3T3NA

Molecular basis for the recognition and cleavage of rna (uuccgu) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
550
structure length
550
Chain Sequence
b'GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
total genus 160
structure length 550
sequence length 550
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3nA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3nA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3nA01
4TZ9A 2I7TA 1YCGA 2QJSA 4TZEA 3LVZA 3RKJA 5K4NA 3L6NA 3DHBA 2WYMC 4D1WA 2BFZB 4TYTA 1KO2A 5HIPA 5LCFA 3ZQ4A 5LM6A 4D1VA 3G1PA 1DD6A 1ZTCA 4ZEJA 5K0WA 2I7VA 5FQAA 2FHXB 2BG2A 5EWAA 5LCAA 4RM5A 2BIBA 2M5DA 4TZBA 3I0VA 3I15A 3T9MA 2AZ4A 4F6HA 2FU9A 5ACWA 4UBQA 3IE2A 4YSKA 4EYFA 5AXOA 4AD9A 1ZKPA 4AWZA 1L9YA 3IEKA 2YNTA 5B15A 4TYFA 3BV6A 4TZFA 4EY2A 2QEDA 5EHTA 1JT1A 2HB9A 1X8GA 5ACQA 3WXCA 2YNTB 1YCHA 5HISA 2YZ3A 2Y87A 3FAIA 3H3EA 4Z5ZA 4UWOB 2A7MA 2BGAA 4XWWA 4Z60A 1P9EA 4HKYA 3VPEA 3BC2A 1M2XA 3KNSA 1QH3A 3SPUA 4DILA 4FEKA 2P18A 3IOFA 5AXRA 5IQKA 4FR7A 4D02A 3BK2A 1E5DA 3IE0A 3ZR9A 4ZO2A 2FM6A 4NQ2A 2GFJA 2BFKA 2VW8A 4ZNBA 4KEQA 4EFZA 1VJNA 2YNVA 1XM8A 4PVTA 4BZ3A 4WD6A 4Z67A 4YSBA 4UWPB 2DOOA 3IDZA 2YNVB 4V0HA 3SW3A 1SMLA 3JXPA 4RL2A 4C1DA 4KEPA 2QDSA 5ACTA 1DXKA 3DHAA 3AJ3A 4Z5YA 5B3RA 4D1TA 5ACPA 3Q6VA 5LLDA 5EH9A 4J5FA 3KNRA 3I14A 2XR1A 4Z7RA 4F6ZA 1BVTA 5HH4A 4GYQA 1WRAA 3IEMA 1JJEA 1VGNA 4EXYA 2FK6A 2AIOA 2BC2A 4RBSA 2UYXA 4C09A 5A0TA 5EVKA 2YNWA 4UA4A 5DPXA 2P1EA 5LS3A 5AEBA 2GMNA 5FQCA 3S0ZA 3ZWFA 5LMCA 2Q0IA 3I13A 1HLKA 3MD7A 2H6AA 1WW1A 1BC2A 2GFKA 2ZZIA 3TP9A 2NZEA 2FU7A 4AWYB 3IELA 3AF5A 3I11A 4UWRB 4AX1B 3RPCA 5EV8A 4LE6A 3SD9A 5HIQA 2WYLA 3X2XA 4EYLA 3KL7A 5ACUA 2ZWRA 2BG7A 3SBLA 4C1GA 5LE1A 4EYBA 4RAMA 2OHHA 5ACSA 2M5CA 5AHRA 2NXAA 2BG6A 2P97A 1YCFA 2BFLA 5B1UA 2ZO4A 3IOGA 3ZNBA 2ZNBA 5EVDA 1DDKA 1KO3A 4D1UA 4XUKA 3SRXA 3AF6A 3ESHA 2I7XA 4Z6XA 4C1EA 2BTNA 4ZO3A 3IE1A 5A87A 2DKFA 5ACXA 3PY6A 3R2UA 4PVOA 2BFZA 2XF4A 3F9OA 2Q0JA 2WYMA 5K4KA 5LSCA 4GYUA 4HL2A 4NQ5A 2WHGA 2QINA 2GCUA 2FHXA 3PG4A 4J5HA 4H0DA 5EVBA 3X2YA 3BK1A 2YCBA 2GKLA 4CHLA 3DH8A 1K07A 1X8HA 4HL1A 1KR3A 3DHCA 2CBNA 1XTOA 1JJTA 5FQBA 4UAMA 1WUOA 2OHJA 5AHOA 4B87A 5K4MA 4BP0A 2OHIA 4C1FA 2FU6A 4GCWA 3A4YA 5ACVA 3FCZA 4DIKA 2QDTA 4RL0A 3QH8A 5HH5A 3RKKA 1Y44A 2YNUA 2E7YA 2NYPA 3X2ZA 1ZNBA 2R2DA 4FSBA 3X30A 2P4ZA 4YSLA 5A0VA 3SFPA 5KIKA 4C1CA 3P2UA 1X8IA 5EW0A 2Q9UA 5LCHA 2Y8AA 3T3OA 4NQ4A 4C1HA 5EV6A 1WUPA 2NZFA 5HIOA 5KILA 1BMCA 4NQ6A 2Q42A 2BG8A 4EXSA 2BR6A 3PY5A 1A7TA 2WRSA 5HH6A 3VQZA 3ADRA 4JO0A 1A8TA 2BG8B 2Y8BA 2BMIA 4AX0B 2FU8A 4P62A 1MQOA 4U4LA 5A5ZA 1QH5A 4O98A 4UWSB 3T3NA 1VMEA 4XWTA 4RAWA 5AYAA 5ACRA
chains in the Genus database with same CATH superfamily
4B3CA 3L08A 2I7TA 3J81k 1DV2A 1MRSA 2KWDA 2O7NA 3REFA 1KO2A 2O1XA 3G2IA 3MJTA 4OI2A 3FTEA 2IK8A 4WOKA 3ITKA 4JB0A 1X0VA 3CLRD 3A0UA 4Y1GA 5BORA 1QS0B 3O7MA 1SRQA 2WXKA 4BMOB 2AQKA 4TTPA 5FPTA 1QKKA 5BQXA 1BDHA 4FN4A 4UNQA 2B0CA 4PN7A 5KOYA 5LSAA 1U8FO 1IY9A 3IALA 1G8SA 4QDZA 4MVJF 1DJMA 5LJIA 3DBRA 2QENA 1P1AA 4F7DA 1HYQA 3QV1A 3DBHA 3CS3A 4CKYA 4KJZA 4TMFA 1HDYA 5FUXA 5KREA 4J16A 2XUPA 4KMMA 5I8PA 3VISA 4Q3NA 5FLYA 5CJ2A 4YCNA 5KTRA 4QJ3A 3QMMA 3RSOA 1UXJA 1UBEA 5LFAA 5KTYA 2C9WB 2X0FA 4DUZB 5ESXA 1Z26A 2VK1A 5CB4F 3GEBA 5CUQA 1FFSA 5EHZA 1NFFA 5HOQA 3MQ4A 5G02A 4RPGA 5I7SA 4B40A 3DT8A 4IIJB 4BKQA 4KKJA 3RVJA 4LJ4A 4OXRA 3ET5A 3AQIA 2HMAA 4ZQFA 1PGPA 1N2HA 3DMTC 2DULA 2QU8A 4Y67A 2NSLA 4AWBA 3EXFB 4M98A 1SKYE 1Z62A 3WGHA 1E79A 3E9EA 4H6WA 3C6YA 2ZWVA 1QRRA 1S2OA 5L3RA 3IVXA 4R98A 2DY0A 1SXHA 4JE3B 1SKQA 2Z8YM 1BDIA 2RCNA 3DMDA 5DT2A 3RQIA 1HXHA 2II6A 1B4DA 1G38A 3V3XA 1PWHA 1XF9A 4RK0A 3X1XA 2H2FA 5KS2A 4MKZA 2E55A 3H16A 4FFDA 2R8OA 4BYGA 4ZHPA 3MWGA 5HJ2A 2VDPB 3TIFA 2E1PA 2OHFA 2MOKA 2WM3A 3F6CA 4N03A 2D0PB 1A9TA 4BEJA 4MQEA 2WP9B 5IH3A 4ZYXA 4E08A 2OZLA 4ZOLB 5C1OA 2BMDA 4RZHA 4BQRA 3B89A 4C7OA 2WAMA 1HL3A 1ZL0A 1OLXA 2GXSA 1LX6A 2B1QA 1XCLA 1N33B 4AZ0A 4QDOA 3I1FA 2H48A 4GX2A 1UWVA 1OGIA 1CE8A 1MHHE 2BI8A 4JVNA 2Q5CA 2HU7A 4D4KA 2EDAA 1PKXA 3TB4A 2PX6A 2OWEA 2E4WA 3JQ7A 2I76A 3N1UA 1FPQA 2HDHA 3VNAA 5HGXA 3BE4A 4Y2XA 3DHYA 3KYJB 2VZ9A 2OA0A 3SDSA 5LBTA 4HJXA 2TMKA 4DW8A 1E98A 1DX4A 4GPTA 4RORA 3O82A 4JI6B 3UQBA 4TKUA 3COSA 4ICVA 2HXSA 3VPAA 5ENZA 1OGYA 3BB1A 2KDMA 4RY8A 3E56A 3PZ8A 4I0WB 4CKWA 1NXOA 4QDXA 1RQGA 4GCWA 1Y1LA 3RZWC 1ULZA 2I1JA 1XK7A 1UQRA 2ZSBA 3N2LA 2FUG6 2O0LA 3NRCA 2A9OA 1KRHA 4ZGGA 1I2MA 3PFCA 3V8NA 3A9KA 2AX3A 3GA5A 2OP0A 1ESZA 3EVTA 2VUHB 3ROTA 4LZZA 4CKCB 3PHHA 1HE2A 2FN4A 2HV9A 4RM3A 2CCGA 3R5TA 2NXEA 4F91B 4TMVA 3EGOA 7REQB 1RWOA 3E3AA 3UH1A 1EEXB 1R2QA 3NHMA 2X22A 4FI3F 4BFTA 3MTJA 4BNHA 3STTA 4GG1A 1WJNA 1C9JA 5HCUA 3PEWA 3TE6A 1AZSC 3RT9A 3DB1A 4RTKA 4TLBA 1TJ5A 1UZAA 1K51A 3M9XA 4PAGA 5BMVB 4BXOA 4C0QC 3RU3A 4C4TA 3MCUA 3WAPA 2WF8A 1Q83A 2BFZB 4WOBA 1U2GA 4J0DA 4FHGA 3MWEB 2LR0A 1EWYC 1USIA 2WU0A 3I6ZA 4FFBA 1W1UA 2BGJA 5FQAA 2XUOA 1AZWA 4ZDWA 4CUJA 2IH5A 1W2HA 1TF5A 4J2TA 3Q11A 1OXMA 3FOAA 3ZU3A 2V9HA 4URUR 