWA 1BD4A 1VIVA 2R11A 1ZKDA 3D6TB 2BMEA 3PWTA 4MQFA 3TW0A 3M6LA 1PR4A 2V98A 1B1CA 2AUTA 2VUSA 2J48A 4C6SA 1NF2A 2AXPA 3QEOA 2BNXA 4UE6A 1YH3A 4ZOBA 3C8DA 4INXA 5DP2A 1QRDA 4JI2B 1HOTA 1L4LA 3AOEA 1RWVA 2CVFA 2XECA 3ZWCA 1M9NA 2F43B 3D5TA 3BA1A 2OC4A 2YFHA 1J8VA 2YUIA 4M46A 1DF0B 1CJCA 1UT8A 5JASA 1GZSA 3MGAA 5G40A 2MDTA 4DUYB 2NUAB 1DZIA 1BEEA 1BROA 5EJ9A 3FYSA 1OOHA 4BKQA 2IDZA 1YGYA 5K0TA 3E22A 4DADA 4YGBB 1JKFA 3W5IA 3WSTA 2D5CA 3L9XA 3EVDA 4AP6A 1CF4A 4ZEMA 3MUFA 5KYYB 2FNAA 2L4IA 1IPEA 1WCYA 5LZ8A 4MVJF 3H6HA 2AOVA 3H2ZA 2K2QB 2CBZA 1OREA 4ZC8A 4WOCA 1IIOA 4QFDA 4ZEVA 3EOZA 1BMFD 1XJWA 4GMFA 3C5CA 4NENB 4HAYA 2FN3A 3FUUA 3CIFA 4ZGGA 3VI3B 1Y7LA 4BGIA 4RD4A 3OEHA 3OPYB 1BFDA 1P8AA 3JS5A 4ID3A 2B4RO 4RZ3A 2Z0MA 5G1PA 1FTYA 4FZRA 4E6EA 3WYCA 3T9EA 4LZPA 1DIGA 4YQEA 1Y0BA 3EF3A 1Q20A 1QRAA 3R3SA 4KUGA 2DX7A 2VDUE 2CVOA 1UOEA 3F9CA 2X86A 1FMCA 2HWUA 4DIFA 2IUUA 2JKZA 2VG8A 3CKLA 1DTWA 2HJ9A 4BC1A 5JXWA 4R81A 1JBEA 3KQPA 4PHNA 4NJEB 1S2GA 4KHZA 3O0DA 3T9BA 3NH6A 3LYAA 1I4EB 4I50B 3LCCA 2JKYA 3BSSA 1KH1A 1E3WA 3QKRA 3LPNA 4KQ2A 2ZROA 2BKLA 4NPHA 4RL4A 2J4DA 2O05A 5D1NA 3N3BC 1DKUA 3ZTTA 1A0OA 3G02A 1WZUA 5GOZA 1FSPA 1BSVA 4KXMA 5MFPA 5DGCA 1GDTA 3D02A 1E0DA 1Y5NA 4RE5A 3JWEA 1O97D 4FEEA 3PUKA 1VLVA 3WTBA 1GPBA 1G21E 3GP8A 2JD1A 2ASEA 1VMDA 5ALXA 2OENG 1TM3E 2XOEA 4RQUA 1X9HA 5EE5B 2O8DB 2AG0A 5HTOA 2QF7A 4DR1B 3SJSA 3LLEA 5LQSA 2ERYA 3DH0A 3CNNA 2JJYA 4GEGA 3MWGA 4ZU3A 4OHUA 3CJRA 1PD0A 3EGXA 2XQVA 3TW8B 2OWDA 4CKBA 1SXJA 2Q5LA 2QTHA 3H5TA 4KSYA 5EPEA 3BCUA 4JKYA 4KZKA 1A8UA 1UDXA 1UMBA 2K87A 4HPXB 5TR9A 3HZOA 3M4NA 4RIEA 2NZYA 5JZSA 2IPAB 2XMPA 4X20A 2VPYA 4ZP1A 3KQWA 3G23A 4JT4A 2BTOA 4TWRA 5AKJA 3PUZA 1LLCA 1CQIB 1ZGHA 1DFGA 