5HZHA

Crystal structure of photoinhibitable rac1 containing c450a mutant lov2 domain
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
325
structure length
320
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPYIPTVFDNYSANVMVDGSTTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELGSGGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1,NPH1-1,Ras-relate
publication title Engineering extrinsic disorder to control protein activity in living cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 320
sequence length 325
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hzhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5hzhA01
2ZU6A 4LJ8A 3AP1A 4AYWA 1G41A 2AR7A 1NMYA 4IEEA 1PLLA 1QHGA 4Q1EA 4B2LA 4JLAA 1E94E 1E9SA 1M7HA 2G88A 5IF9A 3A0VA 2D62A 2QAGC 3LXXA 3OAAD 4JJZA 5EE0A 2IYTA 4TMWA 1Z0KA 3K0CC 4Q4JA 3MLEA 3CKLA 2L0WA 5K8UA 4GFDA 4A36A 1N6KA 3BOSA 3H84A 3LBNA 1GKYA 4XVUA 1ZINA 3BERA 1E0JA 4F4IA 1ZCBA 4FW9A 4MUBA 5JWHA 4D4MA 2QORA 2L1MA 4XT2B 3NDPA 3GEIA 2ZE7A 4WBSA 4CEHA 1BIFA 3DM5A 5CK4A 4Z54A 1M7GA 4JMPA 4LPKA 1VCOA 5FBLB 1WA9A 5KPJA 2O8EB 4DCNA 4B32A 3B1WA 3AH8A 1YZKA 4F91B 4RZXA 5C4MA 1OHHA 2ZI3A 2PD7A 4M4XA 3R7WA 1T1AA 4JLOA 3CH4B 2FFQA 1OJ5A 2FEOA 4NYIQ 5FI0B 4Q7LA 4B3DA 1DE0A 1T91A 3CR7A 3CNOA 2GZHA 4LI0A 4AYXA 4XD7D 1Z22A 3BK7A 1EK0A 4PZYA 2IF0A 1IHUA 1MRSA 1I2DA 1XEXA 2XJ9A 1QG2A 2KE5A 2Z83A 3K9GA 3KJGA 2PH1A 1CRQA 4D80A 4Q9JA 3T35A 1XTRA 3LX5A 4PPQA 1A4RA 1SHKA 1UM8A 5C4GB 2IYRA 5G53C 4A6PA 5C46F 1Z0DA 3SU8A 5LD2B 1CEEA 2RHDA 1DAMA 2PMDA 2DFTA 3K8YA 3NBYC 4PHGA 5KSOA 4YMSA 2Q3FA 1ZM7A 2WWHA 1NSFA 3CRQA 3ICEA 3NVAA 1UEIA 1W46A 3IKJA 3O47A 1T8TA 3MFXA 4EDHA 5F2EA 2BBOA 2RGBA 3O8DA 4RD1A 4QBHA 1S1ZA 3SOPA 1Y3AA 1OHHD 4HJ3A 1ZM3A 2ZOIA 2LKDA 4QNRA 3ZJYA 3UPUA 2X8AA 3DPUA 1OXSC 5F3WB 1WXQA 5SZIA 2D74A 1XTQA 3KFXA 3A58B 2F3RA 2XX3A 1HURA 1E2NA 2H7VA 1DAIA 1F48A 1MRNA 2OT3B 2ZUCA 5JMTA 2XOKA 4N0EA 2ZPTX 2OSBA 1E4VA 3IIJA 3VAAA 1E99A 2R44A 2F1RA 1XEWX 1NNEA 2QE7A 1JJ7A 3SC3A 3V00A 3Q8XB 1LSXA 1NKTA 2WHXA 3CX7A 4G5GA 1R5BA 3UB7A 1WRBA 1CKEA 5HE9A 4ZDWA 4I5SA 1NIPA 2D7DA 3BORA 1KI6A 1WA5A 3C41J 1Q57A 1D06A 1FTNA 4PPGA 2G0NA 2WJJA 3KKMA 3VQTA 1Q1BA 3HR7A 4LRYC 4KITB 2NZJA 3EWKA 2VHJA 4QHYA 1A82A 2VLGA 2ASEA 3W34A 1DELA 5IS1A 3DL0A 2IYUA 3QKRA 4ILEA 1NF3A 4KFTA 4LYAA 4M9SA 5DH9A 1TEVA 3PUWA 4A0RA 1N5IA 2BOVA 1RRFA 4LC1A 1ZUIA 4P32A 2Q9BA 3JZMA 4YXWA 4KYUA 2JJ8A 5DLQC 1T9HA 4DCVA 5FPKA 4TZ0A 4TWZA 2WSMA 2QP9X 3NEJA 2HEIA 4R70A 3B1XA 1FL9A 1Q0UA 4HLUC 4HY8A 4YMVA 5JCPA 1E1RA 1E2QA 2DBYA 4IVPA 4A8JB 3U60B 2AKAB 3BGWA 3MCAA 1S4QA 2ZAMA 1MZUA 4US1R 1VG8A 3Q5DA 2CJWA 4HI0E 5F6AA 3QPWA 4MUAA 4C0HA 5JSZA 5F9HA 4TMXA 2JLSA 2KJQA 2PLFA 2QQ0A 4BEBA 1VCMA 3I32A 2INWA 4PFSA 4BE7B 4OBEA 4R71A 1US8B 1KZGB 1OW3B 3QUSA 1F60A 1KJYA 2GZAA 4B75A 1GVNB 1U81A 2ZRAA 2MSDB 2CVHA 4PPNA 4V03A 3WHKA 4FMBB 3EWSA 1GM5A 1R2QA 1YR6A 3K0AA 2XAUA 1IY1A 1DG3A 1XTJA 2ONJA 3EZ2A 2E1RA 1IXRC 1D5CA 2A5GA 5HCNA 4B3BA 3VNVA 4AWXA 2W6ID 5CYOA 1P2TA 2AK3A 4KVAA 3TAUA 4RD3A 3KFVA 5P21A 2EFEB 4OI4A 3GJ4A 5DYGA 3I3SR 1DG1G 5BN5A 3B1YA 1J99A 1Z6YA 1P73A 4RY2A 2QTVB 4PO9A 3GLIA 4HJ4A 4OQLA 1SQ5A 1GSVA 3V4FA 2F43B 4B2IA 2QBYB 1XXHB 4DJ2A 2QPOA 2ZR9A 4LJ4A 3AP2A 3EWAA 5L3SA 4Q9KA 4EJSA 4A92A 4C4PA 2ZJZA 3R9IA 1U9IC 2ZEJA 4JL5A 4DCTA 2JLVA 5BN3A 2QL6A 3L8YA 4WN5A 4FCWA 1S9DA 2CHVA 3LW7A 1P0ZA 3TUZC 1E9RA 2AL7A 2GCOB 1UEJA 3LAWA 4EXOA 4HLCA 4MYUA 2JAQA 4PC1A 4ERNA 5FUYA 1OJLA 1E96A 1OKKD 1VG1A 2W2TA 3E70C 4TYPA 1OH5A 2HV1A 2P7JA 2KSQA 4IDNA 3AVYA 3AUXA 1C4OA 1HE8B 1XPRA 5B30A 3NJAA 3EZFA 4TTPA 4NCJA 1GSXA 3QQ5A 3N2IA 4JVLA 1OXTA 1IQPA 3A8TA 5DKLA 1G4AE 721PA 5SZJA 4M1YA 4UXHA 3LIFA 3VR6A 1NN3A 3NBXX 2AD1A 5C1BA 3OESA 4JLDA 3WRYC 1DAGA 1DO0A 3LI8A 1YZTA 2R65A 1N6PA 2V1BA 3SBEA 3H86A 1G7CA 2UZ3A 2O8FA 4KSBA 4MQBA 2V4ZA 1EFTA 3CWZA 5C2JB 2F1HA 4A1FA 3K70D 2WPDD 2PHYA 2QWSA 2HXSA 4JKYA 1TU4A 2GJAA 4UQOA 4EPWA 4LJAA 3NC1C 2BMEA 1UKZA 4GT1A 4TLAA 4RD0A 4LHWA 1GDDA 1AZTA 1OYYA 1H8EA 2FFHA 3M4YA 3UANA 2FDCA 2EFHB 3FKSD 1CS4C 1E4YA 1JXOA 3GJ8A 1U0JA 3QG1A 1N0UA 4Q00A 3OF5A 4Q4HA 3Q72A 2C04A 4O3MA 1ESNA 5CDFE 5F68A 2HCJB 4KUKA 2YZ2A 4P33A 2PT5A 1QRAA 4OQNA 2QSYA 4HDCA 3RRZA 3QBTA 2CK3A 2ZRIA 4Q47A 2D4HA 3TVDA 1P9NA 4JBXA 1OIVA 3MWJA 4D81A 1HYQA 2VP2A 2IK8A 4ZDIA 4LJ7A 4CGZA 4RKEA 1Z6GA 1ZM2A 1LF5A 3EXAA 3W90A 2OV2A 2V7QD 2ZROA 4GP6A 4NXFA 4URYR 2IYZA 5FL7A 4HEJA 1KDTA 4EEUA 4BFSA 1MABA 2XTMA 4MKGA 1VCIA 3RHFA 4GOXA 5JS8A 3RS4A 2XSZD 2PMKA 1X8KA 2ZI5A 3TJZA 2KWIA 1EW0A 5G3ZA 3EPLA 4TMZA 1H8ED 2JEOA 2PEYA 3VX4A 2HV8A 1LY1A 4G5RA 4IW3B 2ZOHA 2C96A 2GF9A 2I3BA 2L0XA 3GJ6A 2D7CA 3ZIAD 2NZ8A 4QBFA 3T61A 4MN6A 1LS6A 2WKPA 1T3HA 1XP8A 4DSNA 4EKDA 3U5ZB 3VKGA 1GUAA 3FMPB 1WB9A 4Q21A 2GA8A 1LT0A 5SZKB 2WWIA 4C0QC 3UMSA 3B2EA 4URWR 3W5IA 3WP0A 5CB8A 2C5LA 2GEDA 1XBTA 1CR2A 1XEFA 4WXRA 2BMFA 3SJAA 4R7ZA 2V9PA 5AUPB 1M1YE 4YMWA 2R6GA 4IDOA 4NH0A 1P7CA 2RGNA 1K5DA 2J0VA 3FWYA 3QF4B 4ZCMA 2VA8A 1JQJC 1T5IA 1NY5A 4NU0A 4P3YA 2EA9A 2WOJA 1LTQA 4YDSA 1XZPA 2OBNA 4Q4JB 4M4SA 4OQMA 2FU5C 3RC3A 5TARA 