2Y1CA 4CTJA 4C0XA 2RK6A 2GF0A 5KQLA 1JAYA 3HU2A 3NZEA 2IYXA 4XJTA 3ZY6A 1YR6A 2ETVA 4D8WA 2IHTA 1Q1NA 1MQ8B 2JCXA 2BOVA 2XTJA 4O4IA 4UZFA 4BFLA 1I6KA 5J2TF 4MEAA 3NS1A 1F7VA 2FMIA 1GG8A 1TQ6A 2J87A 3EE6A 2OO7A 4NABA 2BEUA 4UBJA 4A3PA 3HB0A 2FZGA 4CDRA 3NIWA 5AKJA 4V0QA 3ZCXA 2FHSA 2E5LB 5HE8A 1C4WA 4NNPA 1ITZA 1YQQA 3OTHA 4Y7DA 2HLDD 4OVKA 4Y2SA 3I53A 4MIKA 3SQOA 2NU8A 2VZ0A 2D5AA 1GTL1 5JJBA 5HRAA 1O9HA 1EUZA 2AR0A 2CUTA 2VP3A 5J63A 3AU8A 3HUUA 3ZNPA 1SKBA 3IODA 3ZGXA 4BKOA 3B3QA 2OD2A 4BNGA 3SK0A 1XG5A 1CV2A 3UY4A 5A1JA 5LIPA 2M6LA 3BRCA 3D4NA 1S9DA 4JJFA 3WL8A 2UZ1A 3TLYA 3VR6A 3EH1A 2RDMA 2DBVO 3N2KB 1GKYA 3GLHE 3IERA 1NI4A 3C16C 4RLHA 4E22A 4J6IA 1ZHHA 1XLUA 1T1GA 1ZMOA 2GCPA 3K0AB 1X6VA 4HGYA 3ON5A 2Q0IA 3CR3C 3UHJA 1VIAA 4TV3A 2JAPA 2UVPA 2ACZB 2Y1DA 2LUEA 3L0DA 4BP3A 3URKA 2MT9A 2PGLA 1Z5GA 5K0LA 3LRTA 1DEAA 1Y8ZA 1WWTA 2CFCA 3EGDA 2FZEA 3EMDA 4ZEVA 3GAAA 3LAWA 1X7YB 3IR6A 2E4UA 2D7JA 5DBOA 3S1LA 3R77A 4PNPA 4MP3A 3ZVVA 4QGBA 5C7IO 3PL5A 1I8TA 3WMGA 3RAJA 4YJGB 3B70A 4G5OA 2FSUA 1PKEA 5LLSA 4BQPA 3X23A 1R4NI 3JAMA 1OLSB 2GEVA 1YRWA 2XCLA 1OBOA 3NOVA 4PBSA 1WRBA 4TV8B 4A20A 4AMGA 3CJRA 1DKNA 2G72A 4JMLA 1FNBA 4FBLA 5E6SA 1LK0A 1QIDA 5DCWA 3VNVA 4WFIA 2HF8A 1U9IC 2I33A 4OZAA 1NKSA 3L4JA 1R64A 4DTCA 3C3CA 1AV6A 4DMRA 4MGEA 2YEPB 2H88B 4WPGA 5CIWA 4S0XA 1GGVA 1X94A 2NWQA 3F74A 3ZZTA 3R3VA 1TM4E 3K0KA 4LY9A 2PL1A 2CJXA 3C3YA 4GP7A 3R5KA 3PNVA 2G1AA 1SVOA 4Q3CA 2DFVA 5CDGA 4RULA 4IIYA 4J16C 5EWMA 2NUTB 4DIBA 2I6SA 3MG9A 1WXSA 2ZCVA 2ZT7A 1JB9A 1YOBA 3U7ZA 2DNFA 1HDRA 3THOA 3X1ZA 1JQ3A 3DMRA 3D2BA 5EXTA 4B3IA 2I4IA 3RU9A 1IHYA 1KZGB 1RC1A 1T24A 1FDOA 1JPNA 2B8NA 2WYWA 2PSSA 5FUQA 5L3QA 3NG0A 4BNVA 2P1DA 4G8DA 5IAJA 2QJTA 3OZRA 2ZVOA 1K2WA 3C14C 1E89A 3W2IA 1O77A 1X7DA 1RXUA 3DOUA 4MVXA 5AM5A 1P4SA 4QDUA 4BU1A 2VLIA 5ICMA 1ORTA 2C9MA 4AD8A 3TSAA 3RNEC 1ZK0A 4D0NA 3M4NA 5F2EA 1QG6A 2HQOA 3HJAA 4HPXB 4PLTA 3ANMA 2IF2A 1KAHA 1MB0A 4C1NA 3PFBA 4DZTA 1ZR4A 5K8CA 2JVJA 1K66A 5ERXA 4DNQA 4CMEA 2H2WA 4WD3A 3OEED 2ZUTA 3UICA 4S24A 4ZALA 4TMZA 1NLYA 4AY5A 2FSHA 3T38A 3H6NA 2O3SA 2UZIR 2BV3A 1CUYA 4EAQA 1XVAA 4KP7A 3TQTA 1CUAA 2INNE 1MMFB 1L6VA 4XYMA 2VAMA 5KYYB 2EZ8A 4LRWA 2I4OA 2XZTA 2QZ4A 4X00A 3U3KA 3QSGA 3M5PA 3FPGA 3H9GA 1MC4A 2GZ3A 1UDCA 1OFUA 1VCMA 2VDRB 2H54A 3FOFC 5AVQA 2OE2A 1ZOOA 1KR5A 3AECB 4AJYB 1SZPA 4R2XA 4LV6A 3A7EA 4LXYA 3WHIA 5FX2A 4YCLA 3UGKA 5HS4A 1ZG3A 4B7AA 4J5FA 1EBFA 1QZZA 4EHFA 2ZB8A 1YNSA 3TDKA 2M4NA 4C2AA 3NZSA 4XD7D 3ZHYA 3K0FB 3STYA 2GMIC 3KQYA 4DDVA 4UEQA 3PREA 4Z9XA 4ZVTA 4IHQA 2NAPA 4UD2A 2IA5A 2J5QA 1J7KA 2ONKA 5BSKA 1N6OA 5HFAA 1A2QA 1O5OA 2HXGA 3VR6H 3AE8B 2RD0A 5CFNA 3LE8A 4C7JA 5G1OA 1VMKA 1T9BA 4I8DA 1G3MA 3BWBA 2AZMA 1IAVA 3TP9A 4W1PA 4OOFA 3AE4B 3JD4A 3VDRA 2XB6A 3DMPA 2IO1B 2GZAA 3PZRA 2ZNVC 3JSVB 1CR6A 4F4IA 4H16A 2HBZA 2DYBA 3B8EA 4DLLA 1MH9A 1UF0A 3U56A 1E7SA 4AW9A 4DGSA 4U6NA 3N75A 1EFLA 1Y80A 2JJQA 4FDUA 2W6IA 5JJLA 3AM3A 3ER6A 1H2AS 2M1XA 3HKBB 3LUKA 4O2AA 4GPZA 3RASA 3O3OB 5CAEB 1PK9A 1BVYF 5C18A 3N59A 3NY5A 4V24A 4FADA 3RF7A 3Q9LA 5IC6A 2NV0A 2Q1XA 3B3JA 2DKFA 4F9TA 4DVGA 2HB6A 3HJTA 5CXQA 2C31A 3LXRA 2R11A 1V4BA 2XXAA 1BGXT 1M7HA 2NT3A 1SR8A 2GEDA 1MG4A 5JCPA 2P7IA 4UEOA 2LV8A 4UHDA 3CEPB 4C6RA 3OM1A 3H2IA 1YZQA 4B2PA 5GM1A 3N70A 4NK4A 1ZU5A 5ELLA 2MP2A 2Q3FA 2ZRLA 2F67A 5IBRA 2QMOA 3MINB 1TK2A 1ZI6A 4YRPA 1GUYA 2GCOB 4NJ7A 1LVGA 2CJYA 4AWXA 1UT5A 2FIDA 5AJZA 2ZTMA 1I0LA 4CLDA 1DB3A 1F1HA 5CLJA 3H05A 1CLEA 1PTJC 5IM4A 2PE6B 3BD8A 3LZDA 2C84A 2QG9A 2E3TA 2RBEA 5KILA 1E2NA 4LHZA 4WEQA 4WY8A 4JO0A 3HZZA 3FSRA 3QVTA 3LL7A 4GYKA 2BE9A 5BOSB 5FUVA 1U8TA 4DR2B 1B93A 4X8MA 3VO2A 1L4ZB 3MJHA 3DLBA 4MDFA 2AN1A 5B58C 2NTNA 1JUDA 1FPMA 1GPKA 1XEEA 3C8YA 1Q6YA 3R3WA 3LJ3A 4NC9A 4N59A 4HTAA 1J7CA 3PXEA 1GN8A 1LFDB 3KXDA 1UCFA 3KBBA 5A02A 3E58A 4YRTA 1D7AA 1DQNA 1M2HA 2RK3A 4I2VA 1M6VA 4O4HA 1CUIA 4JOQA 3A2LA 3ECSA 3M3DA 4L4YA 1AS0A 3NHPA 5HJEA 3ZD6A 2FMHA 1OVMA 1K2VN 5DOZA 2QX8A 4ZCIA 2VWPA 2HDEA 2QN7A 2Z56A 4XLLA 1D1QA 4AY6A 4UUMA 3F7MA 3DZFA 5DGXA 3OT1B 3ZNQA 1IUPA 4Z5ZA 3AC0A 1ZD4A 4BNWA 1FBTA 4BJ6A 3L7BA 2I4TA 4RKYA 4IOMA 1NVGA 3D3WB 3DQQA 2RHLA 4AJNA 4KN8A 1FU7A 1N3IA 3QEAZ 5GOZA 2F2TA 4WXEA 4YFYA 3CH6A 4IDHA 4ZTZB 3WK4A 3KL2A 4XIJA 2W0SA 1P75A 3EDRA 3R5XA 2R6CA 1SCQA 4RNAA 4WJPA 1EJ0A 1DGQA 2IX3A 1J22A 3N2IA 3WWYA 1ZY2A 3DPIA 5BQFA 3AX6A 4OUDA 3PKZA 1ZN7A 4LPSA 1V43A 4NL4H 5DNCA 4I5EA 4HDRB 2RGAA 4EVIA 4V0MA 1NVFA 3GLGB 4XWYA 4M8MA 1YMHE 1F0NA 4HYEA 2QZZA 3BXFA 1A8UA 4QUBA 4GMFA 1TGZB 4BQFA 1Z38A 1WCXA 5DSTA 5KTOA 2PM8A 5FFMA 2XAAA 1KPHA 2VIIA 4IINA 4KGRA 3EG9A 1I36A 1ST2A 4JLNA 3PG5A 5FOXA 4FUQA 1AQ6A 1XKXA 1L8AA 4QQFA 1JHUA 3HJBA 3EVFA 4MLPA 1QCCA 4CT4B 2OZEA 3JATB 2JWUA 1U0NA 2IBSA 1TKCA 3OLQA 4FDTA 5C0OE 2D5CA 1V9CA 5FKAC 3N30A 4Q15A 2REXB 2W98A 4KKIA 3WWEA 4LF8B 1V47A 2XD9A 3DC7A 4PZ0A 3W5AA 1BQEA 2I0FA 1EYZA 4DPKA 3EW7A 1DLIA 2L76A 3AE5B 3O2SB 2NXAA 1ZWKA 2EZ4A 4MWOA 2PL5A 1V1MA 2K22A 5B1EA 3VH1A 5EVDA 1XCGB 5JAPA 3D6NB 5CHEA 1GAQB 1ZVKA 3SFVA 3OKPA 521PA 4QTYA 4IZOA 4FYKA 5HZGA 