5EGSA 1SPBS 1IAVA 1JTEA 3JVUA 4PW0A 3G2JA 3M6AA 3F90A 4IIFA 4W99A 4CLOA 3P4YA 2OFFA 3ELUA 3EUWA 1A75A 5C3UA 4EB6B 3JQRA 1N1DA 3MTEA 2IVFA 4YROA 5E2BA 3FFXA 5AK6A 2ZETA 1G8IA 3A10A 1KQPA 3P9IA 2XNCA 4D79A 1Q12A 1Q0LA 4KPFC 5DM60 1CY4A 3E61A 2IYNA 4UM9D 4DQLA 3TOSA 1RYYA 3PJEA 3LW7A 3QLUC 2ODAA 1ZO8A 1I2CA 4OFZA 3EGIA 1TWOA 2GN6A 1QP7A 3B2NA 3JYOA 3ADOA 1CJMA 5CVEA 3GGCA 2JDID 1E5VA 4UTOA 2QZ4A 4PWYA 1J7RA 3L49A 1J49A 2PRIA 1K7XB 1KWKA 1J5EB 2X2EA 2V6FA 2DULA 2G1AA 4UHJA 3HWSA 3CG0A 4OK6A 1OTYA 2P69A 3F5DA 1Y8ZA 4A8JC 2BFNA 5IJ0B 3G1UA 1IPHA 2XA1A 3F97A 2VDNB 1OASA 1M31A 1M0WA 3NSOA 3T95A 1PJSA 4GGOA 3RB8A 1SKYB 5IAGA 2X5JO 1A9TA 5EJ5A 5CA1B 3VAAA 3MMPA 3OBVA 1P9OA 3RTCA 1ODFA 2I03A 2WIBA 5JMWA 5FLXA 4PYMA 4MZXA 1GILA 4FB4A 3DXZA 2AMVA 2Q6TA 4N5NA 3INRA 2J32A 2OQRA 2FSIA 3C3KA 2FSVA 4MRVA 2DC1A 4P2GA 1KGDA 4HYEA 3MINA 5H5JA 3ZCRA 4EHDA 3W34A 1RTKA 2M6SA 3WFIA 1TT5B 2XCTB 4KQXA 4QUGA 1HT2E 5L7WA 3YASA 3ZE1B 5DLYA 3JPYA 1OE0A 2WA1A 4ZCVA 2Y2VA 1YZYA 3N7HA 4BIIA 4OYYA 3UKOA 1HZZA 3KUUA 2VWGA 3MJRA 3WHKA 1XC7A 3S8MA 4RHCA 4MB6A 3LBNA 1LK7A 4EY6A 3X2SA 2RHOA 2ADMA 1OWOA 1I4DD 1OWLA 4XUDA 1YKGA 3BE5A 4KXFB 1RP7A 3WSWA 2H1WA 5ENVA 3JRNA 3D3EA 3NT2A 2FCRA 5JCXA 3U13A 1E8DA 1SBQA 1M67A 2PZAA 1UBJS 1YQTA 5FFMA 2NM0A 2M98A 2REQB 3IHTA 4ZVKA 4IH9A 2G83A 5M29A 2ZATA 3OWXA 3GFVA 2AI3A 4AJKA 2WWFA 3GQBA 5AIAA 1QGED 2PMKA 5CRIA 1N4DA 5H8WA 4J43A 3T5PA 1IJBA 4R3NA 2F59A 3FUVA 1EZZA 3Q11A 4UUQA 1C3EA 3L8ZA 3DAFA 3ZBQA 4Q24A 5LDDC 1S26D 3FFWA 4TLLB 1S1MA 3V7UA 1DBIA 2CV0A 1JXAA 2FEOA 2QLTA 2NO6A 3T1HB 3BBPA 2R44A 3GMTA 4E03A 5FWNA 3M3PA 3IJRA 3I01M 5B36A 3ICQB 5JCOA 3VTZA 3PR2B 1HMPA 1EG4A 2BFEA 1MG5A 4ETWA 4LJ7A 4RZIA 1UP6A 3SHFA 3P9PA 3NHZA 