5G4ZA 2H18A 4LRZE 2WKQA 2JLQA 5TXGA 1RFLA 4FWIB 3LIAA 3KJHA 1W7AA 2LWIA 4KHZA 3B9PA 1S3GA 2OLKA 4PKYA 2RGGA 4CEHB 1G28A 1J7KA 3DM9B 4TQ9A 3L0SA 4B2PA 3U7FB 1NLYA 2J41A 4XT2A 1G6OA 4OI0A 4GMDA 3I72A 2IXFA 5AJVB 2EFDB 5FOUA 3BC1A 4JLKA 5HDSA 1E6CA 4B76A 3A1UA 3R7WB 4Q7KA 1CULC 1GG2A 2IL1A 4X8OA 4A2QA 3AVWA 4BUJA 2AXPA 5H70A 4ZKDA 4EESA 4GCZA 4UNSA 2O8CA 1AZSC 2CHGA 1G18A 4MN5A 1XEXB 3VOLA 3VHXA 4KJZA 2TMKA 3KKNA 3CUEF 1COWA 2PT7A 4Q5IA 3JVVA 4BFZA 1HT2E 3LBHA 1M2OB 3GMTA 1NP6A 4O2LA 5JI2E 2ZUDA 1OT6A 4Q9HA 4K08A 5JECA 5EP3A 2UVQA 5A5GA 3KX2A 1KMHA 2G83A 4NXGA 1ZU5A 1Q3HA 4KAXA 3T1TA 4FD2A 2BKEA 3ZQJA 4N0DA 3DOEA 3A4LA 1EFRA 2JGNA 2VTKA 3H0KA 2OO7A 1ZC4A 1JAHA 2ZANA 2YJTD 1E2KA 1E79A 4HP4A 3C5CA 2DYKA 3SHFA 4L9FA 1RIFA 4DJTA 5AJWA 3RYTC 2WKRA 1KO5A 2YOGA 2V6JA 2J7PA 4IKEA 4RCYA 2AD5A 2NPIA 1AK2A 4LSGA 2BM1A 3D6TB 1X3SA 2H5EA 3VFDA 1GRQA 2B21A 5LBIA 5EUMA 1FMLA 4MRVA 5J4YA 2C03A 3IBYA 3L0OA 3H2YA 2PX3A 3LWNA 4LPSA 3BFKA 3T1QA 4JLMA 5C18A 4C7OA 3OIYA 4KYIB 2PEZA 4LYHA 1T1CA 1Q1ZA 1SKYB 1KI6B 1YJ5A 2YNMA 1XB2A 3R8FA 1OV4A 3RS3A 3KXIA 4LOAA 4P4UA 4Z8YA 1VYVA 4DUGA 1LSWA 3OIWA 3U6KA 2REBA 2ZJYA 3NWJA 2G9NA 1Z0FA 4RZ2A 1LL8A 2VHCA 2CE2X 2GBLC 1XNJA 2WWFA 1DTSA 2VP0A 2V1UA 3QKRB 4JL6A 1W0JD 2J45A 1WP9A 4TMTA 4QHSA 5B57C 1OT3A 1Q1QA 3HU2A 2QAGA 5KU1A 4TL8A 3SFZA 1ZUNB 2JDID 1S96A 3K0CA 5DO9A 1KKLA 2JJ2D 2ZE5A 4NBSA 1IXSB 1J8YF 1LV7A 3PEUA 1HY3A 3GQBA 1W4CA 3EPHA 5EFWA 1W2HA 1P5ZB 3P1JA 1CTQA 4DLRA 1KI1A 4A0GA 2CE7A 2GK6A 4HUQA 3RSLA 3WYFA 5F69A 3DZ8A 2KDKA 3U44B 2CLCX 2ERYA 4OHWA 5HDCA 5K8LA 3SJZA 1W36C 2IUSA 1SXJC 2CJWB 2REXB 3TQCA 1YR7A 3CZPA 3ZZ0A 3OFNA 5JSZB 1RC8A 4LJ6A 3GJ5A 4KO8A 2IA5A 3ICYA 4BGDA 2ZRFA 4DLVA 4Q19A 3W6OA 2FSFA 1YKSA 5AWFC 1ZW6A 4U00A 1GKUB 3TKLA 2OG2A 3BB3A 1R4AA 3VNUA 4BZXA 2EFCB 2W2XA 1DOAA 1KHTA 3K0AB 3IPXA 1NMZA 4DIDA 1VPLA 2VV6A 4U02A 3Q85A 5IRCD 2QI9C 5EE1A 3GLGA 2XEXA 5J3WA 2VHUA 2ZRCA 1UFQA 2GVDC 2V9AA 1QDEA 2OE2A 4HAWA 2ZETA 1DRMA 4UNPA 5BQ5A 1AGPA 1MT0A 4Q4LA 3CIOA 3B1ZA 4URVR 2IXEA 1ZNXA 3GLIB 5FOSA 2F1IA 1W5TA 2AFIE 1GL9B 1W49A 4ARZB 1MOZA 3OLOA 1FNMA 3TSZA 2FSIA 1H8HA 3H1TA 1XMJA 2QBYA 4PTLA 2WAXA 5L3SB 3DMNA 4EJSB 3ZVMA 1GITA 2G1JA 3QIAA 1DPFA 2JASA 3RANA 1U99A 3NOPC 4EETB 3ZS9A 2YC2C 4L9EA 4V0NA 1OYWA 3UMDA 4I4LA 3R9WA 3U3OA 1II8A 3NEYA 3LICA 4AKHA 1L2TA 5A0FA 3F0TA 1DEKA 3D7MA 3EPKA 4ZCIA 2XNDA 3W6NA 1FPMA 3PVSA 4ZKEA 2QMHA 4HATA 3TRFA 1OH7A 2QJ5A 1OJGA 2Q6TA 4NYMQ 3GPLA 4LYFA 1SVOA 2C8VA 1NVVR 1IJEA 2R62A 1Q1EA 4AG6A 3QKUA 3MQOA 1M7BA 1NLFA 3HPRA 4JVNA 3IQWA 4ESVA 3HYTA 2ATVA 4TYWA 2FSGA 2R6FA 3G82C 2GWHA 2YHSA 2ZITA 3E2IA 4S2EA 4UNQA 4AKGA 1W2GA 5I5LA 1U0HC 2QPTA 2GNOA 2O8FB 1H65A 4RZUA 3T15A 1LS1A 2OILA 4D0LB 4PZLA 3HJNA 5LB2A 2ZI9A 3WYGA 4Z1MD 3SYNA 1R0ZA 1RW4A 2ZJBA 4A15A 2Y8EA 3MMPA 5FOTA 5J40A 1NY6A 3AEZA 2GILA 4R2HA 3T5GA 2CMNA 3QF7A 3GJ3A 2VRWA 4HLUA 1KZ7B 4NKRA 3U61B 1R0YA 3CLVA 1SXJB 4FI3C 2PJRA 4HAVA 4PQYA 4Q4HB 2NO9A 4BWYA 2O8BA 821PA 1TF7A 3T12A 4URXR 1EWQA 1Z2AA 1J90A 1E2FA 1XXHE 2WWWA 4GS9A 3BH6A 1KMQA 4I99A 3ZYCA 5JJLA 3SJCA 4R38A 4TLDA 3EPJA 2BEJA 3CF0A 2VV7A 4HDOB 4NP6A 4TT3D 1JBKA 2ZAOA 4HB0A 4EAQA 2J0QA 1N25A 2OFXA 5DHAA 3FPAA 3AVUA 1XTKA 3RABA 1XD8A 3BY9A 2X1VA 2ZVPX 1N6RA 1N9LA 1XPUA 1UKYA 4HJ6A 2IHBA 3WMEA 3FC7A 1NVUQ 2NTYC 3ETLA 5KUTA 3H9WA 3TQFA 2QSZA 4ZV4A 5AK0A 2BJWA 3KUDA 4PHTA 1DP8A 3QVUA 3FOZA 3A1WA 2GXQA 4YDHB 3PUZA 1LW7A 4LWZA 4MRPA 1KI9A 3MGCA 1G3UA 4CEIB 2HJVA 2W0NA 2WWGA 3QKTA 4HB3A 1FQKA 2O0KA 3DDCA 3SS8A 2P5TB 2WIAA 3WBKA 1U9IA 2FGKA 1BMFA 1TX4B 3I8XA 2ZRPA 3DKPA 3M6AA 1Z2CA 2WVJA 3PV0A 1FX0B 5GVSA 3NC0C 4Q66C 4DLYA 4PC3A 4V0KA 1I4TD 1PZNA 2QPAA 3WRXC 2RGXA 4ON9A 4KXFB 5F98A 4DVGA 3BFVA 3MWLA 3LX8A 3FMOB 3WBJA 2B7BA 5D3QA 5EXPA 3JZAA 621PA 1G21E 3QF4A 4I81A 4MYCA 5CLLA 2DFNA 1L8QA 3Q5EA 2W6JD 5ANRB 2GETA 1N2CE 3P26A 3HYRA 2DWQA 2JA1A 1NJFA 3I92A 4TTQA 3U7HB 3AV0B 4M9XA 2AXNA 3QKSA 2IYWA 4DLZA 4BFVA 1QF9A 4JKIA 4MGYR 2GEVA 5JBQA 2QJ7A 4AIIA 3AKDA 1HV8A 1UPTA 4PAMA 1GFIA 5IDVA 1SKQA 3TK1A 3B6EA 5DN6D 1XFAA 4WLAA 2VEDA 2QTHA 1TUIA 2XITA 1DO2A 2DB3A 3ZZUA 3QOFA 3IHLA 4XTRA 1G1MA 2Q3HA 3C15C 2O8CB 3D31A 4LBWA 4PHHA 4B73A 2OBLA 3LI9A 2R78A 1A2BA 3NOUC 5L3QA 2HUPA 4PC2A 2AFHE 1HA3A 2G77B 2ZSBA 1QVRA 2PZEA 4XOIA 1OTBA 2Z4RA 2SHKA 2ZE6A 4DEYA 1MO4A 2FG5A 3ECCA 5BW8A 4ZPXA 4I38A 2IEZA 3ZGXA 4M9ZA 2EWWA 5DNYB 3BH0A 5HZHA 2MMCA 4YLGA 1J2JA 2CMKA 4MKHA 1BYIA 4XWKA 4A0HA 3VR2A 4GHIA 1KMHB 2ZYWX 1N6LA 2NOAA 2DCUA 5A8BA 1UBEA 3AP3A 3A0RA 2FZLA 3CB4A 3SNHA 1UGUA 1R7RA 4NL4H 3THXB 5E3HA 1E2LA 2NIPA 2ERXA 1N6OA 3QPVA 1UF9A 2YWEA 1HQYE 1T5LA 2XZLA 3GECA 4HAUA 1UDWA 4HI4A 2V55B 1N5KA 4CYMA 5AVEA 3C7KA 4TLCA 1P75A 1XPOA 4Q1BA 2NQ2C 2YWGA 2BASA 4L5BA 4JS0A 1TS0A 1ZNWA 3QEOA 4OK6A 3EARA 3PUVA 4I1UA 2X77A 2OCAA 3UWKA 3VTKA 4BBTA 1ZP6A 3NHBA 2HCBA 2N1BA 5J4HA 4C7OB 2K7SA 2ZRNA 2FV8A 5L8VA 4MA4A 4C30A 2BIFA 2QM8A 2W00A 1SGWA 3Q3JB 2RGEA 3VR5A 2ZS9A 3K09C 4DXAA 4ZDJA 1TQ4A 1KJZA 4OHYA 2QAGB 4QJ5A 4DSTA 5FTLA 1XJ6A 2ZYTX 2PCJA 2E87A 3E5HA 2H92A 3P20A 1IAQA 5GADl 3P27A 4ASUA 4B74A 1JR3A 5KIZA 2G6BA 4OK3A 