5FA6A 1TOAA 5ALVA 2YWFA 4NQ5A 3GFSA 1SIUA 1K8ZB 3HL4A 3OX1A 4CQJA 4E46A 5K0EA 5HMLA 4F7WA 1SBCA 2MHJA 1GGMA 2OFOA 2NMVA 2GBPA 2PO5A 1C0EA 3OIGA 3LZCA 3PQDA 2YJ5A 2FETA 1EP2B 4EG5A 4XXHA 3TAXA 2FBWB 3AZPA 5T3YA 3D5QA 3CEAA 5EIXA 2J5RA 2C7RA 4MWDA 4RE5A 4EUSA 2WHYA 1MV8A 3BSWA 4POAA 3TGWA 2DUNA 3X30A 2B21A 4KUEA 5LPNA 3OJOA 1FMTA 1Z36A 4C00A 2F7SA 3TMYA 3NVAA 4EH1A 1NUPA 1DBVO 3V32A 2NV2B 2DH5A 2DFPA 4QU5A 1DKMA 3WMXA 3ZIAA 3DVAA 2RGNC 1N9ZA 2Q45A 3HFSA 4JBIA 4Z1MD 1G20E 4NJMB 2V6JA 1QM5A 2WHEA 1G16A 1PGAA 1OHHA 4C4SA 4GZ3A 3N8HA 3AEBB 2CYAA 2QUZA 5DJ5A 5CLIA 4RTSA 4NAUA 4NMXB 3LX6A 3EXG2 3LOQA 3U1TA 1E2GA 4RHTA 4TRNA 2I87A 1WGGA 1W85A 3CLHA 4E2YA 3V80A 2CFZA 4DHZB 4PYIA 4N39A 2VQ3A 3L6BA 2G67A 2HJHA 1YUNA 1DAIA 4JB3A 2LVOA 4WZAB 2SCUA 1Y9ZA 4BQNA 2FUG1 1DOXA 5KYVA 3LGXA 3U3OA 2AQ2B 1NPYA 1GA1A 1FLDA 1ACCA 3IP9A 3IQFA 3NORA 3BPSA 4I08A 2I1VB 3B1KA 2JD1A 4EUEA 1JF8A 4GGMX 1Z39A 1S1QB 4YAKA 3KSRA 1P1HA 4L08A 3QHTA 1FA9A 1GCOA 1FQWA 4MR8A 4MQUA 1DIBA 2X1VA 4XIIA 1RYDA 3S40A 2XOXA 4WVLA 2MYTA 1WH3A 5HQJA 1IHPA 2ATVA 3P1JA 4UNNA 4EABA 4XE5A 5IC4A 1LBSA 3CKYA 4Q4AA 2XODA 2ON6A 4L0DA 1Y1KE 4UHFA 4Q18A 2HNAA 4NQRA 2L0XA 3N0VA 4EMTA 1WQ4A 1XEFA 4X85A 2YW9A 3FXAA 4NY1A 2XNKA 1WGHA 2NZ8A 3OZIA 2OC4A 2BMWA 5CYOA 2IH4A 5LNK1 2G77B 4GVXA 1L5SA 3S3TA 1WX9A 3TNJA 1ZI8A 4LDZA 1Z08A 5EVJA 3RU7A 3AFGA 1RCUA 4J9VA 1DEOA 2YHUA 4QBKA 3EX7C 2PWZA 2G4LA 1A96A 1EJBA 4P34A 4CMIB 3T7TA 1TNDA 4Q4JB 1XRJA 2WF9A 4XVQA 1SVIA 3MCTA 1UWXA 1K5GA 5FLEX 1XPOA 3CURA 3WMWA 3RLFA 1S4QA 5HF5A 1H23A 5DZSA 1OQAA 2FW1A 3I2FA 3ENZA 4OZCA 4E0BA 2VDQB 2D62A 2IFTA 2AKYA 1UBJS 2CMKA 3HU5A 1L4BA 5IEJA 1JJVA 4LX0A 1QFSA 1Q7GA 5FEMA 2R8BA 4KFCA 4QUJA 6ADHA 3I3SR 3WFJA 3HPRA 2WXQA 1BFDA 4EHJA 4H17A 2FSFA 4FS3A 1B8UA 2IP2A 2MTBA 3G8CA 4BP9A 5HIQA 2OFXA 5LUAA 1UFOA 5LN1A 2XUDA 2R7MA 3B5JA 1X1BA 5ITSA 2PUJA 5A6SB 3ELDA 1P1RA 3LY7A 1VGVA 5ACSA 3EQ6A 1VYUA 4XUGB 5EFOA 2AWTA 3HJRA 4MUGA 2M5CA 1D2HA 3M6VA 4JJ4A 5DCLA 3ZYYX 5EUCA 1JDJA 3T1YB 1MP0A 3LLMA 2D06A 2PVCA 4GX0A 2GETA 4UCWA 3GJ6A 3E8XA 3WNQA 1TU3A 2HDWA 2WWRA 1I14A 1MO2A 3AM9A 2ZI3A 2BGRA 3TNYA 2ES4A 4F5EA 2FTKE 2LWIA 1IRXA 3K94A 1KORA 5K3DA 1V1PA 2N7DA 5LQDA 1YDEA 4A6EA 5T57A 1KDOA 2AD1A 3R09A 5JY6A 4K8RB 1PZMA 2CMDA 3DL0A 2CHZA 2X5JO 4I6GA 3DDSA 1F20A 4ZAZA 1CY8A 4KZPA 5DHPA 1RRPA 3DJYA 1N2GA 3PEUA 4X3OA 4DV4B 3DONA 3MT8A 4HFMA 2QSJA 3L07A 4CL0A 4EJ6A 1AA6A 2MX2A 1HPLA 1ULTA 3KB8A 3ZHUA 1L3IA 2O52A 3GN2A 3L40A 3OQNA 5GZ6A 4W9JA 1LCIA 1R4MI 2NTTA 4MW1A 3R0VA 1T9GS 2QTGA 1Z2MA 4CMKA 1HORA 1LRLA 1DU4A 5BVGA 1ZZGA 2KNBA 3V3KA 1V6EA 3S68A 4ZYLA 4BKSA 4EXSA 5CT8A 1TEXA 3Q7EA 4JCCA 2EXXA 2DPMA 2PVOD 4DADA 1NQXA 3P0HA 4P3NA 4M7OA 5F35A 1KH1A 2ZATA 4CQMD 3KKZA 3HUTA 3HBMA 3E23A 1OZ0A 4B4VA 1XCBA 4B4WA 1RWVA 3HR4A 1P17A 1G41A 1Y6RA 3WYDA 3IMEA 1TJ4A 2KB0A 1N2CE 4C5CA 1SBTA 1Y4DE 3DL2A 1O0CA 2FHXB 2QQGA 1FDTA 5JS7A 3A10A 1U8ZA 2Q3CA 3ZEIA 4ES6A 1T5OA 1YO6A 3AT1A 1CJCA 3EARA 2Q2OA 1AQYA 3FAHA 4L4SA 5FAXA 2P79A 5LKAA 4Y6LA 1YVEI 2B3AA 5JAIA 5KQSA 2HB9A 3R0XA 2XCTB 5LD2C 1NW7A 2C2MA 4R3NA 3O8BA 1CRLA 3IAFA 1H8CA 2PRIA 1CY1A 4E74A 1BD4A 2DZKA 1SB9A 2XOKD 3AI7A 1LTQA 3W9YA 2R6HA 4RLSA 3VPEA 1QH8A 4PLWA 2DPGA 5ADVA 2P75A 3VZPA 2XPCA 1PFGA 2XCOA 5CR9A 3ZNGC 3FZGA 4N5DA 1SBNE 1KFKB 4R1UA 2HMUA 2RIRA 1FSPA 1FYFA 1Q0WB 4MB0A 4B2IA 2XK5B 2P4EA 1U6JA 3FCCA 1CDZA 4W5QA 1GRNA 1XA0A 3QX7A 1Q20A 2QE7D 4DY4A 3IBSA 4F4HA 3GRPA 4MRVA 3AI1A 3PNKA 1BVTA 1J25A 2VEOA 3B0AA 3BMXA 4LYFA 1Q1BA 2P8JA 4F8CB 3LG2A 4QHYA 2IPKD 1O95A 4OZBA 4AAYA 4C88A 2Q3EA 1GPUA 5GONA 2O8BA 1E0SA 3P0FA 2IP1A 3FZQA 4U7PB 3EMBA 3NOXA 5BNZA 4I4TA 4YP5A 4PTZA 3F6BX 4DDTA 4RF4A 4EQ6A 4LC0A 3L9WA 2ZIFA 4MVJG 3AZQA 1S7CA 1J97A 2VSOA 5L6LB 4JC0A 2JBWA 3B2FA 5KX5B 1ZJ5A 3E22A 4UWRB 4AX1B 4NEHB 3MTEA 3LRXA 2XDWA 2BRUA 2PL3A 4REZA 3RNGC 2GEBA 3L6DA 3ZWVA 4KVGB 1JQBA 4M22A 4OA8A 1AM4D 3A2MA 1FXWF 4QBTA 1CJKC 2CYCA 2IUFA 3E84A 2UZAA 2P97A 2PH1A 4R4JA 1PNRA 2GMWA 2P62A 2CDCA 3A58B 2ZUEA 1KMNA 2BFDA 1E8NA 1PJQA 5JVDF 1MPXA 4IRUB 1CEYA 1WUYA 4HD8A 4PZLA 2YMMA 3CG0A 3QPAA 3QQPA 4TGLA 5TX7A 1D1TA 4MKXA 2ZIWB 3P20A 2NZWA 3OUUA 3VC1A 2WD7B 4DJ5X 4GLLA 3A27A 3VTZA 1VD2A 4QATA 2DHRA 2P2SA 1HZJA 4IEIA 3RT1A 2VWQA 1YR3A 1I4GA 2X9QA 3K5PA 4M8SA 3R3HA 3E03A 3P4QB 1BWQA 1IVSA 2H2HA 1MT3A 3HVHA 2CBNA 5JNSA 3AZOA 1VE3A 5EEGA 2EBWA 4ROTA 3F98A 3JD3A 4HVTA 4B87A 1XZEA 2VYQA 4BO2A 4NWIA 1RPZA 4IF4A 1AUXA 4TT3D 5AW3A 1X13A 4RHEA 1K98A 4RK4A 5ICSA 1ADFA 4QARA 5AK5A 2FN9A 1Q22A 4MV7A 4CN9A 3AE3B 4YP0A 2PSFA 2KHZA 4PNEA 4Q3BA 1QGDA 4WLUA 2K7ZA 1RHUA 5LCHA 1XMJA 2YLMA 2E48A 2FQQA 4PQGA 3ETRA 4RPKA 5ESRA 4J8PA 1PD0A 2CFTA 4YRAA 3NAMA 1BMCA 2N9UA 4CR6A 4MUYA 1XTSA 2KOXA 5TMBA 2O07A 2OO3A 4TTIA 3GGGA 4MJ7A 3KUDA 1E2EA 3SYMA 4FOOA 3G2MA 3KPVA 2GCNA 2ENUA 4UUOA 5EUBA 3IQHX 4AX0B 1NP7A 4J1NA 1L7NA 1KY3A 3JQDA 4WK4B 4EJFA 1WHSB 2XTZA 1XK6A 3IIKA 4UM7A 3V2GA 3PJRA 2RD2A 3CZ4A 3DCJA 3N2EA 3ER8A 4CW7A 1DDOA 2BGMA 1CVRA 1EPUA 3JY6A 5FR3A 2ZPNA 1QVZA 2BJVA 3HKEA 4MI1A 3NQ41 1T6NA 5AVTA 1XF1A 4NPCA 4MVJM 4YAWA 3Q0IA 4ZVRA 