1GQSA 2XRYA 1K92A 3EZ9A 3RFFA 4YONB 3DUFB 5I4CA 4YMVA 1PL7A 3DNPA 2OCXA 1VKOA 3B86A 1PNTA 3TPFA 4JL5A 4QFCA 4ZHQA 1QE5A 4LY9A 4JUAA 4E70A 4S1NA 5TRTA 2HMWA 3MB5A 5E7QA 5KIAA 1WUHS 2A1IA 5AO9A 3KFXA 821PA 3BCHA 2X5XA 4QOSA 4KC0A 4M1SA 2PGAA 3GRRA 4PZZA 2ES4A 3VYUB 3ESXA 1OXXK 3O6BA 2PR7A 2E49A 5GVSA 3W5UA 4NFHA 1SG9A 3TK1A 5E7IA 1NUHA 4BQIA 3VV3A 4RF3A 5JXGA 3H9QA 5C8XA 3UAYA 4MRPA 2QKYA 1S2DA 3F2IA 1NUTA 1FYFA 4MUYA 2WFLB 3RKUA 1A72A 5FHQA 3V32A 3CS3A 3WMEA 3PT5A 2DVMA 2ZUVA 5TQVA 1FYEA 4E5YA 4L6AA 1JQBA 4NV3A 3NDRA 1N6PA 2QZJA 1A9YA 3TH5A 4D4IA 2XEDA 2YMPA 3UB2A 3G68A 4QUEA 1P62B 4WSOA 1DJOA 1RI4A 4BMDA 4JLWA 3LDHA 4IKOA 2I6XA 3FZGA 4JXJA 5JLJA 2ZIAA 1SUAA 2Y4NA 1XA4A 5AKLA 1PSZA 3RS8A 3TM4A 5DU2A 4MRXA 4FEGA 3M81A 2A4KA 2JHPA 2XODA 1WVMA 1VJRA 3UCEA 5AW2A 4MWCA 5JMPA 3FDJA 4PG6A 2FP3A 1OKKA 3HKEA 4C7MA 1XMJA 3EFOA 1CIJA 4OHZA 4D45A 1NW8A 1L7QA 4GGFA 4ND4A 4E32A 3NV9A 4S0ZA 2Q1XA 3WGUA 2VN8A 3TJMA 3PTZA 1CUVA 5LQAA 4DEXA 3DLIA 3O8CA 1B26A 1T6NA 5BT9A 4QPCA 2H07A 4FFOA 5KOHB 4DIMA 2C0QA 2OV2A 3EGDB 1E4EA 5TQ0A 4TTJA 1T1RA 3DVKA 3DAPA 4UQLA 3GGPA 5C5EA 1TAQA 3CBGA 2WB2A 4YUWA 2KBMA 1TO2E 3LQFA 2PZEA 3NM5A 4FPXA 2ZFDA 2QYTA 1NFRA 1DKQA 4KHPB 1LPBB 1U0JA 3V8NA 4LJSA 2UXDB 2PAFA 2Z43A 1B2RA 2XRFA 2OG2A 1UK7A 1Y8RB 3U39A 4KE7A 3ZHXA 3TTYA 1T0BA 3A9CA 2QTNA 6ABPA 4JSYA 2IZ7A 4HDOB 2UZ3A 5LPNA 3ZEIA 4X8HA 4X61A 3ZCQA 4BIMA 2J3HA 2JKVA 2DWUA 2I7TA 4FD3A 4IXNA 5HL1A 1ESZA 1KDOA 4F6RA 1S6YA 1C81A 1Y48E 2WWRA 5BO5A 1CE8B 1UM8A 4XJSA 4KFUA 1B0UA 1Y3HA 1RW4A 3ANMA 4R9UC 1XZCA 2WSSA 3SJ7A 1N1MA 4EM6A 3B9RA 3LM8A 1X80B 2Q9CA 4DR6B 2FXIA 3MQFA 3UFBA 3TR5A 1S36A 4GRDA 2CLMB 3GEHA 1VHQA 1Y80A 3ZCSA 2D0DA 4R84A 1ZJZA 3C43A 4MQUA 4CN9A 1USGA 