1NKSA 3DO6A 3MAAC 1T6NA 3QXSA 4CT4B 2XOKD 3UB6A 1S3SA 2C78A 5KO2A 4WW0A 2B8TA 1OFIA 4Z51A 4F3LA 2YV5A 3LFUA 4HUQB 2IYXA 4IEIA 3X1YA 2QE7D 4DBLC 3REFA 2DWOA 2VSFA 3OE7A 3KQNA 1GOTA 5FR2A 5E95A 3U44A 1RRPA 2OESA 3CRVA 3ADCA 3WHLA 1KI2A 1EGAA 1FP7A 1EXMA 1F3OA 1W0KA 4FINA 2HYDA 3U7GA 5FI1B 2X2FA 1R6BX 4F4CA 1OB5A 5JEDA 521PA 4LLOB 4Q02A 1P2SA 2CL7X 3A36A 3EX7C 1JR3D 2CCKA 1CXZA 2GVZC 3MQQA 5E4FA 3VR4A 3GDIA 4BEJA 4DIEA 3MR0A 4YXWD 4D0GA 5KNCA 3GLGB 4TSFA 3NKVA 3L82B 4KFUA 1II9A 1KY3A 2ZJAA 4LK2A 4IOKA 4L8GA 3W8NA 2J5XA 1TTTA 4TLBA 4A2PA 3MXQA 3ZVRA 1UBFA 2Z5FA 4M1OA 3OHMA 5FTMA 4CT5A 3GEEA 1E1RD 2JATA 3AF1A 3NOTC 4QGAA 3PYPA 1E1QA 1Q22A 4LPZA 1XMSA 3U2QA 4ARZA 1UWPX 3K9LA 3IEVA 1P60A 3RWOA 2OWJA 4BBUA 2ZI6A 3CPJB 2ZRDA 3PQCA 3BBPA 2IWHA 1U98A 3LY5A 1TQ2A 1II8B 1P4SA 1TQDA 2DR3A 1WCV1 2ZRMA 4JGPA 4HH3A 2CNWA 4V0MA 1S1YA 4QOSA 2WAYA 2WICA 1MO5A 4IVQA 3MD0A 1E69A 1YE8A 1ZYUA 2WM9B 3O8CA 4C3ZA 3UB8A 3IPYA 3KQUA 5AR1A 4B3CA 2ZRLA 3PFIA 2J80A 3G6OA 1Z6XA 1NI3A 3CPHA 4EPTA 1B23P 1MV5A 3B5JA 2EFGA 2Z6DA 1BYUA 3RRMA 4NDZA 2GBLA 2VIIA 5IK2A 2GF0A 3K9HA 3SQXA 1FP6A 1ZMXA 4DB4A 5HWTA 3MJRA 3ZS8A 1A2KC 2BMDA 1PLJA 3TE6A 5K8IA 3SJBA 1M8PA 2D2FA 4FMDF 2WWXA 2CLDX 3UKDA 3I62A 3MWYW 4JVMA 2ZQ5A 5D3MA 1JAIA 4MYHA 3CLOA 2PX0A 5TB5A 5DISB 1E9FA 1JJVA 1E2PA 4O2RA 1JEEA 2KB0A 2NO6A 4B6FA 3SZRA 3A4NA 2A7QA 1N5JA 2NGRA 3GLHA 3ZQ5A 1D6JA 3MUFA 4ACAA 2ZSFA 2ZS7A 3P4YA 1X1SA 3FG8A 2D3WA 2RB4A 1E98A 1ODVA 2GJKA 4NTZA 2J0UA 3LW8A 2IWRA 3SN6A 4HAYA 1DARA 1KDOA 4PO8A 2IF2A 1SXJA 2O8BB 3GLIE 1IOZA 2GK7A 3ZDQA 4CEJA 5ELXA 4NONA 3C4JA 3BB1A 2H8KA 4TQAA 3BXZA 4GS9B 2YKHA 4MDEA 4G3XA 5EJEA 1UAAA 3CRRA 4TYNA 4HAXA 3V9PA 3DOFA 4KU4A 4A4DA 2JLUA 1YQTA 4URZR 2GCPA 3EC2A 3AUYA 1AM4D 2ZJ5A 3IHWA 2BHRA 1SULA 1Z0AA 4EFNA 3H7WA 5DI3A 4AKIA 1XJ4A 2LKCA 3EA0A 4NYIR 5J4VA 5KSPA 1PVOA 2GHIA 4OKSA 1ELOA 3I8SA 1DAHA 3L0IB 4ZI3A 4WOPA 4GBMA 2P2LA 2ECKA 1T18A 1UWNX 1IN4A 1HT1E 4HZIA 4DDVA 3CO5A 3NG1A 3GP8A 1AGRA 4PO1A 2GXUA 1OTDA 1CBUA 4AD8A 4E03A 1XD2A 2N46A 1SXJD 4WZAE 3ICQB 4KBFA 3TR5A 1P62B 1KNQA 2WJVA 1VG9B 2G0TA 3LIBA 1G20E 2GDJA 4HP9A 4F93B 4KI0A 4CEIA 3K3DA 2X2EA 1XTIA 2VPPA 3RS2A 1ZU4A 4H6JA 5EZ6B 1RRCA 2CK3D 2QQEA 4QXAA 4UXJA 1FX0A 3RDPA 1E2GA 2Q21A 1RJ9A 4W5HA 4EEPA 3RWMB 4TLEA 1SHZA 2R8RA 2Z4SA 3LA6A 2AN9A 2GRJA 1DAKA 2V0UA 3SQWA 1E9AA 3REGA 5FL7D 1WQ1R 2ONKA 3BIFA 5KTYA 1QHXA 1VYTA 1XCMA 4NXBA 4Q7MB 3P32A 3UATA 2C9OA 3D72A 4II7A 2H57A 4W7SA 4EUNA 3WNCA 2FFAA 3LUQA 5F9FA 2YWHA 2A5JA 2VSXA 3LQQA 4JLPA 3HR8A 2NG1A 2WSSA 2ZTSA 3KKQA 4BLQA 1F2UA 4LV8B 4LBYA 3CNLA 1Y63A 5GJVC 4JZKA 1CJKC 1G6HA 1YZNA 2BM0A 3QKSB 1CJTC 2B7CA 1UDXA 3SEAA 2KBEA 4PAOA 1RKBA 3G0HA 5TVKA 4GPTA 4DB2A 1I4LD 2F3TA 1BYWA 3B82A 2CCGA 2HF8A 3RS7A 1G5RA 4Q03A 1KNXA 4P31A 4B71A 1S66L 2V54A 5H8WA 4BFUA 1E0SA 5DJTA 5JZVA 5L3QB 4RZ3A 3W8RA 1PLKA 2IUTA 4Z8XA 3W3AA 1Z8FA 4C2UA 3PUYA 4N3NA 5FPYA 4M21A 3CH5A 1D2NA 2QP3A 2ZYUX 4EPVA 3B85A 2LCFA 5DSZA 2ZREA 1ZNYA 3I5YA 2PDRA 3SW1A 2NO0A 2ZXUA 4GP7A 1DAEA 1XEWY 1OIXA 3IBGA 1EFUA 3ONWA 1V9YA 4GHIB 1KI7A 4E09A 2D01A 2HLDA 5B2ZA 1S0UA 1ZD8A 1M34E 2VP5A 3B9QA 1N6NA 4QRHA 2VL7A 3K53A 2QMEA 3PR1A 2VF8A 4QNMA 1OXVA 2VO1A 1XTSA 5DHFA 5JJKA 1NBMA 1NG1A 1GTVA 2VHQA 4GL2A 4DEXA 3CAXA 2QMOA 3L43A 1PV4A 3LQRA 3QXHA 3F1PA 1Z5ZA 1E2DA 2XZOA 4HZUA 1G291 1W48A 1XRJA 3BD9A 4RFSB 5FOXA 2PD8A 4Q1AA 2Q9AA 1RRGA 4OHVA 3GEHA 4DCUA 2IYYA 1C9KA 4QKQA 1XF9A 3W6PA 3ASZA 4PX9A 5F5YA 5HPYB 1A1VA 4PSVA 4ITRC 4PANA 1ZIPA 1P61B 5JS7A 4WIAA 1A5TA 5DYIA 1COWD 3LIEA 3ADKA 4OJQA 2GXAA 1XJ2A 1SVMA 4ZDKA 2H28A 3SI7A 1OFTA 2A78A 1QG4A 3FDIA 5AUOB 3ULFA 4E5UA 4FCVA 2ODNA 4LV6A 3SR0A 4MKIA 3QXJA 4BRUA 3HPQA 2F55A 2ZI4A 3TW4A 4D4KA 2JLXA 1X0OA 4Q7JB 2J1LA 2VBCA 3T5DA 5TY0A 2BC9A 3PUXA 4JYBA 5FOWA 4ESHA 3AKCA 2CXXA 2GCNA 1JB1A 1Z47A 2WJHA 4L16A 4HUTA 4F92B 3B7GA 1IBRA 1EFRD 2BCJQ 1YU9A 4Y0AA 121PA 1ZD1A 1E79D 3K70C 2J59A 4QJ3A 3F3YA 4HHDA 3QBVA 3E4QA 4HIAA 4QG7A 1XCPA 2EYQA 2J7PD 2C77A 2OEPA 2P6NA 4DZZA 5JWRA 4LBZA 5BYKA 2I1QA 1JNUA 4D82A 1CF4A 2PJZA 4F3LB 2VP6A 5BXQC 2ZU0C 2B8WA 3OEEA 4URUR 4WA7A 1Z83A 4RJLA 1GNPA 2AWNA 3X1DA 2DHRA 1LNZA 1KY2A 3RTYA 3WMGA 4AI6A 3NHQA 1VTKA 2ANBA 3RRYA 2FPKA 2OAQ1 3TH5A 1KKMA 4DUGD 4TYYA 2W2VA 3O8BA 1CRPA 4RD6A 3WNBA 3RLFA 2ZS8A 4A9AA 3GLFA 2QP4A 4BECA 2MSEB 3BY8A 1U8AA 4DLUA 4B48A 1TQ6A 2ORVA 1GWNA 4JIMA 5JFGA 4AY2A 4AG5A 4NCHA 4B9OA 1AN0A 4OI1A 2GZDA 2BV3A 4DLWA 3DEFA 1KAOA 3OEHA 2FGJA 2IYLD 3C16C 4I1SA 2F1JA 2QN6A 2DFKB 4JYCA 5TBMB 1KI4A 2ZRKA 2FX3A 4QGGA 1VCNA 1Z0JA 2QRZA 4L9WA 3SHWA 4BZQA 5UKDA 2DY1A 3IIKA 1LB1B 2CCJA 3CZQA 4TMVA 5FPSA 5HCIA 3TBKA 3ND8A 4AK9A 3WP1B 1HQCA 1TMKA 4L15A 4IFEA 1G5TA 1U8ZA 3NXSA 3BWDD 3IEUA 3OFND 3QXCA 2V1AA 2IS1A 4CF7A 1VHLA 1W47A 2ODBA 3NHAA 4BRWA 4C9BA 2GJSA 2R6AA 1Z3IX 5E7JA 5FFMA 5KSZA 2AX4A 1Z63A 2Q3MA 2QZ4A 1G8FA 4DHEA 5TDHA 4HB2A 2ORIA 3WXMA 4WZBE 3E1SA 1FTSA 3C8UA 4MH0R 1G3MA 3KKOA 4TL6A 1FFHA 3GFOA 1VG0B 3BE4A 2G3YA 2ATXA 2NO7A 5AJXA 1KSJA 2PR5A 3L8ZA 4GZMA 5FUWA 4XSHA 3K09A 1E9EA 4I39A 4WVFA 1XD9A 3GFTA 1MR3F 3FMIA 3PEVA 3TW8B 3UXMA 5KPDA 1CR0A 