3EAGA 4GZMA 1BWPA 5F2NA 4EKYA 1WHTB 3RFZB 4C0LA 2WWHA 1FUIA 5CW1A 1ZP0B 3RM3A 3ITNA 4RGMA 5JXIA 3IEKA 3UJNA 3BC1A 4O6VA 1JT1A 4F4CA 4NKRA 4Q7EA 4EF6A 1XKLA 1ZJWA 1E7UA 1BCSA 3RS9A 1RD4A 2QX7A 4Y2RA 1DMRA 3NEJA 4JIOU 3BK7A 4QJ4A 1S9HA 1T29A 3I62A 4PS3A 2FG7C 1KJ9A 1YL6A 1U8UA 5HUHA 3TK1A 5KNDH 1QH3A 1IN7A 4HGOA 3IP3A 3GT7A 1X1AA 4LSWA 3VDZA 2Z2ZA 5AVRA 3EK2A 4MTLA 1BROA 4U0KA 4QAJA 1T0SC 4KIKB 2Q7XA 1UBQA 4MRMB 4QXQA 4KQMA 3IP8A 4ZVKA 1ZYUA 4HCPB 3CH7A 4IEEA 1G0NA 3THXB 4KEPA 4ZHQB 4OUKX 1B26A 4ZDJA 4RAQA 2JL1A 2BF4A 1CY0A 1JH9A 2RAUA 3WRXC 3C5CA 3UAOA 3HCDA 4OPMA 2JLCA 1TTTA 3AR6A 1J07A 3WHPA 4LHXA 4MS1B 3NRJA 3VYWA 4F4UA 2KJQA 5ILOA 5L9AA 2G9VA 2CLCX 5BR8B 2XT6A 5CRIA 2HBYA 1K3UB 1G7SA 1PYDA 2L00B 1YAJA 2Y9PB 1QBKC 3TSCA 5KMGA 3VDMA 2N9PC 4EZLA 4P83A 1PQWA 2KSQA 2PSEA 3OLWA 4TMKA 3VMFA 3AU4A 1KVTA 3AB7A 3K1ZA 3IUJA 4Q03A 3OF5A 1IZ9A 3NBXX 2UYHA 3TR5A 3TSSA 4PCLA 3E18A 4INJA 4LDRA 4OGGA 4WRRA 2CNWA 4N3NA 4L2IB 4QXMA 2ZW1A 5DASA 3HCEA 3O74A 1ZGZA 4FGWA 1VPTA 4BB0A 2VOEA 4CTOA 1T8UA 2VWGA 3BZUA 4FYPA 3A9RA 4L6IA 3Q88A 1VHWA 1H4VB 3S28A 2I3GA 3N6VA 4X6XA 3QCAA 1OUMA 4UMDA 4GYUA 1YCDA 1OMOA 4RHYA 1QJCA 1NW6A 5JS2A 2JJ1D 1A0OA 5KWIA 3GL9A 3WZLA 2JFHA 1N7JA 5EPEA 1XA4A 3H8VA 1GYQA 1P2BA 4NZZA 4X62B 1KR3A 1H1DA 1VL0A 2XQFA 1ZQ1A 3MCAA 4LWOA 1PFQA 8AT1A 5EESA 3KS9A 2KWVB 3H3FA 4HPWA 1WMBA 1NVKA 4OQDA 1A9XB 2CDBA 4LE2A 2IWHA 5DYTA 1CS4C 2V7UA 4BWGA 2Y8AA 4AY3A 4HRXA 4MQFB 3BH7A 2FV8A 3A1WA 4NYJQ 4XPIA 1N3LA 1TIBA 2OAQ1 4C0JA 4OHKA 3SVLA 3PZ7A 4H7FA 1YKFA 2BG8A 4UQOA 3FFXA 1E2QA 3ZWYA 3GJ5A 3SU8A 2W00A 4FX5A 3KAPA 2OV8A 2R65A 4OU4A 1RWBA 1LQ2A 4B3TB 4G81A 3I3OA 3GGPA 2QP9X 3KZOA 3DPUA 3SOZA 1M2FA 2OFFA 2HOQA 1HTTA 3UYKA 3DOHA 3E0QA 4LOIA 2ZROA 2IH2A 1OASA 3EGCA 4MQ4A 2J6CA 2ZPYA 4AX4A 1ATZA 5ED0A 3K9QO 1O95C 4MP6A 3IBTA 3C97A 2HIAA 3VKUA 3DMYA 1PL6A 4Q7JB 3BWVA 1CHNA 2OHXA 2XA1A 3V55A 1REQA 3CCCA 5SYMA 5L8VA 3QHPA 2I6QA 3HC7A 1T4CA 3HY6A 5EYPA 3AE6B 2AFHB 1SAYA 3MAJA 2VWHA 2IYZA 3QW4B 2EV9A 1X1EA 2W2PA 3I34X 4G1EB 2HJ1A 3QFTA 2YFHA 1NOKA 2HUNA 4NH4A 4CV1A 4RFVA 4O4JB 3DQPA 4HDKA 1NW4A 2D5LA 3I2HA 2PKWA 4EITA 4GSWA 4TYWA 4FFVA 1C4AA 4WZBB 3SQNA 5C4IA 1RI5A 4JFAA 3TOZA 1RHKA 4EPYA 2IY7A 1ODFA 4B1FA 1Z7YA 1WF6A 1Z28A 3KJFA 5FBRB 5C1ZA 4KIWA 3M49A 3GXBA 3A3NA 4MJXA 4WK6A 4LJ8A 4Q3DA 5BWNA 1FMCA 3K4PA 3Q98A 1TJNA 5JY1A 1AZLA 4LECA 1SQFA 2YWHA 1Y6FA 4Y2TA 3LQFA 3OWOA 3H0EA 2IF0A 4KV2A 3O1IC 4G0VA 2AW5A 5G55A 5D3QA 2NOAA 2BFEB 1I1HA 4LVNA 4JR1A 4EB3A 1CQVA 2QRMA 4DLYA 1XALA 4JB8A 3U39A 2BFBA 3G8YA 6GPBA 3GMSA 1JPJA 2D8AA 2F8LA 4U2KA 1DC3A 3AERB 2AIOA 3RREA 5E95A 4FEEA 1E7VA 2PN1A 4PY2A 4ZPXA 1IZ8A 4HB3A 5A4AA 4NENA 3TF5A 5EQFA 3DDCA 4MYRA 2GBGA 3WA0A 1SA0A 1GGJA 3QLVC 4DYDA 3ROXA 1OT5A 3RTBA 3MZ0A 2H6AA 5I45A 2IEZA 3ZKAA 1N8NA 3F4KA 3BQNB 4M4SA 5CA0A 4BZZA 1Z18A 1V26A 5EV8A 3GEEA 4JUBA 3R9IA 2VHYA 2HJWA 1NG1A 3EVNA 2NNLD 2FLKA 2ZS9A 1O94D 3H9JA 2IYDB 2F3QA 4QNRA 4NATA 2RARA 1DBIA 3HJGA 3DC2A 2G8LA 2IYVA 4ZVVA 3SJCA 3V4VB 4RK6A 3TTYA 2C95A 4X8OA 5K4AA 4BATA 1KXJA 2EL9A 3G5UA 2VAWA 5A03A 2ZSKA 4F45A 3I9KA 2QSDA 1CY4A 3QARA 2Y2UA 3EIFA 5AOBA 4W7SA 1VLHA 4PGGA 3VJKA 2P9YA 3FOZA 1FUYB 5DX0A 4D9BA 3FDXA 2ACVA 2M0XA 3MJSA 3L6UA 2IJGX 2IYLD 5KCZA 2YZGA 1RYNA 2W2VA 2H1OA 2C5HA 3DOEA 1BA3A 3WA6A 1PU2A 2OCAA 1NQTA 3P0RA 5LNK6 2YDXA 3WQBA 1XZFA 4TKMA 3X2YA 5CVTA 5AP9A 3G9XA 2NN3C 1IATA 4CG2A 3OLZA 1VPWA 3R3JA 4E09A 2A9RA 5KTTA 1GTJ1 1AGPA 3MMZA 2XQGA 2JGNA 4CHTA 3FUVA 1KJZA 1A27A 4RO0A 2ZBPA 3CQ9A 1M34B 1TKEA 3EPLA 3EVZA 3OCXA 4KWTA 2D07B 3FVWA 3SLKA 1KU6A 4UU8A 4G5HA 3FCUB 3ZDRA 3AU5A 4JITA 3FRJA 2WRZA 1JEEA 4MQEB 5HJ5A 3QPDA 3LYAA 4ALJA 2BBSA 4FCVA 2OYCA 4EW6A 4P0TA 3DGEC 1D04A 1P7CA 2RHRA 2D1FA 4AZ0B 3M6WA 4D1YA 4JR0A 3MT9A 5IYZF 3TTUA 1CE8B 4CODB 2P8SA 3MXTA 2V3CC 6LDHA 2D2IA 3HV0A 5LLIA 3TVTA 3E0XA 3JQ7B 4PICA 2WHXA 4H35A 4N8EA 3MTAA 5F77A 4FXPA 4RCYA 2VNAA 1TMOA 5GY7A 4CU5A 4LGVA 4PSAA 4GT1A 2JLXA 2G7MC 2ZPUA 3BA6A 5HEKA 2WJIA 4YV0A 4CWAA 2Q49A 2ATIA 2R68A 1HQRD 4ENSA 4AO8A 2YWXA 3V4PB 3Q0TA 2BTOA 1YF3A 4DYHA 4FA6A 1KJJA 3UFXA 3FJOA 3W8FA 3LA6A 1DLJA 4CKWB 4US1R 3WXCA 3ZU5A 4HG2A 5G41A 3REQA 1XRPA 4W9GA 2C3OA 1FNVA 3AV3A 2I71A 4WLNA 5BXQC 1C8BA 1M6NA 1PT6A 1EFHA 3H5TA 4REMA 4WCDA 3RUPA 4JDUA 2ZNVB 4MUKA 4OBWA 3U3RA 3EPHA 3WI7A 5DHRA 5AT1A 5I9LA 4MARA 4UDXX 1WR8A 3D0OA 5BXYA 2ZCUA 3KCNA 5I7VA 1KWKA 1M5TA 1DOZA 1XTBA 3LMKA 2CDAA 3G0BA 2Y3IA 4L72A 2EU8A 4JEIA 1U7DA 3RTEA 1G6OA 2PFKA 1P7PA 3B7GA 5ELMA 4M1MA 2NBUA 3WLTA 3DB2A 4RUKA 2A9FA 1USUA 4K28A 4RMIA 4WIPA 4YSZB 3VRHA 3Q41A 1T0YA 2KS6A 3BJEA 2ZZPB 1F17A 1DKUA 2ZRGA 3FPSA 5FNVA 4YV1A 3LX8A 4FFBB 1C1HA 5K8TA 4LTNA 2I6XA 2YW2A 4W5RA 2B7BA 2BC2A 4OG2A 1DUSA 3W7VA 3PNQA 1PHPA 1VBKA 1KDPA 1YI1A 1O0SA 1QFMA 3KQUA 1QYVA 3VI4B 3P2IA 4IXDA 2LD9A 2G1UA 1VL6A 1I3CA 3A3YA 2IW3A 5JBIA 2NLOA 1LSOA 2ZKIA 1YJJA 4JJKA 1Y7IA 3NNSA 2YVUA 4U8HA 5FLKA 4C4RA 4J0HA 4ZQEA 2X7HA 4O4IB 4YAJA 1N25A 1G6KA 2EZ9A 3A6GA 4LMAA 2YJNA 3IXQA 2FDCA 3AF1A 3S55A 3QOXA 1D7OA 4JLOA 1L4DB 4QUHA 2LE0A 5SZJA 3OG9A 2BEUB 4UOZA 1KM7A 