1C9MA 3SYKA 5D3MB 4QXMA 2HUNA 5F73A 4U00A 3CPJB 2ZRPA 2GFIA 4JB3A 2J67A 4MV9A 2VSFA 5HOEA 2HBYA 1M5UA 5AXAA 3R8XA 4USLA 4BJ5A 1VZ3A 1J6UA 5CDHA 2AC4A 2F8LA 4Q4HB 4MI6A 4ZYXA 4CLRA 5TEVA 2PANA 1R8XA 3LKVA 2JFWA 4CIVA 2UVDA 1LTHR 1W36D 1QO0A 3LQ1A 3OURA 4CM8B 1KZ6A 2JAOA 3LUHA 1E3JA 1GFSA 4DLWA 4WXEA 4ZYLA 1KWGA 1Z82A 1ZMXA 1I7QB 1PFGA 3JWPA 2ZIWB 3H42B 3CBQA 3DZCA 3JRWA 1M2GA 3NGVA 2ZTLA 4BQFA 4Q93A 4H7EA 1Q84A 4Y0AA 1KQ3A 4G4SP 4LHXA 2H00A 3U9SA 2CMDA 4LOJA 2QSZA 1BAPA 3V1KA 3ZWHA 1KVSA 3UH0A 1CYDA 2OBYA 3G0HA 2I6GA 3BMNB 4X64B 2J7PA 3JTDC 4YFVA 3AUTA 1O8CA 1NI3A 5AHOA 5HK8A 1V39A 1BYIA 5KVAA 1DAIA 2L82A 4M2PA 3Q6IA 2I8AA 1KORA 4HNGA 1WETA 4MS3B 3JD4A 1TQ8A 2IBMA 3ADCA 4Q4JA 3EIEA 2NNWB 4G1BA 3GEGA 3W1VA 3DA8A 4BFWA 4BLUA 1YRBA 2C2KA 4Z2YA 3COPA 3G8CA 2RGEA 2WV7A 1W4AA 1ABBA 3OEEA 1U6KA 4TL7A 5K8UA 3OLZA 2GTEA 4JKOA 3LQKA 3LS2A 4FUTA 1GUZA 4N8DA 2FXVA 2AMLA 3EW9A 1GP2A 4YV7A 4NAUA 1NNSA 3MUEA 4AO7A 1TU4A 1OXVA 2P4HX 4HJRA 4CDGA 1TEHA 2AD1A 1ODKA 2G17A 3SJAA 3REQA 1BE1A 1KQMC 2H29A 1FMLA 1C8BA 1HT3A 4JDPA 1SOUA 4HQLA 3TNJA 3TZLA 2SKCA 1W581 3OH8A 5JSQA 3OI7A 2QTVA 4PNZA 4WZAB 1C1HA 4IUCS 1B3RA 2CN1A 3U40A 1YVRA 3WQQA 2VUUA 3RM1A 1LPNA 1T1EA 4J94A 4MEWA 1G55A 2PKCA 3PLNA 2OD9A 5AVYA 3G2HA 1KO5A 3BGSA 3TIGA 1W7AA 1B9AA 1C2TA 1TD9A 3O4XA 2VHWA 3PVSA 1S2MA 1R4AA 3HBAA 2IH5A 1VMAA 2JQ6A 4KQMA 2QW1A 4YJGB 3KFVA 4JJ7A 2FWNA 3CYFA 1V8PA 4QBKA 3VX4A 4I2VA 4TTVA 1NMEA 1W76A 2NXCA 3G2NA 5BR1A 3Q3JB 2F90A 3S27A 4MW2A 3IT1A 3T5TA 4PZUA 4PG8A 3BQMB 2I2WA 4NJOA 2BLLA 2E55A 2GCPA 4EKIA 5FRDA 1ID8A 3IP9A 4C6TA 1VDZA 2M9MA 4EATA 2CY0A 1VHJA 1WDWB 3TMAA 4DIBA 1HY3A 3ZW7A 1R9NA 2WIGA 3NV7A 3K30A 2DERA 4GP7A 1FLAA 1CIVA 1NG1A 1MG0A 1XP8A 4X1KA 