4GRAA 5CITA 3FKQA 1L7VC 3LXRA 2IT1A 1XFQA 1G7TA 1H8HD 4OI2A 2NPFA 5HKKA 1D2MA 4LGMA 5BYJA 3TUIC 4CVNA 4TL7A 4DDWA 1QHNA 1AQYA 2JLRA 2VHTA 4GOKA 3E4PA 4EERA 5D3MB 1OTEA 5HZKA 1OT9A 1FMJA 1AA9A 2QROA 4XJXA 2VEAA 2H1LA 3GLHB 4KUOA 3RS5A 3NDBB 1SVIA 2C99A 4EQ6A 4UNRA 2XNDD 3GLGE 2CBZA 2J0UB 5KNBA 1P3JA 3HP1A 2FPLA 1BO6A 221PA 1W36B 4HOIA 1CU1A 4JGRA 5EXTA 1TU3A 5HD3A 3R20A 3AVQA 4Q4AA 3K0EA 4CEJB 1AS0A 3THXA 2XTZA 3WMFA 2XNSA 2R2AA 1P2VA 3EW9A 1G17A 2OCPA 4XTCS 4KSCA 1KK1A 2JLZA 421PA 3EASA 1WBBA 4MYTA 2ZM5A 3KQLA 1IY2A 1ZBDA 3AB3A 1FOEB 1YZLA 3CRW1 3H7WB 1VYUA 5AJZA 5DI3B 4CDGA 3KQHA 3Q9LA 3FVQA 4H1VA 4DT1A 1R0XA 2J3EA 3N70A 2PYRA 4KLZA 5HDDA 1SVSA 1EX6A 1G19A 2XXAB 4JJKA 5FH9A 1DP6A 3PITA 3TSOA 1N9OA 4IHQA 1S67L 5KDDA 2FA9A 3CWFA 1F98A 1GKIA 4I3JA 1R5NA 1U0LA 3CX8A 2V0WA 5KOYA 5J5CA 1K5GA 1XD2B 5DJUA 4M1WA 2WMOB 5KDLA 5LD2C 4AKEA 2OUKA 3LH5A 3K3CA 1NN1A 2RMKA 1E0KA 2HT6A 4DDTA 4BLRA 1TAGA 2W0SA 1WBDA 1KGDA 4R3AA 3DHWC 4M1MA 1VKJA 2J7KA 1Q21A 4CRWB 4H6JB 4PHFA 2Q0HA 4M53A 1QVAA 1KTVA 3UMRA 3CPEA 2VP4A 4XVRA 4JT4A 1RJ9B 3TR0A 4D25A 2JN7A 3OAAA 3LNCA 4UNNA 3AVPA 3TAHA 5L3RA 3CX6A 3A1SA 2IC5A 4UJ3A 1Z6AA 2R6CA 4S35A 1E32A 2A24A 1FQJA 2P0EA 3VMFA 1HEIA 4OK5A 3IO5A 4LJ5A 3CNNA 3TNFA 5FL3A 2Z43A 3SYKA 1IN8A 1QZXA 4FCTA 4LZZA 1QHYA 4RQ9A 3AKEA 3MRSA 4DKXA 1F2UB 1IN6A 3CW2A 5BWMA 3G5UA 1GNQA 5IU1A 1G7RA 1NIJA 2GJ8A 1HUQA 2A3RA 4BFTA 4BBVA 3IO3A 3SBDA 3AKYA 3LRPA 2YOFA 3N2EA 2GAAA 1W4AA 2JJ1A 5EE5B 4ZI2A 3VX3A 4FN5A 1VHTA 1BMFD 1W5SA 5EE3A 3Q7PA 4XD7A 4Q1DA 4B3XA 2PZGA 1CR4A 2FJUA 3BWLA 4BLTA 2O5VA 1JEDA 2PCLA 2A30A 3HU1A 5CJ2A 4G01B 1OPXA 4IRUB 3VKWA 4MRNA 5HR5A 2RHMA 3F8TA 1X8JA 1CLUA 5CM8B 2BBSA 2JCSA 4EPRA 4EPYA 5EUQB 4TTRA 2XB4A 3DKVA 2BBTA 4DLXA 4JGQA 2FN4A 3QY0A 1V9ZA 2YOHA 1N3BA 1D8TA 1Z0IA 1WF3A 3LO5A 3MJHA 3U6BA 1JI0A 4YC7A 1NJGA 1T3SA 5FTKA 3T34A 2XTNA 4F7WA 2IS2A 4LHYA 5HTKA 3F5FA 1G5PA 2VYFA 1OH8A 4A8JC 1QHHA 2IYQA 5EP1A 3QI2A 3RNLA 1E9DA 1E2MA 5CJPA 3A37A 1P2UA 3EA5A 3FFAA 4ZCLA 2ZI7A 2ZJ2A 4RVCA 2JHEA 1VIYA 2JJ1D 2EW1A 4DRZA 2FOLA 2R9VA 5H1YA 4LHXA 4P4SA 2JLWA 5CIQA 4E04A 1VMAA 1G3RA 4B34A 4Q01A 2O0HA 3F1PB 3B1VA 4PKYG 4HZUB 3UG6A 5G3YA 2VP9A 4TYQA 5FUVA 2CVFA 3UG7A 1E9CA 4RFSA 1JR6A 5BN4A 1TNDA 5HWWA 2ZSEA 1KI3A 1YVDA 3PG5A 3E4OA 2A5DA 4GMXA 3RH8B 1SVWA 4DDUA 1S1CA 3IGFA 2OHFA 4XH9B 2QAJA 1NRJB 5LDDC 3F1OA 5G4YA 4X8LA 3PJRA 3C5HA 2QHKA 1BOFA 3AGQA 3CF2A 3LD9A 3H82A 1HTWA 1P9WA 3P7NA 4K8OA 3VE3A 4KVGA 3QNUA 1AS2A 2GKSA 4EW7A 1AS3A 3GJXC 3KJEA 4UJ5A 1VB6A 5J7EA 2DPXA 4BZPA 4W9MC 5FOVA 3W9YA 4ABYA 2ZR7A 2C9YA 2ZYVX 1X8LA 1D2EA 2QKPA 1U90A 1UBCA 2ZJOA 4XWAA 3ZQ6A 1XFNA 1OTAA 1IY0A 2I9VA 1LF0A 2ZVQX 1TEXA 3ZD6A 1B0UA 1S4RA 3AF0A 3EEHA 1X1RA 3U4QA 1BKDR 1QHIA 1U8YA 2P67A 1LFDB 3KDSE 4KCGA 4NE2A 5HE8A 2BKUA 1W4RA 4NYMR 5KNDA 2OXCA 1KI8A 4RCZA 5EXXA 1KOFA 3UK6A 3THOA 1XX6A 5IT5A 2QENA 3KTAA 4OQFA 3GD7A 1EG7A 4PR0A 2PYPA 3WYAA 3FE2A 3DVLA 3DMDA 2YC4C 2YKFA 4PPFA 4IJMA 5FBVB 4FMCB 4QHTA 3RVBA 4G1UC 2WJYA 1G64A 2WZQA 1YRAA 4L9SA 3GLFB 4OHXA 3RS0A 2W0MA 4G5OA 1ODFA 5TMPA 3KQKA 4TL9A 1XCGB 3K0FA 3U3JA 3LIDA 1KO7A 1YR8A 2W6IA 1D9ZA 3UMEA 1SVLA 5J4EA 4DLSA 3K9NA 4R2IA 5FPTA 4V0LA 3S1AA 1N0WA 3IBRA 5EXSA 1GILA 2RAPA 1S1MA 2VH5R 3BRWD 4Q1FA 3ZH9B 4ASUD 1Z28A 1XU4A 3VU9B 1MO3A 1NN5A 1XMVA 2IX3A 1G3IA 2AKYA 1TS7A 1JALA 4DWJA 4M22A 3UB9A 4D4LA 5TBMA 1UKVY 2Q9CA 4JT2A 5AUQA 4GDFA 1NSTA 2F9LA 5CB6A 3A1TA 3B78A 3TGPA 1SKYE 3PXGA 5LPNA 1N9NA 2WBLC 1KSHA 3OE7D 5IHPA 1V5WA 1XJ3A 2FNAA 1HH4A 3V4RA 4D6PA 1UADA 1EWRA 3QPUA 4MRRA 2J87A 2IS4A 1JECA 1OTIA 2WJIA 4C0SA 1Q3TA 3GCGA 2EU8A 2PLRA 2I1VB 4LRXC 1F2TA 1G8YA 4G0NA 1W0KD 1OKKA 3O8RA 2V8OA 2IEYA 5DI9A 1JR3E 5FTJA 4L4UA 4KQDA 4B33A 3ASYA 3MG9A 4O0MA 2QNRA 1TADA 3MFYA 2EQBA 1MO6A 1OE0A 4C2TA 4TSFD 4HLQB 1PUIA 4AC9A 5CDFA 2W58A 3M1IA 2QT0A 4JBWA 5EQTA 3UMFA 1KK3A 4IXNA 1G4UR 3B8HA 4IDPA 1ZM4A 3FYHA 1R8SA 3N5CA 1R5OA 5FBQB 4NYJR 2VSOA 1RZ3A 3ADBA 1BS1A 2IYVA 2VLIA 1JNYA 4XWOA 1ZRHA 2AHOA 1E1QD 3FHTA 3TLXA 2MSCB 2WPDA 5KDOA 2O8DA 2HF9A 5KHOC 5KYKA 2BJVA 2IHYA 2WMNB 1CJUC 4H1UA 1SVKA 4JBYA 4XSGA 4RFVA 1ZCAA 2EWVA 4ZIRB 3THYA 3SDZA 3FKSA 3QXXA 2CNWD 4EQ6B 4IOMA 1YRBA 2RGAA 4UXIA 3MSXA 1P97A 4HYYA 4B47A 3THWA 1L4UA 2RCNA 4Q1CA 3C8CA 1GIAA 4RD4A 3A6PC 4HH2A 1R10A 4A2WA 4KLNA 4Q4AB 3A0SA 4M1SA 2F6RA 4HQAA 2YWFA 3CM0A 4LX0A 4TN1A 3K0SA 1EX7A 4GSYA 4WAUA 2W83A 3IS2A 3QSYA 4MITA 1OIWA 2FF7A 5JEEA 3HDTA 1YR9A 4K81B 2K5UA 5K8TA 1CJVC 3BJIC 5IK2D 2KX6A 2V7QA 3OIVA 3M0EA 4TQUS 4BQSA 3T50A 5E7MA 4FWTA 3C2WA 2WV9A 5HSQA 5E7IA 1G16A 5CYPA 1QHSA 4GZLA 4KFSA 1U94A 4HAZA 2XSZA 3W3ZB 2DWPA 2QM7A 4V02A 3I5XA 4V0ME 4MRSA 1F5NA 2QGNA 4IXMA 4BFWA 3F1NB 4DT1B 3IIMA 5GJBA 3NBZC 4JLBA 2WIBA 3Q7QA 1JXMA 4PC6A 5CIWA 1P72A 2I4IA 3ZIAA 4WF0A 3QG5A 1D9XA 2OCYC 3W5JA 3VR3A 1GSIA 2XXAA 1AJEA 1NVWQ 5JRJA 4OL0A 2B6HA 4EQ1A 2WJGA 1NVXQ 4PSAA 1IM2A 3ADDA 2W27A 4RKFA 1RYFA 1K8RA 1M74A 4HNBA 4HB4A 4Q48A 1W36D 3SFVA 1YZUA 3D3QA 3FFBA 2FEMA 3QVVA 1EESA 3TVTA 2R6DA 1O87A 4CIDA 4DJ3A 2QMUA 1P9RA 4E22A 1KO1A 1N5LA 1BH2A 5AJYA 4A82A 3HJIA 1G9XA 2BWJA 4QC2A 2IXGA 2F7SA 