3AXSA 5D3ZA 4FDMA 1RJFA 1T8RA 2OCXA 2CD7A 3WLRA 1L7AA 2HLNA 8OHMA 1V1OA 3PFFA 1PL0A 3ZEAA 5DF1A 2IL1A 3GJ8A 5LB2A 2AL7A 2X0DA 3VUFA 3PR1A 4RKRA 1HKHA 2NU8B 2W22A 3IAXA 4AJJA 1ONBA 1Z0AA 2QVCA 1F4LA 3PSAA 5CHYA 3ZNOA 3K1JA 2IYOA 4G9BA 1ML3A 1ADYA 5AVKA 4ZT2A 2IXGA 4UDOA 4M9SA 5JEEA 2AQ1B 1ZWLA 4MRSA 2D5IA 4PYKA 5KAMA 1TCUA 1F5SA 4CXMA 4I19A 2FAXA 1XZBA 3K15A 4MEBA 4GDFA 4MGKR 3ZZMA 5CFPA 3U7IA 2FZCA 3FWZA 1G8PA 4IVPA 5HE9A 1NI4B 5CFQA 2VK8A 4BVKA 1GWNA 1K7EB 2ZUDA 2FZVA 1WU8A 1E69A 5C3UA 3HVUA 4OFWA 1F8GA 3ETDA 3M62B 1FQJA 2UVPB 4QJBA 1Y44A 4ZZ3A 2VJQA 4HEQA 1QGYA 1U1GA 4QTTB 3A6HA 1AKRA 1QG2A 5TMEA 1U3WA 5TGTA 4MS3A 1XJQA 3JQGA 1KMHA 3LBYA 4D80A 3EGDB 2NUAB 3WGLA 1HL7A 4EB6A 2OFPA 1EX9A 3EIOA 1UEXC 4DA4A 3L06A 1KOGA 4IHJA 3G2NA 1E1QA 3OE1A 1E9FA 1C7JA 4FSHA 5HTOA 3HSKA 1E1RD 4R2WA 3RUAA 2OG2A 4X5OA 3M6UA 1U1FA 3TEWA 3SYLA 3I9LA 4BTEA 1D1SA 4FHFA 4BCCA 2HNKA 5L4SA 4BVEA 3K7EA 1S1CA 3GAFA 3HM3A 3LS2A 4N6GA 3TAHA 3DGFC 3FPFA 3O1HB 1NQ5A 4NOJA 2ZSJA 2BYEA 1U28A 3ZN2A 2E18A 4M0KA 2C7QA 3ZV3A 2X4IA 2ZXUA 5E6SB 4MRRA 2YICA 1SZCA 1AYFA 5CFRA 3RD5A 2CJOA 1EX7A 1Y8AA 3LSTA 2AFIA 2ZQ5A 4BQSA 1P91A 2B5WA 3ZU6A 1UOPA 2XT0A 4XVHA 2F3RA 4O5AA 7ADHA 3I73A 1A7AA 4RFSA 1U7OA 1VLQA 1EJ6A 4G89A 3E7PA 4M0WB 1A77A 1U0HC 1TAUA 2ZE6A 1VFNA 1YJAA 1Z25A 3O31A 5EWMB 5LBIA 1POXA 1S3SG 2WSLA 3HYLA 2BUAA 3NEPX 3FUUA 4WXRA 1R5NA 5DRTA 5CD1A 1YJXA 3OD1A 3LK6A 3NDIA 1VI6A 1R4NA 1TCAA 2AQ3B 4JAVC 3IL2A 1K89A 5L3QB 1X3LA 4DMMA 3I6YA 1RBZA 3O8CA 2ASVA 3HUIA 1QDEA 1H94A 3ONWA 2ZQYA 1DFHA 1M74A 1LLUA 3EEFA 2BGNA 4QOSA 5BMGA 2ZM6B 2IQ5A 3I04A 3K0SA 3AUSA 1U2GC 2PTLA 2CLSA 5BYKA 1KGSA 2B4YA 2ZJZA 1F9EA 5B30A 4GLBA 4DOMA 4UBIA 4LQLA 5EAIA 1AKVA 1QH1A 4AKEA 3Q8FA 1OT3A 2XRMA 2H17A 2DHZA 1Y1TA 3ZK9A 4RGQA 5F7OA 1N2SA 3VNQA 4ZRKA 4NV3A 1IZ7A 5D94A 1U7ZA 1WX8A 5CNJA 3I13A 4BX0A 4R9RA 3NUHB 3CLSD 4D9MA 4ESEA 4ZARA 5LBUA 4E5VA 3FJYA 3I5AA 4NG4A 4Z3KA 4Q7KA 1FP1D 3OESA 2CXXA 2C2ZA 2O7SA 4E4RA 4NG5A 3D2CA 5B7PA 2FSPA 3ELWA 1E6WA 1UZNA 2ANBA 1T1SA 2BEJA 5KYGA 2A7XA 3WXBA 4NYIR 1AY0A 1H85A 3OX4A 5EJ8A 3TSWA 2C5LA 3CF0A 5AHXA 3PUXA 3JWJA 3EULA 3D2AA 1Z34A 1WU7A 3U17A 1JJIA 1M6YA 1WW8A 2V4IB 4UOEA 5JAMA 1KPIA 3A36A 1U1DA 5JCOA 2HWUA 4PAWA 2UDPA 1YE8A 1TKGA 4PG7A 4N47A 1RHQA 3TOCA 3M34A 1OTHA 2F1OA 2C59A 1J19A 1KFBB 1C7QA 4KLAA 2DPXA 1ZS9A 3GUCA 3LB8C 2EG9A 3QVGB 4GSYA 4D9CA 3QELB 3DZCA 4LY3A 1VRCA 2W6CX 4IX9A 3G23A 1ADJA 5CDFE 4N6EB 2DWPA 3FZEA 3BK1A 3L82B 4IW0A 1UK7A 2QUBA 3ZH2A 4LGMA 4PZEA 1O2DA 1S3FA 2VYVA 3OZBA 1W0CA 4O2BF 2ODWA 1Y5RA 1GU7A 3M6FA 3MC9A 4QRHA 2X2EA 2HA0A 1JE1A 5ACVA 4E5MA 2I3BA 3ZKWA 4NBLA 2V1YA 1BJTA 5IDVA 1UXIA 1QU3A 2XNJA 3GELA 3KALA 1HNZB 3VC2A 3VZDA 2VRCD 2I2CA 1M2OA 2E89A 3ROGA 1X77A 3WGZA 5AW2A 4DIFA 2BB6A 3I5MA 4M49A 1YZTA 1ODSA 2EKPA 5CM2Z 1XD3B 1M1NB 2XE7A 1AN8A 3HCAA 3WB1A 3VGJA 4IR7A 2FE4A 5I9BA 1GG3A 4RD1A 4O2AB 1G3RA 2BYFA 1M10A 4HR7A 1WE2A 3OOEA 1H2FA 2AJLI 5KIAA 2G1JA 5AVYA 3UJHA 1DELA 3PRPB 1S4MA 2VDWA 2PWAA 4LF9B 3I6BA 1Z0SA 3K6JA 2XXAB 5HI1A 4FZVA 2VEDA 4J0QA 2Z3VA 3K4HA 1K8YB 3KLSX 3PHJA 1G3UA 4PLZA 1YJBA 3GFVA 1KMCA 2MSEB 1SBBB 2V7QD 2QI9F 2QL5A 4YVFA 3I09A 2YMLA 1SCIA 4XVCA 2D1RA 1MEOA 4NYJR 4F3NA 4V1CI 3VR8B 2MP2B 4EF4A 3CEJA 3EFOA 2XXJA 3UKOA 1IHOA 3ILSA 2JZCA 4OXQA 3IEPA 3UQAA 1APBA 1YL7A 1XIVA 2HA6A 4G56A 1HF3A 4OM8A 3T5GA 1K0FA 3G0OA 1OAOA 1OLOA 3RVQA 3RBAA 3AIMA 1HNNA 2WJ4A 3QE2A 1RRGA 2XI4A 8ATCA 5E4FA 4OL0A 2I2WA 1HK7A 1WPGA 1UBKS 3G8DA 4QYXA 2Z04A 2V55B 3F3SA 3BQ9A 3RVMA 2YZNA 4JU8A 4LQCA 4HHEA 1QYCA 1M5RA 1NBFC 1O8BA 1VI5A 1EQUA 2EFEB 2V0GA 3BGWA 4F3YA 5AD1A 5KNCA 1B6RA 4R84A 2PE5A 3QKIA 4EKUA 1SD2A 5E6RA 2QJFA 1I3LA 3G2PA 3ORSA 4OQ4A 3USCS 1U7PA 2ZWPA 1Y1SA 4LIPD 4FGLA 1QT9A 2QP3A 1V71A 3K8YA 4JROA 3VSBA 1ZSYA 4WA7A 2WM8A 2XRFA 2BD0A 4MRPA 4OAPA 1XMOB 1P74A 3HWX1 1MG5A 3SC2A 4DLBA 1OIVA 2G5TA 4FT4A 1IQRA 2BHLA 4Y2GA 4IGAA 1M6VB 5KTMA 1X1CA 4KYUA 1CX9B 4WBXC 3SKYA 4CMEC 4DA6A 1CVIA 1FSZA 2FPRA 2PX3A 3TQSA 5A1TA 4M9UA 4R1NA 1CR1A 3OBBA 1IY8A 4GB9A 4RVHA 3DVNV 1E9SA 1Z29A 4XTCS 2C98A 4KQEA 4OHVA 4CRWB 4P33A 4A9AA 4XRGA 3RNOA 2N1VA 4PYZA 1X7XB 2SAKA 2ADMA 5FFFA 5BSUA 2PBFA 2LJIA 3IVFA 2JJMA 1ZH8A 2KDEB 2NUPA 4X1KB 4FLEA 1A9OA 1ZOPA 4BZWA 4PLYA 1WY7A 4GVLA 1E6KA 1Q7RA 1T5IA 3EY9A 3KOXA 5JCXA 3UTCA 3PDIA 4WKNA 3FB4A 2GPSA 4MCAA 1ZGAA 2K8CA 5K0JA 4ER6A 5DH9A 3HWWA 5ICEA 4HWIB 2GK7A 4QELA 5FI3A 1ZDMA 1RP7A 3ZXVA 5TIIA 1NUTA 4FSXA 3T3GA 3TZ6A 1LO5D 5FBKA 2CFRA 2JGDA 2BBOA 5IWCA 2V1XA 4KWEA 4WKCA 2KHWB 4G86A 2MYNA 4FLFA 1II0A 1EGAA 3CVOA 1YASA 3C45A 4FB5A 1DPFA 1KE1A 4Q7QA 4JUDX 3ROQA 4LZAA 3FWKA 1U8EA 3HVKA 3O0TA 2HHCA 5MPOA 3L7LA 1NY6A 2WSMA 3O9ZA 3G79A 2BFWA 5LD2B 3O8LA 5DTIA 1AN9A 5EW0A 5JJKA 4ZEMA 1VRWA 2Z6AA 3RSFA 5LZ7A 4FOPA 5G53C 4FFOA 5KI6A 3X2SA 8LDHA 4AN1A 2LXCA 1V8FA 2C5BA 5BWMA 4WXPA 5I7OA 2ACEA 4C2TA 1IONA 2O5RA 4CIWA 3FNFA 2P5SA 1IOLA 3OVMA 1MC1A 4H60A 3LY9A 2HGZA 4M60A 4OJYA 4DNXA 3U44B 3SSNA 2FB9A 3AJDA 5DPMA 2D3TA 2QLFA 3KQKA 5BWLA 4ZV7A 1UH5A 5JFGA 5IU6A 3OE5A 4TXMA 1TZBA 3MHPA 4A73A 4LRUA 2ABWA 2V59A 2YJ6A 