2WYIA 3FX2A 4I9NA 1E9RA 1MAUA 3I30X 4MDFA 1QGAA 4B3SB 3FYUA 2GVDC 2D1RA 5JCZA 1K4YA 4LXUA 3JWIA 2IV3A 4MUXA 2EKLA 2DLNA 5BWNA 1ONNA 4FZ5A 4ML3A 2QACA 5HZKA 1OI2A 4H1WA 2YZGA 4IIVA 3M6WA 3WNDA 3I53A 3ND6A 3TB6A 1XFUO 4M38A 2AN9A 1C9NA 1K2HA 3Q3GE 5EMHA 1IEXA 4OAOA 1YWGO 1RK9A 5CLJA 4FEAA 4GSYA 3QOWA 2SCUB 4O33A 3B5EA 3VR4H 1KFJB 3ZQ4A 3G0IA 3KT6A 2V8BA 2Z83A 4NS1A 3R5FA 2FZEA 3HB4X 1NKSA 4L8GA 4DM4A 5HKAA 3KLOA 2VRCA 4B85A 3HGQA 1GN9A 1X1TA 4UAUA 1X1QA 4H1HA 5H7XA 5FLEX 3ZWWA 3DM9B 3CA8A 3NC4A 1PW7A 3R7AA 3MCWA 2BKUA 4RD6A 1VIAA 3T7RA 1YAJA 4K1XA 5K0FA 3MGGA 4W5WA 5AJYA 3DDUA 3PM8A 4U63A 3PD7A 4BMVA 4JGGA 4Y0VA 1YR8A 5FTMA 3N0TA 3SIBA 1G20E 3NIDB 1RWKA 4E1BA 2X4IA 121PA 4FMCF 3LK0A 4KN5A 4P4SB 1UBCA 3O94A 2KM1A 4PHFA 3WISA 4FDTA 1K0FA 3O8QB 1YVUA 3H3JA 2DEUA 4Z4GA 4KK4A 3HR8A 1CFFA 1YR7A 2SCPA 1GAWA 1ZRNA 1JWBB 4PFSA 5I9LA 2DBQA 4WKGA 1PFWA 2BGGA 4RHEA 1F6DA 4ZD6A 4BNUA 3KV3O 1N2GA 3AETA 1G5HA 1OD6A 5FEMA 4AUEA 1IIRA 3W2FA 4X66B 2N0SA 4XZ3A 3TD9A 4LZAA 1E6KA 3TQOA 2B8JA 5AW5A 1DAOA 3AP2A 3IA7A 4PALA 1C3OA 1XD2A 1W44A 4U2KA 5FBHA 3J81k 1SU8A 4AKGA 3GUCA 1FBVA 3EE6A 2HAEA 4HFRA 3FPGA 1P1HA 3DFMA 3QYAA 4I4TB 2LXNA 4D0GA 3MTDA 2WC1A 3NYWA 1MENA 2JANA 4QL3A 2O54A 4W8HA 3S1LA 3RIHA 2XNJA 4A8JB 4CNQA 3UMSA 4RPCA 3PGKA 4WA8A 4X71A 4N03A 1BXZA 3IKMB 4UTZA 2I34A 3L1JA 4RLQA 4UM8B 4YAFA 3N2ZB 5HPYB 3KDSE 4NDZA 2LZ0A 5JCJD 4QQKA 2CW5A 2I7CA 5BY2A 3PGJA 4GBGA 3BUXB 1G38A 5BSGA 4N3GA 4PR0A 3O74A 2CXJA 2NYRA 3A4MA 3EMKA 3SBEA 2YGUA 1XYDA 2M0RA 1XX6A 4O5AA 1N4AA 2JAHA 4R1MA 4MP8A 5AVVA 1E3SA 2X9GA 3R76A 2XRMA 4F46A 2TRSB 2K2AA 2P3QA 2VYVD 3O31A 5BW4A 3HMKA 1GL6A 4JJEA 5HJ2A 3PNKA 3TEJA 3LLSA 4BO8A 2GJAA 5KYTA 1AKWA 3V1MA 1TJ3A 3R1IA 4WLOA 