1R0WA 2OBMA 2UKDA 4JSTA 2O52A 3KXKA 3GJ0A 2ANCA 1UJ2A 3AF4A 3GLHE 3BB4A 2A24B 1GRRA 3B60A 1NVVQ 1R8QA 1W44A 1GP2A 1FUUA 3LDAA 4C0JA 1KAGA 3KKPA 1N6IA 4LDJA 4PQFA 4C0KA 3CBQA 4PQRA 1SXJE 1E2EA 3LYXA 2QY9A 4JGOA 5DIFA 3DZDA 4YQFA 1NG9A 1S8FA 2ZIAA 1TS6A 2XB2A 2RH5A 3NH6A 5KSYA 1ESMA 1TF5A 2D06A 2FPMA 2GAOA 2CLSA 5B58C 1RVDA 3QEJA 3KL4A 4C0AC 3SYLA 2NMVA 1WE2A 4POAA 1Q44A 1KO4A 2IYSA 1KDPA 4X8MA 2KI5A 1CIPA 2A9KA 1G3QA 4LC0A 4BASA 2OLJA 5CM9C 2A2ZA 1UBGA 2V1XA 1IN7A 1ZNZA 4BPBA 5JJIA 1J8MF 4NHOA 1QBKC 4QBIA 3IUYA 4NPHA 1J70A 4NCIA 2QTFA 3QENA 4DLTA 3ZLJA 5J4KA 4QM6A 1X86B 2YYZA 4OYHA 1JPJA 4IDQA 2FMXA 1I4DD 3PENA 5GVRA 2C2HA 1TL7C 2PBRA 1GL6A 2FSHA 2BDTA 2WSSD 1QHHB 3HWSA 4O25A 1TPZA 2A5FA 2HXYA 2ZUBA 5JCZA 1FW6A 2O8EA 4L9GA 3JVUA 1Q20A 4LHZA 4PC7A 3NBFA 2GXSA 2UZIR 4QL3A 4P4SB 3X1XA 1T19A 3EZ7A 5DKKA 3EG5A 1W1WA 4BLSA 2HJGA 1L4YA 3R9XA 1FNNA 2FH5B 3FMFA 4LYJA 3U3RA 2QG6A 1II0A 2EYUA 4WUJA 2GEUA 2VQSA 2D02A 5JRZA 3ND9A 1ANKA 3FTQA 4NXEA 3RAPR 4LY6A 3BH7A 2P3SA 3NIBA 5EP2A 1V43A 3F1OB 3BFXA 4B6EA 2HT1A 3TMKA 2GESA 1DS6A 1VIAA 2IUUA 5J47A 2FFBA 3H82B 2GTPA 2CHQA 2RGDA 3AM1A 3B33A 2CDNA 3IILA 4M1TA 4F4JA 3CONA 4I3AA 1G8GA 1W0JA 3KB1A 3CF6R 4OQXA 2WTUA 1OSNA 2HLDD 3EAQA 5FTNA 1EFCA 2JDIA 1XWIA 4M1KA 1D7EA 5SZHB 4Y0VA 3T1VA 2H17A 4EJSC 2JJ2A 4B35A 1CJMA 5DGXA 3ZVNA 1S4SA 2KBFA 1NBMD 2Z6VA 2ZRHA 2FZ4A 3EIQA 3KB2A 5FBRB 5G41A 1GZSA 5GJWC 4MGIR 4KFRA 3TIFA 2P6UA 2C98A 1E9BA 3QE0A 3NH9A 1C1YA 3SE0A 4GI7A 1K6MA 1ZM9A 4EIWA 3U4QB 4TZ6A 4DC9A 1ETUA 4G5SA 3UE6A 2JIZA 2OOLA 1T4GA 5EZ5A 3VR1A 3EIEA 4NCKA 3C14C 3LBIA 2BVNA 2XGJA 2FE4A 4EPXA 3AVXA 1IXZA 3TUJC 5TV2A 1LSVA 1G7SA 3KTAB 2IBMA 4JLVA 1OXXK 1OF1A 5M04A 1FUKA 4FMCF 3EIHA 4QM7A 1RE0A 4D26A 2C9CA 2CL0X 4U5XA 2WWYA 1KDRA 1NBME 3LVRE 4U7DA 1Z08A 2PL3A 2J0SA 4M2LA 1KK0A 2G1KA 2DFLA 4A6XA 4IOLA 5FBWB 1AKYA 4C0LA 3K0FB 2RGCA 4Q9LA 2BEKA 1DADA 4HLDA 4R6LA 2F9MA 1ZIOA 4JSYA 1GSWA 1IJFA 1OXUA 5EP4A 2RKOA 4B43A 2OXRA 2HYIC 3S1AB 2P65A 2ZRJA 4QGHA 2V3CC 3AVVA 4M0LA 3U3KA 4G5QA 1G8PA 4AYTA 1F9IA 4H9GA 2OAP1 2JIZD 4OJKA 2REOA 1KOUA 2YKGA 4D0NA 3D8BA 4WZ6A 1P6XA 3VU9A 4MGZR 2QEQA 2AWOA 4A8JA 5L3VA 2ODWA 4HDQB 6Q21A 1NL3A 3KUCA 3ZZTA 1ONBA 4NCNA 3OEED 4BFYA 1O3YA 4P0TA 2YINC 4YWZA 4KBGA 3MWKA 2ZE8A 4US0R 3PIRA 4M9QA 5EE9A 4OHZA 5J4LA 3WNDA 2PR6A 1ZUHA 2Z0MA 1US8A 4CZ2A 2ZR0A 4PAQA 3AVTA 4NMMA 4YMTA 1DAFA 3VE4A 4M8NE 4I1VA 3OIUA 4LJYA 3RRNA 1F2TB 3PEWA 3AVOA 2O0JA 1OLOA 3PCRB 1IN5A 1E0AA 4IFBA 1YHNA 3FB4A 4LHVA 2B02A 1TUEA 5G40A 5B64A 1T3LA 1OB2A 1FZQA 1E2IA 1G8HA 1SZPA 4FXPA 5A4JA 2H16A 4IOJA 1S2MA 4LJ9A 3UIEA 2ZSAA 3A1VA 1ZAKA 3LVQE 4E07A 4EFLA 1PUJA 3OEHD 1OFHA 3QJYA 3ZVLA 1A7JA 4W5WA 4NZYA 3CR8A 4ACBA 1KYIA 2F43A 3K1JA 1WMSA 1M6NA 1XXHA 2B92A 2QUZA 2M1CA 3LV8A 2CL6X 5JHHB 1T1BA 1RPZA 4B3FX 2ZRBA 2X19A 1GRNA 4QBGB 1JPNA 3I73A 1DP9A 5HWVA 1DVRA 1KSGA 4QGFA 4RD2A 4IVRA 1NMXA 4Z1MA 1EFHA 3GLFE 2ODEA 3K70B 2N42A 1AQUA 1T0JB 2O8DB 2GCOA 3A4MA 4Q18A 4C0BA 2V6IA 2VV8A 2FWRA 2MMGA 4R9UC 3X1ZA 1MKYA 3R8CA 1GAJA 1KO8A 2CEAA 2QGZA 4GOJA 4LBVA 4Q9IA 5H68A 2JLYA 3THYB 2WOOA 1PJRA 1ZVQA 1F6BA 1RYHA 1Z29A 2RGNC 4ZIRA 3AGPA 2OFWA 4JL8A 4FIDA 1U2RA 5AVFA 3THWB 1JQLB 1Y28A 4QJ4A 3I4LA 3IDQA 3U3MA 1E3MA 2HDNB 5HD5A 1MH1A 4MDFA 3IQXA 1I2MA 1HE1C 4A0FA 3H4MA 1AIPA 2PZFA 4J0QA 5CK5A 2C95A 3HU3A 2ZBBA 2A5YB 3GJ7A 4DCSA 1VECA 3I1FA 3WY9A 1XJCA 3IS2B 4KODA 1OH6A 4TT3A 5JLJA 3CRMA 1UKEA 2ZJ8A 1OFUX 3KXLA 1CR1A 3L0PA 3B13B 4JLNA 1Z07A 2GJ9A 2EVWX 1DBSA 1ZD9A 1CP2A 4FMDB 3LLMA 3RC8A 3X1WA 3PHYA 4ZO4A 3TSWA 2QA5A 3OZXA 1LVGA 4LV5B 1S9HA 4MKFA 2BCGY 4R98A 4BFXA 1N0VC 5AUNB 5HKKD 1E2HA 2Z6CA 2P6RA 1NLZA 4D4JA 3RSOA 2QU8A 3KZ1E 1KIMA 2OM2A 4LUCA 2QRNA 3AF3A 5GJCA 3F1NA 2AK2A 2NO1A 3VHLB 4HSEA 3P4XA 1T0HB 3CWQA 3PEYA 1X6VA 3NTUA 4XVQA 3VKHA 1N6HA 2OFOA 3T06B 2L4RA 3U7EB 1Z06A 4B3GA 3BS4A 4B44A 3EZ9A 4JLJA 1KK2A 5FPHA 4GNKA 1GL7A 4DSUA 1IONA 4YMUA 3UWOA 3FHCB 2J46A 4WXPA 3KX0X 4UKDA 2GJ3A 2XZPA 3AQ4A 4AURA 3T1OA 1AKEA 5JI3E 5CLQA 4RSGA 4LRWA 4P4TA 3ZD7A 1Q12A 4D2IA 1XDBA 4PXAA 3L2OB 2E9SA 4XIGS 1Z6TA 8OHMA 4PZZA 1MABB 2VF7A 5FUXA 4YONB 3X2SA 1XJ0A 3FHOA 1XJQA 4WL9A 1VDZA 2J9RA 2OZEA 4JVSB 1E2JA 4KV9A 1W4BA 5DE3A 3I61A 1TF2A 1KJWA 4PSKA 3FGNA 2IS6A 4CW7A 4BLPA 4LCBA 4X8HA 5LB4A 4V0OA 2W6JA 1GNRA 4K46A 2BMJA 3EZ6A 3HJKA 4BLOA 4N1AA 1XZQA 1YZGA 3LLUA 5JHGB 2D2EA 1ZJ6A 4W5JA 2OWHA 4US2R 4TMKA 2OCBA 1T8UA 1TS8A 1XMIA 4I1OA 4IDHA 3BAFA 4NYJQ 2IW3A 2ZRGA 3MJQA 2P5SA 2BBWA 2QT1A 1WDTA 4QFMA 5FR1A 2XJ4A 1KSFX 3KJIA 4GW9A 3EC1A 1ZC3A 2ZSDA 4DSOA 1YZQA 5JWOA 2ORWA 3AF2A 4F38A 3GFPA 1NWZA 3J81k 4I3IA 5DN6A 2YVUA 1NN0A 4EFMA 4MGKR
chains in the Genus database with same CATH superfamily