5D6JB 3CWZA 3WP0A 2WMOB 5CXUA 1WMHB 3BGOS 2JGEA 5FCDA 5BV0A 4HQ6A 4Z4CA 4KR3A 3QHAA 4BHTA 1XQYA 1R1DA 3FNBA 1XU9A 3I6QA 2G28A 3DHHC 2FVXA 1GZDA 2J4CA 2HF9A 2X5XA 3HXOA 5AW0A 2FU9A 1KDZA 1GP2A 1OROA 2XE6A 2FW6A 4E03A 3H1UA 4MV5A 1IQPA 4X66B 1UT6A 5BSGA 4NBNA 4P86A 4ACAA 4B8WA 4HAYA 3IP7A 2FEPA 1XMQB 3DS8A 3IEIA 2OGTA 4JP5A 3WHKA 2JIDA 1TD1A 3AEKB 3OE7D 3UV3A 2AZTA 4IDDA 4GBGA 1BYUA 4YTPB 2C5LC 4WGGA 2EWVA 2WJYA 2C20A 2CNBA 3PCTA 2OCPA 2R4UA 4YXWA 3DVAB 3HY3A 1LDYA 2L7RA 5T4BA 4UPEA 2FG6C 3LDAA 2XYRA 4TRJA 2I1KA 1LWNA 3SD5A 1T2NA 3T1TA 2DWOA 2IE0A 4CDGA 1CPYA 4YUZA 3P2BA 3M4XA 1U6KA 5IDYA 4IGKA 4L8FA 3PD1A 1E3IA 2QDSA 1FW6A 4C0AC 1QO0D 5ACPA 1CZPA 5KNCH 2WTAA 2PT6A 3QVSA 3ZTWA 3ROEA 3NC4A 4DM4A 1W85B 1PJ3A 3GD5A 3FNIA 3C1AA 1RMYA 5FORA 2N9XA 3NBMA 4OMFG 3G7NA 4G0NA 5CJPA 5FR6A 1E63A 2SCUB 1L6RA 2P30A 2V96A 4Y6GB 1TC2A 1KFJB 4DXHA 1E2LA 3ZNID 2GPJA 3M1AA 3TPZA 4XWOA 4TSFA 2JCBA 4NVRA 4UBMA 1MJFA 3E3NA 2YV3A 3H2JA 4YRJA 4QHTA 1IY1A 5IS2A 2W93A 4EHDA 2HM7A 1TPZA 3CX3A 3GUHA 1YB2A 4PG4A 1A97A 4IL5A 1NRIA 1XTTA 4W7IA 5HFNA 3E7XA 2F4VB 2PBLA 3E61A 3MD9A 1XX6A 1NN1A 4XWKA 4LYAA 3AYXB 3WXMA 2HQBA 4BLUA 2PSHA 3R5SA 3EZ9A 3RVDA 2P6NA 2KX3A 4U7GA 2IZ1A 4A8TA 3VOBA 5FWDA 2VF7A 4JIGA 5YASA 5TEWA 3BEDA 1E7PB 1NJGA 4XDDA 4FGKA 4IUCS 4L15A 2I3AA 1SUEA 3B2NA 3HUDA 2WWYA 1ZR2A 4EA7A 4X6UA 1NXVA 1J8YF 5BNIA 2A14A 3ZU2A 3OF2A 2IY9A 3ZUNA 2WT9A 3ZO5B 5DGCA 2WAYA 3CKLA 1QZUA 3JR7A 1NQAO 2BR3A 5FPQA 3SZMA 3OQBA 5EZ6B 1OFGA 4H7IA 2OZPA 1GB4A 4RY9A 4AX8A 5IJ9A 4O1HA 3AJEA 2VFAA 1FP2A 4MPRA 2XITA 1M66A 3DVSX 2XLCA 2AUTA 4YIKA 4HMOA 4WN9A 1S3GA 3PDHA 2NYVA 4TYYA 1V5TA 1EAYA 4GVPA 2XMPA 4H3KB 2MMGA 1DZ3A 3EC8A 1T1EA 3QE3A 2I38A 2PUDA 1IAQA 2ZWOA 1KI9A 2B92A 5IULC 5EE1A 3D8RA 3STWA 2IU3A 3F5FA 3DWGA 4NZPA 4A1FA 1KO8A 2ID8A 5JW6A 1J8QA 3EZNA 2IYQA 1DRUA 1ODKA 4C21A 3GGCA 2KAJA 4DSNA 1HSZA 5LWQA 3USZA 3N3KB 2I8CA 1K7CA 3W5HA 3HRDD 2CHEA 4MGZR 1WXGA 3B9PA 1PR2A 1KF0A 1YRAA 1Z74A 4AUEA 4R5MA 3T7IA 2FN8A 2RGRA 5TLSA 3UF8A 4ZRDA 3U4DA 2PVGC 4HX5A 1Z0ZA 3VYRB 3KEOA 3TUJC 1NVMB 1Q0QA 1EXMA 2PY6A 3IXSA 1DKLA 4EJ0A 1PGOA 2JB9A 4LKOA 5JBQA 5DHQA 5JYDA 3NKLA 1I4DD 1QO9A 1MN6A 4JXJA 4BFUA 4MHSA 4HWGA 4JA2A 1CP3A 1PG5A 1ZPSA 3TL3A 1RWQA 1MGOA 3NTVA 3WP1B 3K2BA 2P9GA 4J0IA 3ML8A 4F2GA 3BMCB 3O4JA 1HSOA 4PCUA 2GBMA 4TM8A 5D01A 1DS6A 1Y8RA 2NU7A 2JYTA 2GAAA 1TS3A 5JYEA 5ALXA 4PZUA 2WUGA 4BV8A 2ZRKA 4K9OA 4K9PA 4EY2A 5JI3E 4YUWA 3PS9A 3VH2A 2GBNA 1U7UA 2Y6UA 1KIMA 3U3MA 1P7VA 3AIOA 1AUOA 3KOOA 4D3XA 4HROA 1T4DA 1ZM4A 3KQVA 2LKCA 3ND7A 3SC4A 2SKEA 1EB9A 4YV7A 2AYZA 1EMDA 4BB9A 2NGRA 1H8HA 3CTPA 3LD9A 4ZQBA 5CLQA 2JGIA 1RXEA 3LH5A 3S7TA 4IDNA 3DF7A 1KARA 4G36A 3IKTA 5AJUA 5C8YF 3HABA 1WB6A 2H5IA 1ZGGA 4P7BA 3WB9A 4JLBA 4RJTA 3ZVLA 4PVTA 3PGMA 2KK8A 4BZ3A 3R1IA 3OH8A 4KAFA 2DYKA 1DKPA 1TA0A 3N86A 4RIFA 1XZQA 4XR4A 4FX2A 1EDDA 2IQIA 3H7AA 1IRIA 5FJJA 4Z5YA 1N5WA 1JALA 3PJGA 3MBOA 1HTQA 3BXXA 4KHZA 5JD3A 5EJ2A 2PS9A 4P4TA 3UOGA 4G0OA 3LFTA 1P4HA 9LDBA 4IOJA 2L83A 5EZYA 2LCFA 1W36D 3F5MA 1DTWA 4HBZA 2XYHA 4N6OA 2K0PA 4CMJA 1YIOA 1JU9A 5C1DA 4Q7LA 2FEKA 2JCVA 1QUFA 2Q5WD 1VYTA 3GJ0A 4LJ5A 3MPUA 4X1YA 1YI0A 4D9GA 3UIPB 4GW3A 5CCDA 3TL6A 2WDZA 1KZ7B 4U4AA 5BOVA 2NX2A 4QOIA 5LA6F 2I5PO 4RMHA 1AHNA 1RI4A 1RLUA 1TUBA 3RPCA 5A4KA 2KXJA 1N1DA 1P1JA 2BMJA 1NN0A 1NW3A 1X0XA 1QH8B 4MKHA 3R6DA 1FXIA 3PTLA 3IVRA 3CWQA 2AXEA 3SVTA 3WB2A 1JIQA 2AJCA 5A3QA 5HK9A 3ZD7A 2QRKA 3JPYA 1O6BA 5K0FA 5DIZA 5FH9A 1VIDA 3DMNA 1D4ZA 5IHXA 2OILA 3AF6A 3GLIE 1JMVA 5JISA 5JZSA 4YDQA 1MQAA 3RF6A 1C3OB 3ETGA 2P9CA 1A5AB 2WHRA 4KCGA 2QP4A 4HQ0A 4OYYA 1RAXA 1SELA 3SBOA 3WWOA 3THYB 3B7PA 4HUTA 3DEHA 2V0CA 1N5XA 2R87A 2VK4A 1FEHA 2IV3A 3WLSA 2ZBGA 2HO4A 2B5VA 4D4JA 2O23A 3PFIA 4Z9AA 4KPYA 1JIVA 1XNGA 2J85A 5LXTA 4OLBA 2O8FB 3L8DA 1RJ9B 5EMJA 1I6LA 4ZANA 4RBNA 4JXZA 1ZEMA 1Z83A 3PQ2A 4RGTA 2HIGA 4KX6B 2OHIA 2XBLA 2DEUA 4REOA 1KI7A 2IVZA 2O2VA 3JQ9A 2C0PA 1TQ2A 1R8QA 1BQ3A 2V6IA 3UOWA 2NADA 2VTVA 1N60A 1S2MA 1FRZA 1SH7A 2WFLB 2XA9A 1PYGA 3U19A 1GC6A 2PZKA 2WFAA 2KQSA 3W5JA 4B9EA 3B60A 2QTZA 2HTME 1HBJA 5IAGA 1IN6A 4S17A 1NAHA 1SJED 2B4RO 4BVJA 3LLCA 4F96A 2EGHA 2J3QA 1Q0RA 1ZGJA 2WHPA 2GBCA 1L5HA 2OK8A 2IGDA 1DC4A 1T26A 2VYND 3GP5A 1FY2A 2NO1A 4Z4GA 1M54A 2CHVA 5ULLA 3K9LA 1T4GA 4JP1A 3ZBQA 3QAQA 1FF9A 4ITKA 1W35A 3MYYA 2Y68A 4PC2A 3NDRA 3CWIA 4V02A 5FT9A 2B3TA 4JS0A 3F97A 1UJNA 2WUWE 4I3HA 1IMJA 2N46A 4D6PA 4NYIQ 4KDRA 3O75A 5CDSA 1YX5B 3CZ9A 3C7AA 1YFZA 4NXNB 4AP4C 2GS9A 2LMCA 4UU7A 4II7A 3HVZA 3PQ7A 3EXAA 1SUAA 2PZFA 1QYXA 2O0JA 2P9FA 3AUTA 4RXMA 4AS3A 2LVQA 2R61A 2O0HA 4BX2A 5CB8A 5HNKA 3QTBA 1THMA 3GRAA 3EF0A 1L5OA 3DMHA 2CDRA 3K1AA 1YTUA 3H3EA 1YQ3B 3SR4A 1Z75A 1OLUA 2H06A 1YL5A 2I8LA 1KA9H 1A2OA 1XVVA 4LOHA 3U4HA 2KQ4X 4FMPA 1ORVA 2CD9A 3TB6A 1IJEA 2BFCA 2J52A 5H4GA 1U2EA 1BSVA 4NJEA 4D9FA 5G5GA 3A26A 4QOEA 4FJVB 4BO7A 2G1EA 4F38A 2EHJA 3EMKA 3SW3A 2ZJFA 3I8OA 3KJIA 5IXYA 2ZIGA 1B43A 3O47A 1QK3A 5IF9A 4DCNA 1ZD9A 2CL7X 3ADOA 1B7GO 5A3RA 2UUCB 4Y18A 4L4ZA 2K8BA 3DVLA 5KC8A 4A10A 3D32A 3GMIA 4XB2A 3UMVA 