2GLXA 1G5QA 4O2AB 3WSVA 2EU8A 1QYDA 2O3TA 2RKBA 2QVGA 4RHTA 3OZGA 2OE2A 1Y98A 4OBBA 1UQUA 2RSLA 3AGPA 5C5CA 3G9TA 4CL3A 4Q6BA 4U0JA 2ECPA 2Z1MA 1VGRA 3VOTA 4EABA 3OQPA 4MEAA 4QHYA 3D3WB 4IZOA 4P5OE 1RI3A 4GBJA 4Q1BA 4E4YA 3GYGA 3HABA 4KVAA 1L3BA 4HWRA 2HV8A 1T13A 3H8VA 1RJ9A 3TSOA 3WGGA 4RC9A 4A5OA 2DWQA 4AECA 2XEXA 4F3TA 5LXTB 3FLEA 3S29A 3ZV5A 3UAGA 4OOFA 2DJ5A 4MGEA 3REFA 2OFXA 3L6OO 3VH3A 1J09A 1GJRA 3AVYA 4J0FA 1XB2A 1Z4NA 5I9IA 2GN1A 1S3IA 4S12A 3K5IA 5DCYA 2C95A 2V1XA 1WY7A 4FMDF 1Y34E 1DWPA 2RG1A 3ESQA 4XWGA 1A5TA 1U7TA 1Y3AA 3AIIA 4JT9A 2L18A 1PEYA 2YJ6A 4AMVA 1PP4A 2KBEA 4KIJA 3T8YA 5KYUB 3N05A 3BIWA 2JGKA 4D3SA 3PEYA 2VHVA 1PULA 1U0EA 4TV8B 1LPAB 2EL7A 1NPDA 4TYQA 3VYTB 3KQHA 2SICE 5FO1A 1JJIA 1GM5A 4LE2A 4U2BA 4HYQA 2YZNA 5MN4A 4AL4A 1NIJA 2GJ8A 1NBMA 5I48A 2H5LA 5ADUS 4PAOA 4Q3AA 5JVDB 3ZWXA 1Y82A 2P9HA 3CUEF 1GGNA 2B98A 2M9GA 3JALB 1R6TA 3KYDA 3RVOA 1SK6D 5T3YA 1NZJA 3LNCA 9LDBA 1T5DX 2WKSA 5L3SA 4PDZA 1UPCA 1JQEA 1R4MA 5CT9A 3QPUA 3RYCA 3RNOA 2ODEA 1TC2A 1KZ1A 4W6QA 1Z7GA 2CHFA 2Y66A 1NXQA 4XASA 1DVRA 2PWAA 5CH5A 2HZBA 4XCVA 1KP3A 4R5MA 2JRCA 1N3IA 1NI4A 2X2PA 1QASA 4I55B 2HGZA 1FDTA 5A4DA 3JZAA 2POCA 2J3MA 1PWHA 3WDMA 2IYUA 3RYIA 1VMIA 4X3CA 5ITVA 2AI2A 1RFJA 3N8KA 4NYJR 1PEKE 3NYQA 1W2GA 4QDTA 4R7GA 1M8KA 2JH8A 3DC2A 3RIYA 4C6RA 2VH1A 1QCCA 4ZWNA 2YV5A 2WU0A 3QF7A 4N0MA 5AXBA 2OY0A 4HEA6 3WL7A 3IPXA 5A0VA 1K1EA 1KFXL 4K9LA 1R6VA 1VKHA 1UHJA 2R7NA 4GQAA 1OGJA 2D4AA 2GBPA 2ABWA 4YQZA 2J7KA 3EK8A 3I9V1 1U1CA 4N12A 4D8UA 4UZFA 3G0DA 3H2SA 2FSHA 3K8OE 3AT1A 4V03A 1YTZC 2BBMA 1K6EA 3R1PA 1EH2A 2GD6A 1SELA 1TM2A 1KNQA 1RJWA 4EX7A 1QHIA 3MGKA 1OLXA 4OKIA 1OH7A 4E2FA 4NNJA 2O7QA 3SQWA 2AL7A 2ERBA 2C5HA 2I3AA 3MPO