1OX4A 2AR7A 5JE8A 5DBHX 3BE8A 3H9GA 3ETDA 2D62A 3LXXA 5HIAA 5J63A 4KJXA 2E49A 3N0VA 1NE2A 2ZJ4A 3GEIA 3IJ5A 2GPNA 4Z54A 4KO2S 4R54A 3H2SA 2XT9A 4E33A 4YQYA 3OD1A 4L2IA 4U5QA 5FWXA 1B2RA 1Z22A 1EK0A 1EUQA 4XDZA 4D9FA 3K35A 1Q77A 2A0XA 3UV6A 4IO1A 1VOTA 2FJ0A 4NOLA 4JN6B 5CTNA 3IAM6 2PWYA 3ETGA 1AU9A 1ZPDA 2Q3CA 2PV7A 5TX7A 1DC6A 1NMEA 3CMCO 1RI5A 2HO4A 4KXUA 2EFJA 1E2NA 4J3NA 2P2DA 1NNEA 5HX9A 2QE7A 1KVRA 1EWKA 4YH1A 5IULC 1K97A 2HJRA 4OVKA 4TUYF 1R5BA 1KE1A 3KYDA 3QKWA 2X1MA 3N2GA 4X6LA 2OYRA 3VQTA 1PUXA 3FRJA 5C8YF 4R31A 3W4OA 2PMWB 2VJMB 1TEVA 4NK5A 5BV1A 5C51B 2QUIA 1HLGA 1N5IA 1RRFA 4L3WA 3GLVA 4KYUA 4TWZA 5AVUA 3W5BA 4IZOA 4K3VA 1FL9A 4HLUC 4HY8A 3IAEA 4AKTA 2KJQA 1CVIA 3DFKA 3QP6A 5D3ZA 3K92A 2WU0A 4O01A 3WHKA 3EWSA 4F5ZA 3P2MA 1XTJA 3B6KA 3VNVA 2H63A 2I7VA 3ZFZA 1QDUA 3TAUA 2KX7A 1FY2A 2DE0X 2VJCA 1P81A 4S2NA 2J3MA 4PO9A 4MBFA 2Z8XA 2DHCA 4G0QA 4IJVA 1FSZA 4BO8A 1TM1E 4B0PA 4DCTA 1R0LA 2J5BA 1VLLA 1ERQA 4CKBA 3K94A 1H5UA 1N0HA 3PC4A 3EISA 2FPGA 3HCDA 3CE6A 4RIFA 4D7AA 2HX1A 3IKLA 1G4AE 5T4EA 3M89A 2V1BA 2P0AA 4MQBA 5H02A 4B17A 4UQOA 5AJTA 4LJAA 1A9YA 1CS4C 1YL7A 2X22A 1MX5A 1SXIA 4MIKA 4P33A 2Z9CA 4XCXA 2REQA 4CGZA 3NJ4A 1KRXA 2P9JA 4URYR 4HEJA 2WUVA 3RS4A 1UBNA 2ZI5A 2J3DA 1H8ED 1CEGA 3G2LA 2WE8A 3GAFA 3P45A 3D7NA 4CDNA 3HLCA 1VL6A 2HP9A 4Y2VA 4WMCA 3RTDA 1L5HA 1QOZA 4I9HA 1PG0A 4EBPA 1ZMOA 5B3LA 2Q9NA 4QYSA 2PKEA 4YV7A 4OQMA 3D6NB 3FD8A 2H18A 4LRZE 5CNKA 4LV2A 1QYCA 2C7RA 4FWIB 1L4FA 3DM9B 2J41A 4GMDA 3SC6A 4JLKA 2ZTUA 2FQ1A 2XUFA 3IRUA 2DECA 2OPHA 3DAOA 4GM1A 4JB3A 3H5OA 3OQ6A 3KKNA 1JMKC 1LDBA 4QSMA 2I62A 4ZGWA 4WEOA 4FOFA 5KOJA 1X0XA 3CG5A 3L04A 4JXGA 2WB4A 5LZ4A 4NXGA 3C5AA 2RI1A 4RPCA 1JAHA 4HP4A 4L9FA 1RIFA 3UHOA 1XELA 1OI4A 1XZGA 1YJBA 4LSGA 2VGJA 3MELA 3QVTA 1JRLA 4BVJA 4AMGA 4PYIA 2FWMX 1OV4A 2WTAA 1ZH2A 4RK0A 1DTSA 4U9IS 3PT5A 2JJ2D 1JWPA 1IXSB 1QTRA 3VTAA 1ZWLA 4IQ0A 1JH9A 8ATCA 5CFNA 5F69A 3TZCA 4JI6B 4HFJA 3OFNA 1MX3A 4W5TA 3GVBA 4IUCS 2ZRFA 1UPCA 3Q7VB 2CNNA 2P9CA 3LHSA 1XMPA 4NBNA 4K9KA 4MPJA 1KYYA 2B34A 3CH6A 1SBYA 3GJZA 5AI6A 2IXEA 2Y2JA 3IF6B 3OFJA 3S8MA 5GM2A 5FORA 1AKTA 5H4HA 3TSZA 1E1MA 4EJSB 3RANA 4EETB 1WDLA 2KQUA 3RS9A 4B7XA 4XJVA 3AINA 2QMHA 4OOLA 4DLPA 2VGLM 1RRMA 3SZLA 3KPUA 1A96A 3A2MA 3CW9A 3O5YA 4AKGA 4L8LA 1W0CA 3QVXA 3T15A 3QVLA 4UBOA 3I2GA 3ROTA 3TDKA 1ZA2A 3D7SA 3MNFA 3EXHB 5IU6A 2WWTA 4Z4EA 1D2RA 4PQYA 2NO9A 3HABA 4Q4HB 4R1PA 3DF9A 2R751 5B1DA 3T12A 1V3QE 1Z2AA 1Y5MA 2J5KA 4TLDA 4NP6A 4OYLA 4XM0A 4TS4A 4U39A 3HLTA 3A31A 4J2OA 3M4XA 1UKYA 1CHDA 2E4ZA 4JJ6A 3VOTA 2NT4A 5KQGA 4XVHA 4WE3A 2QLJA 4OMFG 1TFRA 1M34B 4C7VA 1XQWA 1ZEJA 3DOUA 1JTGA 2G9ZA 4E14A 4J91A 4KXFB 1IQRA 4C88A 3K1YA 3PHBE 5CLLA 1F06A 5ANRB 2J5QA 3UAXA 4G0WA 4K3UA 1J56A 3SF8B 5B1IA 3AKDA 1HV8A 1U1EA 1RXYA 4V2UA 5CEBA 1TZJA 4WXYB 1VKRA 4DEYA 2FG5A 1WSDA 1Y4UA 1GZHB 1ADYA 2D0PB 3F1KA 4JVOA 1A97A 1J2JA 4PZ0A 3RAFC 3GMDA 4A0HA 2P2NA 1Y3HA 5CHYA 3K6RA 5E4JA 4FBMA 1T5LA 3K71B 4GQBA 2ZUTA 1E3WA 3ZV5A 1XPOA 4L5BA 4JS0A 1MDFA 1UK8A 1FTYA 2I91A 1ZP6A 3H4VA 4C7OB 2EFXA 5EA2A 4F3YA 2OQ2A 2BIFA 1X1EA 2ZS9A 4HG2A 1HT0A 5LYJB 3PHGA 4ZDJA 1GHIA 1TQ4A 3KUKA 4G36A 4PU0A 3O4IA 1XJ6A 2PCJA 3BRWA 4QG3A 1JR3A 5GHXA 5KIZA 5F78A 2XEPA 3VFFA 4BGEA 5JDIC 2BDEA 1GOTA 5E95A 4GGPA 3FDXA 5I7EA 3CRVA 5IP5A 3PNOA 4OA5A 1CE8A 8LDHA 4WBNB 3OPPA 2IUFA 1UPBA 3IEKA 4WL0A 2ZUEA 2DLCX 4P6ZM 4L22A 2XD4A 4YXWD 1ONNA 5EIWA 2O7SA 2FY8A 1TTTA 1VMKA 3U7RA 5E9AA 1SK9A 1YSCA 3RWOA 3HZZA 3D2LA 1X94A 1DBWA 1NJ4A 1A4IA 4HWGA 4EJFA 2FKAA 2WICA 3DBOB 1HDEA 1ZYUA 3DFIA 5K3AA 3G6OA 4R3WA 3PIIA 3SQXA 4P98A 1ZMXA 3CPSA 3WWCA 4KXYA 2LD4A 4GOGA 1PI5A 1CX9B 2DH6A 5LMCA 4AXXA 3LJKA 4NTZA 3LW8A 1TUGA 4UFPA 1NV8A 1VE3A 2IF2A 3ZDQA 4NONA 4DM7A 2VDRB 5CUQA 5MFZA 4KX3A 1JPVA 3AUYA 4EFNA 3BRQA 2ISQA 2WD9A 4X60A 4N0MA 2NYUA 3PGKA 3UC9A 1BCRA 3E9EA 4O5OA 1JIXA 4DDVA 4D41A 3O3CA 3AIKA 3GP8A 3V7NA 1MJNA 1YLPA 3SKVA 1UBOS 1E5VA 4HWTA 3ZI0A 1UCFA 1XTIA 5DTIA 4QXAA 1E2GA 2X01A 1OFGA 2FMKA 2R8RA 4CKYA 3FJOA 1DAKA 1NXQA 3S7TA 2GMWA 5LQRA 3L7CA 4RYDA 2VSXA 3SBOA 1NRIA 3LR4A 3ETHA 4CM6A 1Z0SA 2N1MA 5IM4A 1K6RA 4PPYA 3GLUA 4YI3A 5TVKA 1JTVA 3RS7A 4OA8A 1KNXA 5L3QB 1SPBS 3PUYA 2C5HA 4X62B 1V11B 2QZSA 4U4AA 5JFTA 1U65A 3I5YA 3JAKA 3ZG5A 4Y1GA 4QOHA 4LRUA 2HLDA 2DAPA 1ZD8A 1O58A 1A5SB 3JZIA 1PR6A 2O5EA 4DSZA 4GL2A 3CINA 1ISSA 4KOAA 3G35A 4FQ5A 4RAOA 1WHSB 1G2PA 1XF9A 4H1WA 1LSSA 2C7VA 5DP2A 2BEUB 3KXPA 1OD6A 1SHUX 3VAYA 1YDFA 5FI2A 5ELLA 3EBPA 4G0YA 4JDPA 1T2VA 3G31A 2B4AA 5IVIA 1ZD1A 1E79D 6REQA 4HHDA 4EI2A 1XCPA 3G7SA 2Z8YM 3DTYA 2P6NA 3AEQB 1T2CA 5I01A 3WWDA 3SH9A 2HBZA 1GNPA 4LF7B 4N9LA 3NHQA 2YNMD 3E05A 1T9BA 4HR7A 5FWYB 1KKMA 3V33A 3O8BA 2CV1A 4CMKA 4BMSA 2WJZB 2H10A 3R6GA 3PXUA 1CY0A 4B9OA 3WNZA 4X65B 3MTAA 2Q2OA 2F1JA 1DHRA 2HMWA 3HJGA 3M3PA 3KPWA 4LZNA 3A4IA 4XYEA 3GMWA 4O4LB 3G1WA 5E7JA 4D1YA 4B87A 4LIPD 1IBMB 3OJXA 2AA3A 4OGWA 4IJ5A 4JU8A 3VR4H 1DEOA 3HBAA 3EEAA 3LQYA 1K7CA 1DKPA 1OT9A 3WWYA 1UP4A 4JBLA 1QHEA 3TNDA 3ZDDA 3IBTA 3K0EA 5AHRA 4GLOA 3CLKA 1KC1A 2H65A 5F33A 3GRVA 3B6JA 1JWVA 3IP7A 2J07A 4F84A 2PMCA 3UJ6A 3FVQA 2Q5CA 5HIMA 5LOVA 3NHZA 1JVJA 4ZALA 1F98A 3FLEA 1K5GA 4PRZA 1J9ZA 4TROA 4AKEA 1E0KA 4CNBA 4BLRA 4ZCTA 3S2UA 2HPHA 1IJBA 2H3HA 2YJ4A 2P1ZA 1BROA 1B73A 4RX3A 3S70A 3JARA 1E32A 1FQJA 2YS7A 4OK5A 5IAOA 1QHFA 4EO7A 1I33A 3EULA 4KGXA 5JS2A 4Y2FA 4E2FA 3OJCA 4BBVA 5KHLB 2GRAA 4YOFA 3Q1KA 1SUDA 4B3XA 1R16A 1N8NA 2G71A 3VKWA 4R68A 1DKQA 1X8JA 3PT9A 2P9FA 1ZJ4A 3PTLA 3UB3A 