4F6ZA 3K2IA 2D7CA 2AV6A 3TO5A 1TMKA 3SZLA 5HH4A 3DZIA 7ABPA 5DMXA 3ZZ0A 4OXIA 4GU2A 1XV5A 4PSKA 1XCOA 4Y6QA 3DE1X 4QGHA 5IT5A 4CKBA 3R9KA 2DWCA 5E4JA 3HQ4O 1PVVA 2IS6A 1JP7A 1GL6A 2IOFA 1Q0ZA 4BNKA 4KGXA 3S0JA 3HCNA 2I65A 13PKA 3MM4A 3BRQA 1GV0A 1SCJA 3LX4A 4O08A 5LMCA 4UCFA 4BKGA 4TVOA 3DWGC 4CF3A 3VUXA 1GAWA 3O3MB 3JVIA 1P7ZA 1E9EA 4J0CA 4HPMB 5AUKA 1VLLA 3ESQA 2VTEA 3LF1A 4AKGA 2EP5A 4RKEA 1MC5A 1PJLA 4QLAA 2R96A 2BH2A 3R41A 1DDIA 3R5JA 3ORHA 4L7QA 3LP8A 4K81A 3HCCA 4EB8A 3EC1A 1JGTA 1PW7A 2BN4A 4HQRA 3SWWA 2O0MA 4RZSA 4EG0A 2X4GA 5KJEA 5ITVA 3NUGA 1T3LA 1UAGA 2CBZA 5HM6A 5DXJA 4RGBA 4LWQA 3ACDA 4BGVA 1PNQA 1MFZA 1L6UA 4GGOA 2CVQA 1XEAA 4WASA 4DJJA 4R01A 3K70C 3NTRA 3I05A 4UPDA 2D3AA 4L5CA 3VH3A 2WIAA 5GIPE 4JH0A 3W34A 3E70C 2O3TA 3BFVA 1RQLA 2DHDA 2XW6A 4OH1A 1Y8RC 2CXQA 4NAMA 2HQRA 4EDHA 4E7OA 3VHLB 4ZYNA 2V3SA 3MJEA 2V4LA 1G60A 1T0QC 3DW3X 4YCMA 5JQGF 3HK2A 2QDFA 2AG0A 3SZRA 3G6KA 3ICQB 1VBMA 3C6BA 1GUDA 5B1SA 2QX6A 4WAUA 4OX9Y 2B99A 1KQFA 2ODPA 3B3GA 3A32A 5I3ZA 4DXAA 3JVDA 4M02A 1SJHD 1KJYA 2PVSA 1L7YA 1MB9A 2R7NA 2PLWA 4N3CA 1QF9A 8ABPA 4YCJA 1XZNA 2FP3A 4HGNA 2BRUC 4HF7A 4KB5A 1GGFA 1LPOA 2H16A 1O7JA 4C0SA 2Q07A 1JG4A 1N7IA 2IYTA 1E3QA 2XH8A 3TMPB 1Z6QA 2PUFA 2QIEB 4TQGA 2Q42A 3BL6A 5K1ZA 3LPCA 2E1RA 1YFKA 2FKAA 5ADHA 1EVJA 1M1YE 2LPMA 3GFBA 4HLUA 3FTFA 3UPDA 3ZE1B 1WO8A 1ZDVA 3D7MA 2HGSA 4CDNA 3ZE0B 4DSZA 3KYDB 2WSYB 1KVQA 2JLSA 3ZW3A 1B15A 2QJSA 8ADHA 1V3TA 4DIUA 4TYQA 2WF7A 3FX2A 1PUTA 1QQAA 4Z8YA 2XDYA 2J3DA 2WMDA 4XVUA 1H93A 3H19A 2WB2A 2X8LA 4AC9A 2DTEA 1WR6E 4QO8A 2DQZA 4EK9A 4NTZA 3ED5A 1U0FA 1OFUX 4F8JA 3FYCA 3MLEA 2WD8A 2WOOA 5LP6A 4KDLB 2HX1A 1THGA 2ZSUA 3OCWA 4EPVA 4EYFA 4G8CA 3JW8A 3PJFA 2L0TA 3KJZA 4MHOA 3GMTA 4ZV9A 2LHEA 5GMVA 3AEAB 1RABA 4YT4A 5I4IA 2RH9B 1YS9A 2EJBA 1J7AA 1YT5A 3ENEA 4P8RA 3I2YX 4F6LA 3MT7A 1CK4A 3NWJA 3RV3A 4U2FA 4H15A 5JS6A 1AKWA 3D6UA 4A8JA 4UVEA 3DBRB 3DAOA 1LTHR 3DBHB 4E3WA 3UFBA 5IEBA 1J33A 1U6IA 1QHFA 4CCWA 4XPIB 1ZJ4A 3EQ9A 4IW3B 3BE8A 3RVLA 4LK0M 5AVZA 2IELA 3LY5A 4R3DA 4J94A 2PKQP 3ZDBA 4J0GA 1XVIA 1T6BY 4J6FA 4O4LA 1NBMD 1CIPA 1DC8A 3AHFA 3Q8EA 2GJ9A 3MBKA 4CCAA 1QQTA 4L8VA 5JPCA 4ZCQA 1WJ4A 4M1OA 4DEVA 3S2IA 3FPEA 4BX3A 3LKDA 3I23A 4GBED 4J9UE 2ZYAA 4IM0A 1M0TA 1CR2A 1E9CA 1UJCA 5IUJC 4KE8A 1J8DA 3BF7A 3UA4A 1AGXA 5BURA 3GFPA 4E3ZA 1WOYA 1KZ4A 4E71A 4B6QA 2W6PA 1E9BA 1KNQA 2QSYA 1J8FA 1FVOA 4J49A 1WF9A 2HIHA 2Q5HA 4GOKA 1K8RA 3ISJA 3T9BA 1F4VA 1JHRA 4JI4B 1ECGA 3KWJA 1KAOA 4KQXA 2EWWA 4MEJA 5E6JA 2JYEA 3SJBA 3UF0A 3TIGA 3JQ9C 4TSRA 4URKA 4EFDA 1R0RE 3VKGA 3BXPA 4PYOA 5HKKD 3NIDB 2ZKLA 1X1QA 3HFJA 4OHZA 1WNFA 1QANA 1KMMA 3RYHA 4B7CA 1MEJA 1UK6A 4CLOA 1T5LA 3DCYA 5DXAA 4BOYA 2XZOA 3JU3A 1NTOA 4TYMA 1Q57A 3KTOA 2YQZA 3M70A 4RXUA 1E9AA 2OOSA 5I51A 2MDTA 2UXCB 3WAKA 3UBMA 2OZLB 2HMSA 4JLDA 2YRFA 4QAYA 1I3OA 2Q7OE 4AYXA 4C7OB 5DGDA 1OLXB 5DP1A 4XUKA 1QOBA 2KN5A 1OU4A 4ENVA 2GA9A 2RAVA 1DIOB 3CX7A 1Z63A 4AP6A 1XXHA 1GLVA 1GTSA 5HCIA 4S1WA 1B8VA 4UHKA 4OSEA 1EK1A 4C56C 2D59A 5T3UA 1GQ2A 1AIPA 3A4RA 3HZOA 4ZKEA 3NJRA 5EP3A 3K53A 1KJQA 1Y7LA 1FFVA 1AC5A 2DQSA 5JTUA 5CH5A 4M9ZA 4NHEA 2XA2A 5EJ9A 1Z0DA 3FNHA 3QZUA 1NXXA 3DOJA 3GU3A 4R2LA 5EQDA 2IGHA 4J76A 4NE7A 4HJRA 4NENB 1EU4A 2VPYA 1B8NA 3ZWBA 4TKUB 1YNTE 1SA0B 3AR4A 2IHYA 1Y3DE 2KDBA 3LPMA 4AO7A 4UMEA 2WXJA 4OHYA 1FX0A 2R2DA 2G70A 1UDAA 1YRHA 2LRHA 1VPDA 2MSWA 3L7JA 5CA0B 1W52X 2W6JD 3MW8A 2IZ0A 3FNRA 4HC4A 1QRUA 1WWKA 5CXXA 4P5EA 2LUOA 2BGFA 2HU2A 4K1RB 4F2HA 3A9KB 1FFUA 1KI1A 3SM9A 1NONA 3I9NA 1S3IA 3RR2A 3CXRA 1P72A 1WXXA 2FSGA 3WAOA 4NBVA 1DV1A 2GGSA 4FNGA 4KDIC 2GFHA 3V7UA 2X13A 4KUGA 4H4CA 5FI1B 2VJKA 2FHPA 4UCQA 3F3KA 3GRUA 2V97A 1N34B 1DHTA 5JU6A 4BXOB 4S1PA 4YX9A 1OV4A 1W6UA 2WV9A 1QRAA 4Q01A 4FYXA 3ZDXB 2XGOA 4ZMSA 1YULA 3QE4A 1V9JA 3RRXA 2FPUA 4HBGA 121PA 5FNZA 4IIBA 1C1XA 3MLAA 5EY5B 4K3BA 2A1TS 4N5NA 1V3QE 3IO5A 1RMQA 4DCTA 4F4FA 2Y1OA 5HFYA 1QRDA 3CZ5A 2FPWA 1FS6A 3G0CA 2ANCA 4FOSA 4P16A 1K7SN 1RYBA 3FCEA 1EGQA 1R0XA 3L4BA 2QVXX 2PZEA 3PITA 2BWES 3E9ZA 1E99A 2O2YA 3K92A 4BFWA 2FMXA 2IE8A 4K1LA 2O4UX 4HNHA 5C37A 4RDXA 4GR9A 2H3EA 4OLAA 4HS4A 4RVGA 3HA3A 2QJOA 2FR8A 2Y05A 3IE0A 4DC1A 2ODEA 4ZO2A 3VJLA 4W9HA 3WLEA 3JQFA 4Y8VA 4YASA 2L8JA 5DHAA 5CURA 4BGEA 2KO3A 3DVRX 4Q9JA 3RWOA 3FVRA 3AXCA 1GQFA 1J6UA 1PUJA 1KAQA 1JXMA 3JWEA 1U0SY 5B3AA 4B74A 3FWYA 3VPGA 5A6VA 4P6VF 1P61B 4E4TA 3GP8A 1YN5A 3T4XA 2GPNA 2R6R1 1VMAA 2R97A 5JYBA 4LI0A 4AJ1A 1J49A 1HLPA 4BB6A 5DX8A 4W1RA 4ND3A 1N8SA 2K7FA 5DBGA 1Q6ZA 4KSLC 4ARZA 2UZ1B 5JT1A 2CHQA 2P90A 3IEXA 3H7PA 2P6OA 3QPVA 2IEBA 4LXGA 3RDPA 3QYJA 4ECEA 3PXUA 3L8ZA 2AKAB 1Y56A 1VP9A 4K9RA 1W0JD 3REQB 1NBME 3CJTA 4IKPA 1IBSA 2FPMA 2F8TA 5ES3A 1DPGA 3N8DA 4MPDA 1QVRA 1GO2A 2KWCA 2QTBA 3SHOA 4HDMA 3T0IA 4BJHB 1YUMA 5CHFA 4LTDA 3WRYA 3FILA 4WN3A 1MVKA 4HV4A 3A7DA 3D7KA 2N9EB 1EB8A 2XCQA 3PUHA 3KUXA 3FYTA 3TM4A 3VVWB 1OB2A 1ZHFA 2OQ2A 1KVRA 3ACBA 1JI0A 4EY8A 1KO3A 1WPRA 1ISFA 3JQEA 3VGPA 1GAJA 4UFPA 4QSHA 4I50A 5DMHA 1K6JA 5AM0A 3AVYA 1CEXA 4YRSA 2O5VA 2Q46A 1GU0A 4DDGD 1KI4A 4X7PA 