2H4HA 1OH8A 2IYQA 2VUUA 3FFAA 3JQFA 4E04A 2OORC 3UG6A 5KWIA 2R8ZA 5BN4A 3T7KA 5T8KC 3PNYA 3D7LA 2OD9A 3O2JA 1I7DA 1NRJB 5B1HA 1YIAA 3PJRA 5IFKA 3CISA 4RGBA 5H16A 1T24A 4NE7A 1H1DA 4D0SA 4LRTB 3BQMB 1UBCA 3V32A 4KQRA 1QGDA 1FYWA 1QHIA 3SXUA 2VSYA 4NE2A 2E89A 2ECOA 1ZQ1A 3DVSX 2ZTHA 4EW3A 1UOOA 3FR8A 3R23A 2WTMA 4LAFA 3VR5D 5TMPA 4Y2PA 1JFFA 1NVMB 4AMVA 5CERA 2IV7A 2RAPA 1F17A 4MR9A 1DNPA 2AKYA 1U4NA 2Q9CA 3L6UA 1GPAA 2EQ5A 5KC8A 5LKRA 4HEHA 1CUEA 1OTIA 5CVDA 1RQXA 1YTUA 3GCGA 3WICA 5KSWB 1OKKA 3R3XA 3IB3A 4YWJA 2V8OA 3P9KA 3A27A 3C38A 1U6KA 3QITA 3ZV7A 3NBQA 4AC9A 3O90A 2O3TA 2I7TA 1QVZA 2IYVA 3QGMA 3OLXA 1DRWA 1A3CA 2Q7XA 4EBBA 1CJUC 1LPMA 3QXXA 2CNWD 3AIIA 4IBRA 1FU7A 4ZI5A 1P3Y1 2E8IA 4BPRA 1G0OA 2F6RA 4OXIA 1PVVA 1G6AA 1OIWA 4EL0A 2P9GA 1MQ8B 3GRZA 5EERA 3R09A 3ABZA 5EIAA 2XSZA 2R7MA 1OU4A 1XA3A 2WIBA 4MVJP 5KQSA 4NNOA 2JCVA 1TAUA 1FF9A 3LPLA 4Z49A 3TVTA 3CX3A 5AK6A 2O2CA 4A27A 1U7HA 5F73A 2ZKIA 4IXWA 4RTRA 3A9TA 4YFYA 4ZYUA 3BB4A 3IMCA 5B6PA 1IB0A 4PQRA 4QBTA 3OU2A 3NTVA 1E2EA 4S0XA 3QVOA 1FQWA 1I9GA 4XDYA 3L0CA 4R8VA 1ESMA 2D06A 3MZFA 3L7YA 4E7OA 2F48A 4ALMA 3HKEA 1G3QA 5A3RA 3Q6NA 3N0TA 1IN7A 4R7GA 3UWSA 4BO7A 4KO1S 5B53A 3Q88A 3D5EA 1Z2PX 5J4KA 5CVCA 2EX2A 5LU9A 5GVRA 1LK0A 1O97D 4F12A 4F5DA 3PC8C 1F8YA 2ZUBA 5K3FB 5HF5A 1QDLB 4L7VA 2I7CA 4P4SB 1W88A 4DJFC 1W1WA 3M6XA 1QNFA 5EWMA 3O7MA 4DE1A 3R7BA 4LDZA 2R5NA 5JNUA 3QPAA 2R5FA 3VSAA 4CQMA 2O2YA 3ZJTA 1N2SA 5EP2A 3O8OB 2IUUA 2FW7A 3EF1A 4P2BA 5YASA 3K5HA 2GPAA 5FTNA 3T9FA 5K3EA 2H17A 2BZ0A 1DMRA 4LGVA 3O3NB 1Y7PA 3LDFA 2C98A 2QJOA 3UN7A 2E8JA 4GI7A 1P2BA 1OZHA 4DLLA 4EUVA 2NPOA 9LDBA 3U19A 3T4XA 3KKKA 4X1IB 3UT0A 1K7EB 1Z0ZA 5M04A 2YBEA 3EIHA 4LV1A 4KI7A 3D4OA 2VT6A 4IOLA 2FZ0A 1ZIOA 3S1AB 2ZRJA 2H1VA 4J0FA 3KQOA 2YRXA 1R50A 1OGYA 4PCUA 3I6QA 1GZDA 2HW8A 3GRAA 3DBLB 2W3DA 3W9BA 4FXOA 5G40A 4PINA 3TBHA 2OLEA 4A03A 3ECAA 2I1WA 4P8RA 4MLPA 4B3FX 4LJKA 1CJSA 4QBGB 3I73A 1N0IA 4RD2A 1SQFA 1T8YA 3DMGA 3X1ZA 3IP9A 2FWRA 3J7TA 1V26A 3HDQA 1PJRA 4INPA 3DWEX 1KEWA 2A9VA 2VPYA 5HD5A 3NJ8A 1PGOA 3I6BA 2PZFA 4J0QA 3BDVA 1KETA 3MWEB 1OFUX 4BV2A 2AOUA 4JI2B 1LVGA 4L0DA 2EF1A 1NLZA 3LT5A 1G21A 4O4IB 1BDHA 1K66A 2ACWA 2WGWB 4PR3A 2QSJA 3BS4A 4LDRA 5BSHA 1V1RA 4DBZA 4D3FA 3VR6H 2X9QA 3LC1O 1NC1A 3ND5A 4HXEB 2R68A 3KSGA 5CXSA 2GPWA 4ZAXA 3FHOA 3DBHB 4ZRNA 1GNRA 1QC5B 3OOSA 2D2EA 5CCEA 3CITA 1RJWA 1A1SA 1QFYA 2R25B 4BKOA 4O3FA 3K8ZA 5EIBD 3GUZA 4HL6A 4MTLA 4EW6A 1IY8A 3TLMA 5CXUA 1H2HA 2B2NA 3BM5A 3WMWA 4UHUA 1CW2B 2H4JA 3A9UA 3ES9A 4I5GA 4Z7OB 1N2BA 3LBNA 1N1DA 4HS9A 2Y9PB 3SGLA 3DM5A 2OHGA 4LPKA 1VCOA 1WW8A 4J1TC 4QHCA 1O94D 2BONA 1NXOA 4OX9Y 4R2WA 3GGOA 1GGHA 4RK6A 5FI0B 4B3DA 3G9XA 5DSTA 3PDJA 3SLRA 3FKVA 4CMGA 3KJGA 5JZSA 3F9IA 3HQ4O 1LI0A 1S7CA 1ES2A 4FE7A 3HLEA 2DFTA 1TYZA 3O3VA 4OP5A 1T36A 5K8CA 4EDHA 1MKIA 2QN2A 2V7VA 5AKZA 2VHWA 3O8DA 3OMXA 4HJ3A 2XTAA 1OBOA 1R64A 1NWHA 2PM8A 5LNK1 1VHMA 2WVGA 2F3RA 3FGPA 4YQZA 4TVKA 2ZJ1A 5JSKA 2GO1A 2I6TA 4F2DA 3CEPB 5HL6A 1E92A 1GU1A 3QH4A 2QNIA 2XD5A 4UAJA 2QVLA 4BOYA 1DC8A 4P32A 1YMSA 3KLPX 3GQZA 3KYIB 2OKGA 4YMVA 1BLSA 5FNVA 2DBYA 1MQ9A 3N39C 2AKAB 1J9GA 4IJWA 4F2WA 3ICCA 2EDAA 3T3GA 4DDKA 4PFSA 4HVCA 1J9EA 3FGOA 2ZPAA 1I3KA 3B2NA 1IY1A 4DRTA 3L9WA 1P2TA 4FPXA 2GAFA 3KNZA 2PIAA 2BFCA 2HREA 3N0XA 3R9IA 1RPTA 2ZEJA 3BMCB 1UEJA 4HC4A 1RCFA 4MYUA 3T0FA 3ZUPA 4KV7A 2I9PA 3KQTA 3UV3A 1NUUA 2VYCA 3EUFA 5IUNC 1GD1O 1YT4A 3K2IA 721PA 5H3HA 4B45A 3R0IA 3NBXX 3F7OA 5C1BA 1P44A 5H9VA 1ZICA 1SKBA 2FHSA 4KSBA 4JGBA 4LXYA 3H3FA 1MTZA 1STOA 3E7XA 1GDDA 1OYYA 2FFHA 1ID1A 4CDMA 3GJ8A 2D2IA 4GBGA 5F68A 1I3CA 1JQAA 4JJAA 5HBGA 3QBTA 5CAEA 2B2CA 3ZY3A 3FNGA 4XGKA 3VJRA 2D1FA 3Q9SA 1Z33A 3E9YA 4JBGA 3OCLA 1VCIA 4PTZA 2AFHB 2C2YA 1ABEA 3S81A 4IW3B 3JCZA 3OTWA 2QVXX 3ZIAD 1TDJA 2G2WA 1RKVA 3ZLBA 3SP1A 2FRDA 3RAEC 1YS6A 2C5LA 3UBTA 1OX4B 1Z12A 4ND8A 5DK4A 2XQJA 2CLMB 3ODPA 3DLHA 5TARA 2RGUA 3E7DA 4MWDA 4ZYLA 1UFKA 1RYMA 5CGZA 4B83A 1PWZA 5FOUA 2JCYA 1ZGJA 1PR2A 3PQ7A 1C9YA 2GBIA 5FWXB 5DCWA 4UNSA 4E13A 3H6KA 4MN5A 4Q5IA 2IPAB 1SCBA 1CUYA 2ZJ9A 1Y89A 3MJSA 1IKGA 3LHDA 4NZNA 1ZU5A 4WEQA 5AVVA 4ND4A 1CS0A 4X24A 2IPNA 1CZKA 5AVWA 4IKEA 3H5VA 5ALIA 3RC1A 3VP2A 4LPSA 1U9YA 4YRMA 5ULLA 2P90A 1SXGA 1YJ5A 5IWAB 3KYDB 3N2GB 2CYBA 3FWHA 1I4EB 2Q0OA 3CLHA 3C24A 3D6FA 3NIAA 2XWPA 3DFFA 4HYQA 1FFSA 1I10A 2GPYA 3DZ8A 3T7EA 4XQGA 3I2YX 3JYOA 4EFDA 3VNQA 3KHTA 3W6OA 1ZIXA 2E2WA 2OG2A 3I6YA 4H0NA 2BSAA 4KZKA 1A77A 5A06A 1C2TA 1VLJA 1QDEA 3CIOA 4I5EA 1JKJA 4OMUA 1HKHA 3DB1A 3AFNA 4L1KA 5CG1A 2XD9A 1I0LA 5FCDA 1XMJA 3M3DA 3PX7A 3ZS9A 1BXZA 4UQIM 4CKBB 4MW5A 1YDHA 3SR4A 1LBIA 1UDCA 4ZVRA 1QQ6A 3UZUA 2V7BA 2FPGB 1BG6A 4NU6A 2PZJA 3DA8A 3MQOA 5HDQA 3ZWNA 1YOVA 2C7QA 1F5MA 4JUIA 4TYWA 1ZKJA 1TW3A 3HA7A 1P4RA 3QJ5A 3MWDA 5DNEA 2GNOA 2QVYX 4C3VA 1ONSA 2HPVA 3MA0A 4OGFA 2OAEA 5EPOA 5HAIA 3HFJA 2I4OA 4P1ZA 1A95A 5D00A 3ZZ1A 1K7SN 1GQYA 3ZGOA 1EXDA 1SCKA 5IYZA 4L3VA 1S3FA 2AYZA 2VHZA 3KP1A 2FPIB 2POCA 1N25A 1XTKA 1YNSA 4FDLA 3QNWA 4MKZA 4N9WA 4EZIA 2XFTA 2J3WA 1W8IA 5AK0A 3KUDA 1DQNA 4YDHB 1E8MA 3PXBA 3FPHA 