3E9MA 1C9FA 5JECA 2JCSA 2ZI9A 4WACA 2WPDD 3OECA 1RFLA 4B6JA 5JWRA 5KSOA 3G82C 2VHEA 1VGQA 4F3RA 3T5AA 4ASWC 5FNVB 3GE8C 1WXWA 5LP6C 3M5CA 1XEWY 4ZO9A 3X1KA 4UHJA 5JATA 4PC1A 3LPDA 2A67A 1KP9A 1SUFA 5E6UA 1UAAA 2VBCA 4PF1A 2N42A 2ZSFA 4YMGA 1R0CA 3UYLA 4DANA 3I12A 3SXUA 4K7JA 1XZCA 3TQIA 3S99A 1VLMA 4RL0A 5DN6D 4DIEA 2HLHA 1IEVA 1VCNA 3WAJA 4FSBA 2FPLA 3D4LA 1Z7EA 4BLTA 3GWGA 1SK9A 3H97A 1V39A 2PRZA 4Q4LA 4HDCA 1C1YA 4IFIA 3DW1X 1UELA 4ARBA 2L32A 2JASA 3GARA 3U5TA 3I57A 3UMCA 2X8JA 1CZKA 4KWCA 2A4MA 3QFSA 4NSNA 4JSYA 3CLTC 3ORYA 4QTZA 1EGHA 4C6SA 5BW8A 1P0RA 2KQUA 3FRHA 4DL9A 3KV3O 5IVKA 3R2IA 1LLFA 2V45A 2Q50A 2G63A 2Z08A 4K0KB 4RAWA 5KHQA 3RWMB 4YP1A 5EMMA 3VR5A 2WI8A 4ZP1A 3T3MB 3ZWMA 1ICEA 1ZKMA 5IKMA 1LPSA 3PRMB 3F6PA 5BO5A 1A4XA 4U3JA 4HGQA 3GLFA 4YJ3A 1N57A 3GUVA 6YASA 4MW4A 1CXZA 2YZMA 3FRIA 1AA9A 5EWAA 3O2JA 3EHEA 2Z0DB 3NBKA 4XDYA 3PVSA 5TQVA 1N2IA 1PWEA 5DEIA 4XDCA 2LEKA 4UE2A 4RYLA 4NQZA 3RIYA 3D43A 1SWVA 5C4GB 4G01B 3FUWA 3IT1A 2FN3A 4TZFA 1I80A 3O94A 4F1JA 4N76A 1O87A 2NPTA 4D41A 2GLSA 3RS2A 4A91A 5EUQB 1YIWA 2WU1A 4KE6A 4UHHA 5L3SA 4BUZA 3IRUA 1H2WA 1SOMA 4MCJA 4R1SA 4ZQHA 2FZ4A 1ZVMA 4MS3B 3PX3A 5EXEA 5DYIA 2KBFA 3KPYA 1THTA 1KMHB 2CK3A 3LHIA 4CF7A 2YFKA 3GE3C 1PSDA 2B1GA 1N5OX 2HCFA 2YV1A 1NVUQ 3AG6A 1E6EA 5COQA 1X1DA 3M6AA 1XM8A 2G9QA 1Q92A 1JFFA 2ZI6A 3R0JA 2HD4A 2JLZA 1U3TA 2R84A 3KV1A 4J1SA 5JS1A 3GXOA 3S8EA 2PGDA 1GV1A 3AJ3A 4EHHA 4MQ5A 3QY0A 3DHWC 1Y63A 3B1YA 1HFJA 2XEWA 3AP2A 3H4MA 2P9BA 3IYLW 3L41A 1Y33E 1MAUA 2AX4A 4ZRQA 1H9CA 4OJKA 3H9QA 1SKUA 3ABIA 3TLAA 5J2UF 1UADA 3BT7A 3HB1A 4B84A 2QVYX 5CVVA 2RK4A 4DBZA 5DV9A 3UMMA 1Z73A 2VJPA 1N6RA 1PR1A 3PPAA 4M38A 2Z6VA 5J17A 2PX0A 4TM7A 4YK7A 1DUVG 3M1LA 3DMFA 4POOA 2XQVA 2WYUA 4DUGD 3DA8A 2LWPA 4UZSA 2EKEC 4H3SA 2BR5A 3KSMA 4D99A 3KC2A 3PC4A 4N0EA 3W5SA 5FPPA 3PPYA 4CZ2A 3GHHA 2Q9CA 2X14A 1A4IA 4Q4DA 4CNBA 5EJ6A 4ITUA 5F12A 1EDEA 3WDLA 3P9YA 5JD4A 2QRLA 3DBLI 1PT5A 1T0UA 2OJWA 4X93A 1T4MA 4NH0A 2W55A 1WCV1 4Y0NA 3N1ZC 3PY6A 1SIOA 3AG5A 3PQ5A 3RNLA 3NYIA 3JQPA 1U3DA 1P2DA 1KZHA 5F3DA 1EQ2A 3P97A 4KQ1A 1JR2A 4EHNA 1A95A 4NK5A 4PN3A 1FJGB 4JEUA 3OFNA 3LP6A 2EX1A 4D0RA 2IBMA 2HK7A 3G2HA 2QW0X 1O97C 2Q2WA 1XRQA 2JH9A 1AQIA 2W2KA 1DX6A 4HN9A 5BNTA 4W4TA 5B4TA 2O6LA 4UBOA 3VTUA 1CRWG 3EXG1 4M0UA 2JD0A 1OXSC 2ACWA 2G45B 2XN9C 5AM4A 4UUPA 2EEZA 1WXFA 4TKNA 4Y9DA 1E2HA 3JV7A 2KJRA 3NVKI 2DLCX 3SC3A 4EECA 5A4FS 3CT4A 1MG8A 3VVBA 3KE9A 4WJKB 1FNMA 3FPAA 3MK31 2EDCA 1QOZA 1QCZA 2FOXA 1V6AA 1LQTA 3OP1A 3DHGC 1SVNA 1CW2B 1RAGA 4RC9A 4BWYA 4AKSA 3HS3A 3AUKA 5CFZA 5KEIA 1S6YA 4CEIA 1XNHA 1I5OA 2IIVA 1SF0A 5K20A 1RS0A 4R2HA 1N6PA 2W6NA 5A23A 2WM2A 3WAGA 2UVQA 1EI9A 2WY2D 3ZE2B 5IJWA 2O2IA 3VXKA 3GP7A 1ZIDA 2WTEA 3MC0B 3V1LA 4EYKA 1WGYA 3L5OA 1OH8A 3P9CA 5ALKA 1Y4UA 3JS5A 1C7EA 2JLVA 2CEAA 3VR5H 1YJCA 1D4AA 2C3UA 3CO0S 4KN9S 3U48A 4U7FA 1H3FA 1Y81A 1L4LA 1C3VA 3RFCA 5FV4A 3TWOA 4EKIA 4RMNA 5JARA 2BIBA 4JNKA 1TU0A 5KJFA 2ZW9A 3PWKA 1U2SA 1EKXA 3IE2A 2C61A 1L8LA 4O4HB 3E5MA 3OAAA 1CJUC 1DT5A 4HEA1 1DKQA 5C2JB 2F59A 1QWOA 4KITB 1Z6TA 1BMFD 1NAIA 5E4YA 4N0PA 4OHPA 4OK5A 4PLHA 1BUIC 3PX2A 1VPLA 3WISA 2YS7A 4XASA 3BHJA 4X71A 3A1FA 2ZJ2A 1E5VA 1IUOA 6AT1A 2Y76A 3IVAA 3BBPA 1NZFA 3KNSA 1TIFA 4JY7A 2QXYA 4MLZA 1E5DA 2WVGA 4OXNA 2XBMA 5BT8A 4JXXA 4M8IA 5TPZD 3RHFA 1PYWD 3KJXA 2EKBA 5HG0A 4XOUA 1EWTA 3PLVA 1QK5A 5MFPA 4QEDA 1I0IA 1F52A 2I6TA 1Z2CA 3KB2A 2ID4A 2RB4A 1ESMA 1RRMA 2CNOA 1ZL2A 1MB3A 1HEZE 1U28C 5LZ2A 2LTAA 2CXSA 4AJHA 2JS7A 2RHTA 4Z7RA 3SS8A 4G4SP 4LZPA 4OUDB 4I9UA 3FKJA 2PK3A 3DDUA 4LSZA 2YFYA 4S1VA 5H3CA 5WRFA 4RKQA 5DDIP 3TOXA 4YAFA 5DTRA 5M04A 2ZW0A 1EFUA 2WZCA 2XCIA 1DJLA 2MCNB 3CZMA 2X6QA 2YIDA 4ZOAA 4WBNA 2XMGA 2CZQA 3FF4A 4IFBA 3DZ8A 1TVCA 4TQUS 2JIZD 1QHXA 2JKYA 3JR3A 1OV6A 2Z1DA 2KQ7A 1FFBA 3EG9B 1VJRA 1Y1PA 3Q8BA 3WLJA 3WA7A 1LNQA 5ADUS 4GP9A 1FNWA 1VG9B 3DZJA 1OEYA 4INAA 5T41A 4D8VA 3I11A 1LFAA 3SD9A 3QXGA 2HEGA 7GPBA 2X9LA 4Y2HA 5E0OA 1E5LA 2YV2A 2ZJ8A 1ZXXA 2O2ZA 5KYXA 3CF4G 4C7MA 5DTMA 5KQMA 2PG3A 4PHFA 4EY7A 5CTJA 4ZJUA 3ESYA 4DIMA 1HOTA 1QK4A 2AN3A 5JDCA 4DR7B 2J3EA 3DFKA 3LKBA 2RGYA 2LRUA 3H5RA 2F3UA 1NF9A 1SC1A 3KVRA 1V1MB 4P58A 3G17A 3FHOA 4B3GA 3W9UA 3A4SC 3PO0A 4RF2A 1G21A 1M8GA 2IPOA 2QY6A 4BDSA 1NMEA 3ZHZA 3CYFA 4ZOBA 4ED9A 4CDMA 3HACA 2AN9A 3EZ6A 1YV9A 2MSDB 3WKBA 4V1CA 3C3XA 4TV9A 4JGBA 1BRMA 2QUAA 2ZWIA 4GX1A 5IA7A 2X3YA 3FMVA 5DPWA 2NXJA 3SC2B 4CHLA 1E1LA 4MYDA 3IKLA 2YHIA 2OAGA 2G3QB 5C2TB 2QV7A 3TXAA 4H1TA 1OFVA 3VR3A 1GRRA 5FQBA 1K88A 4R0NA 1OU0A 2A4ZA 5TMDA 4GLJA 1YZUA 5PNTA 2AZDA 3NBFA 3BF8A 3TS1A 1LDNA 2O8CA 2WE8A 4L8GA 2JA2A 3K8ZA 3PI7A 3D6AA 4ID3A 3EXEA 4J1QA 1LC3A 4GR5A 4CMGA 4K2AA 1C7IA 3W7BA 1PL8A 4JI3B 4GM0A 3UB4A 3A05A 5I4KA 3SEFA 1AV7A 2NZFA 4FFNA 5CYFA 5CIQA 1NKVA 1ZH2A 4C04A 2B9EA 4O1IA 5GZ1A 3CU5A 1CERA 1Z2EA 3ZE8A 2PX8A 4DCVA 2M2IA 1E60A 5ALSA 1Z56C 5JCOC 1E9RA 4RK7A 1SVSA 3ABOB 3PDIB 4QGFA 2WIFA 2IEYA 1GPWB 4BFXA 4RZXA 1QMGA 5C31A 3LVZA 4ZO4A 1FNSA 2CCKA 4RQBA 4YGXB 2WTBA 3CSTA 3OBIA 5HX7A 2V9PA 4YEDA 3ZXYA 4IG4A 2BWFA