4P08A 2HJVA 2I34A 3BIOA 5IWCA 4ESOA 1SELA 1BQEA 3DKPA 3N53A 2ZWMA 4ZQHA 1L5HB 1TKBA 5ARCA 2QPAA 4JEIA 3L7DA 4COKA 3GIWA 4IO0A 1O95A 3C4OA 3MOGA 4Q3DA 4XI9A 4ZO9A 4KLAA 4DL9A 5DX0A 4BNFA 1Y8CA 2PKQO 1K3TA 3RKSA 3O83A 3IHLA 1CETA 1YHYA 2QSUA 2ZE6A 4BNKA 4UUBA 2X42A 5KOJB 5B3JC 5JALA 3KZVA 3M4JA 3VVLA 3IOBA 4TWRA 1HQYE 1U0FA 1UDWA 2Z2MB 5JS1A 3G6KA 2QJTA 2NQ2C 4I1UA 3WC4A 3WAKA 2OCAA 2V7EA 3LTNC 3PICA 1NYTA 2QM8A 1PEYA 3F67A 3MWFA 4LXHA 3I42A 2Z2XA 4QJ5A 4DSTA 1GGEA 4RULA 5FBHA 5BSMA 1JDZA 1SU6A 4NC9A 4M86A 3UB6A 4TM8A 2YIJA 3RH0A 1JDTA 2G5PA 2YV5A 3LFUA 3BFEA 3GL9A 3HCNA 1M2EA 4K7JA 1XZBA 1S01A 5LZ9A 1J6UA 2G9UA 4NICA 3ZQUA 2F9FA 1NX6A 1SUCA 3THRA 4MVJD 5KZMB 2W4QA 4TV8A 3AV3A 3ZHBA 2JAOA 1XKTA 3MQQA 3DEKA 4D0GA 3EQ6A 2Q0XA 1KY3A 2VZ8A 3N3BC 2J5XA 4BIIA 3ZVRA 1UBFA 3PZRA 2EX4A 2FR8C 2NU8A 1OROA 3O6VA 5ICGA 2IZ7A 1WCV1 4ZOLA 1X38A 2WF5A 2WAYA 5AHWA 4WBGA 1LQTA 1ISMA 4L57A 2I0FA 2QX7A 2ZRLA 1V5IA 4K9RA 1NI3A 2P9YA 3FHLA 3IB6A 3LT0A 2C5WB 4WPGA 4MUEA 2DOKA 2O9JA 3SJBA 1UWLA 4Q39A 1LBQA 2J85A 1E5QA 2X3YA 4ACAA 3G9ZA 4Y2YA 4GOOD 5HOQA 2IWRA 2CBXA 1H3EA 3H0CA 2QLLA 5D6NA 3GLIE 4W4TA 3T12B 3NW9A 3SLGA 4GKUA 3DQPA 5CCBA 4P38A 2PY6A 1KA9H 1JLHA 1YQTA 3WRTA 1P2FA 1X8XA 4S05A 3HGMA 4GBMA 1HT1E 3TZEA 3RFBA 1VLHA 1SXJD 1YCDA 1UT6A 2WJVA 2VK8A 5LQSA 4F93B 3TRIA 3DVQX 1UP6A 2C94A 1Z62A 2M6LA 1L1EA 1RJ9A 1K25A 4FVTA 2AN9A 3IEIA 1I9CA 4Y2TA 4JYMA 5EMHA 4EUNA 3P0HA 2GD0A 5ALZA 4L6AA 1XCOA 3I23A 3ITNA 3IUNA 1I8TA 1V96A 4IWYA 2O9CA 4DB2A 2OSUA 4MB0A 4RWEA 1GHTA 5B7PA 1E62A 1PJ2A 4BFUA 4U8HA 3REQA 2LCFA 1SOAA 1EVQA 1J97A 1ZNYA 2HJHA 1ACLA 4N7MA 1DAEA 2FK7A 3WGQA 3AW8A 1V9YA 3O4RA 4QRHA 5CVTA 3TRCA 3BXXA 1GTVA 1N7HA 3MLAA 1Z5ZA 3IVRA 2Y3IA 4DCUA 3GGDA 1AF7A 5IJAA 5HPYB 1GZ3A 3G0BA 5T41A 3KE8A 2ZIFA 2V58A 4BWGA 1I24A 2JFUA 5LYJF 2JLXA 5FI6A 3B7GA 1W5BA 1CCWA 1Z38A 4G67A 3NONA 4H3HB 2V4MA 2J7PD 2JANA 1KRHA 2QUHA 2PJZA 5AVRA 2JI8A 2HLPA 3ZCZA 2DHRA 4DREA 2B1IA 5DMXA 1CE8B 3WMRA 4ZREA 3GLFA 1EG2A 3KDAA 1O7JA 3VV2A 1IEQA 3R77A 1PEAA 3HLDA 1C9MA 4NCHA 3LUPA 3AOGA 1V35A 1KI4A 3FCCA 2QRZA 4MQEA 3JATA 3ZY6A 5AKHA 4ZVSA 1YTLA 3BQAA 2D8AA 2QG9A 4IFEA 3UMGA 2NYVA 4PEVA 4X44A 3R5KA 2WC1A 1Z63A 4UW9A 2WHQA 2DLNA 2D5LA 1EGVB 4BMPB 1ZNQO 4LQCA 2NUPA 4WXEA 5AJXA 4Z4QA 3UHPA 1BOOA 5FUWA 5DGHA 3GAZA 4PHCA 3GFTA 1E20A 3X2EA 3LWBA 4QU3A 3C1AA 4ENRA 4KIJA 1D2MA 4CM9D 1NVKA 5DT9A 2WG1A 3B3XA 4JR1A 2PO7A 5C53B 3RS5A 2OCIA 2M7UA 1P3JA 1YA6A 2FPLA 3FVTA 221PA 3AVQA 4Q4AA 2XTZA 5ELMA 1H5XA 1NVDA 1S2LA 3PWKA 1WNFA 3DWIA 1J3WA 1I6KA 5CW1A 2Y55A 1KVSA 1DFIA 1AX9A 4IBOA 4DT1A 3EMKA 2IPXA 4Z9AA 1BCRB 3H05A 2QRQA 4B81A 5IDXA 2YX1A 3CWFA 2GZMA 4I3JA 4RGQA 2WMOB 3NRJA 2JBAA 4U6SA 5K03A 1B7GO 4QLAA 5L4NA 5IX8A 4HGZA 3HYLA 4BNVA 4WMLA 3BKWA 4LJ5A 3TNFA 1BCSA 1LLUA 3AKEA 1WB5A 4IV0A 4GBJA 4BFTA 1I13A 5CDUA 1R37A 4DV1B 1L6RA 4BMYA 3N7AA 4CLRA 5KTKA 2QT9A 4BX3A 2QQGA 3WDLA 2BBTA 3GFFA 3MJHA 4KSYA 4W7IA 4MV4A 3KWJA 2VQDA 3RNLA 4MCWA 3ML1A 3F8SA 4YAJA 3ZHQA 2H31A 3A2KA 4LHXA 1TVEA 4DXCA 1QTQA 3IGFA 4XH9B 5LDDC 4Y1EA 1JILA 3DO8A 5HZGA 2NO4A 2BDUA 4K8OA 1YBHA 5TR7A 4JA2A 3ZWKA 2JFFA 1G59A 2JJMA 4OF4A 1HEYA 6REQB 5LWHA 3GELA 1X1RA 1U8YA 4ERXA 3WYCA 4YMLA 5KNDA 2OXCA 4O63O 5EXXA 3V5MA 1UXOA 2XZDA 4PR0A 4M87A 3STTA 5FPPA 4QUEA 2YC4C 2G72A 4G1UC 1WCYA 1YRAA 4L9SA 4G5OA 3QV2A 1TM5E 3KELA 1KO7A 5JC8A 1NJ5A 1LLFA 2GN6A 3FXAA 4YR9A 1POWA 1NN5A 4KX5A 1UT5A 3B78A 2Z9BA 4LZAA 3V4RA 4O4LF 5B55A 1QF7A 3B7PA 4JP1A 4C0SA 2EU8A 3I01M 4ZVPA 4B33A 1DQZA 5TNXA 1XJ5A 1MO6A 2AX3A 4MX8A 5DU2A 4BMCA 4C2TA 4TTTS 4TSFD 3KEMA 3KPYA 3L6OO 4IDPA 1Z2OX 3B8HA 1R8SA 3NNSA 2VSOA 2VN8A 4KE9A 1JNYA 4AF7A 1ZRHA 1P9OA 4X90A 1U3GA 2HN9A 2BM9A 2C2ZA 2O8DA 1HI9A 4CUJA 3VFHA 3O9ZA 1P7ZA 2RGAA 5ALMA 1Z5NA 2NYRA 4C21A 3QU7A 3A0SA 4TN1A 4MROA 2VTDA 4JUAA 3EIOA 1CJVC 3YASA 1K6EA 3GA5A 3M0EA 3C2WA 4R0NA 5HSQA 1G16A 1SRRA 4FFVA 3VYVA 2IFTA 5GV8A 5LOVB 5GJBA 3JQBA 3FV7A 3VGPA 3EZGA 4WF0A 1AJEA 4EQ1A 2C2KA 1E1YA 4J6FA 3QBJA 3TQRA 4ZYZA 1P9RA 1F3LA 1BH2A 1ZL2A 2HDOA 3GJ0A 1YMUA 1YU6A 3I6MA 3JARB 2VGLS 3B60A 4AJ2A 4NPAA 3LG2A 1IZZA 4MO2A 2V7TA 3IQAA 1LBHA 2BMWA 4M6WA 3EJ6A 5HKBA 1KARA 3UGKA 5KKNB 3OLVA 4DA7A 3K6JA 1LDGA 2V1XA 1B1CA 4XIYA 1J8MF 3ZV4A 1QZUA 3SC2B 4Z4HA 3DSRA 4EYQA 3PENA 3GYGA 1GL6A 1A76A 5LA6A 2HRRA 2G1PA 4KG7A 3RVSA 1NQUA 1K86A 2GXSA 2LTAA 1O6FA 1WW2A 3H3JA 5TGFA 1EUDA 4J94A 5BN4B 2W6PA 4OPYA 3BH7A 3ZUGA 1TJYA 4Y2UA 2ODQA 4FC7A 1EXNA 3TMKA 2PGDA 5KJ6A 1C5KA 4R8MA 1GA6A 2FZ5A 2WZBA 5EM1A 3F2VA 1XWIA 3I52A 1MQSA 2EWMA 5K7SA 4X5OA 2Q62A 4R81A 1C1YA 1WXWA 4ABTA 1CQZA 2Q5HA 3SXUB 5I7UA 2DTXA 1XV5A 2ZQAA 1U5BB 3GN2A 3GBSA 1RE0A 5T3YA 2CL0X 4U5XA 1VBKA 3R41A 2DFLA 1JFFB 3BG5A 2GZ1A 1GPWB 1XP5A 1FFWA 4NZMA 3AI2A 4ETIA 4MR9B 5BV7A 4D0NA 3PLRA 4JOBA 3NCTA 1ONBA 4MVJM 2QE6A 1I94B 5F64A 3WNDA 4CZ2A 1PQWA 4PGMA 3M8KA 3EIWA 2FMUA 1OLOA 2B99A 1TUEA 5T7BA 4O7DA 1UOPA 2IWDA 1E2IA 4FXPA 1YQEA 4AZSA 1E58A 3QJYA 4A1OA 1H2WA 4G1CA 3D6JA 2CL6X 5FA8A 2IU6A 3IT0A 2O14A 4EBNA 4Z1MA 1T0JB 1PX2A 2D5AA 4GOJA 1WP4A 4FIDA 3A3IA 4D8YA 1AK9A 4EB6A 5EZQA 1T6BY 4A0FA 1HE1C