3T3NA

Molecular basis for the recognition and cleavage of rna (uuccgu) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
550
structure length
550
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/rna
molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
total genus 160
structure length 550
sequence length 550
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3nA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3nA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3nA01
3DHCA 3LVZA 3SW3A 2OHIA 1WW1A 4FR7A 2HB9A 1KO3A 2FHXA 2Y8AA 4AWYB 4BZ3A 1L9YA 3PY5A 4DIKA 1WRAA 4YSBA 4FSBA 3IELA 5EWAA 1M2XA 1X8HA 5LCHA 3IEKA 2BFZB 2Y87A 4D1TA 5FQBA 1DD6A 4C1FA 4ZO2A 1MQOA 2OHHA 5AHRA 2Y8BA 4AX1B 4GYQA 4C1EA 1WUOA 3IE1A 4P62A 2FK6A 4UWSB 4HKYA 2P18A 2ZZIA 3X2ZA 4C1CA 3VPEA 5EVKA 1XM8A 4B87A 4RL2A 5EVDA 3IE2A 3SRXA 3AF5A 4EY2A 5A5ZA 4TZFA 5EV8A 2BG8B 4UA4A 4UWPB 4LE6A 5HIQA 4J5HA 2XR1A 3DHAA 5ACSA 3BK2A 2FU9A 4TYFA 5EVBA 4D1WA 2R2DA 2BFZA 4Z5YA 2BG6A 1E5DA 4H0DA 5EV6A 1YCFA 2QDTA 4C1HA 4KEQA 2P4ZA 4KEPA 3ESHA 1VGNA 4EYLA 3L6NA 5B1UA 3KNSA 2BFKA 3Q6VA 1KO2A 2GCUA 5AXOA 2DKFA 4ZNBA 3IOGA 5A0TA 2BG8A 2ZWRA 3S0ZA 2Q0JA 2NYPA 3I14A 5AYAA 4V0HA 2GMNA 5EH9A 4TZEA 3MD7A 4XWTA 3X2XA 4Z5ZA 3ZWFA 1QH3A 5HH4A 5EW0A 3DHBA 4TZ9A 2BIBA 3I13A 2Q42A 4O98A 3TP9A 2DOOA 4UAMA 5K4MA 1BMCA 3WXCA 3SPUA 3RKKA 2BR6A 4NQ6A 4C1DA 1ZKPA 3IE0A 2NZEA 2ZNBA 4RM5A 2VW8A 3FCZA 1ZTCA 5LM6A 2QJSA 4PVOA 4F6HA 1A8TA 4Z6XA 2E7YA 4HL2A 4NQ4A 4Z60A 5HIPA 5FQCA 5ACVA 5ACPA 3SBLA 5LS3A 4D1UA 4C1GA 5EHTA 2GFJA 5LLDA 4YSKA 4Z7RA 1HLKA 2AIOA 4YSLA 5A87A 3SFPA 5LE1A 1A7TA 2WHGA 2I7XA 5DPXA 5LCAA 3X30A 4UWOB 4AX0B 4AWZA 1JJEA 5A0VA 3PG4A 3DH8A 2H6AA 2UYXA 2FHXB 1QH5A 4EXSA 1VMEA 3R2UA 4CHLA 1SMLA 2GKLA 1VJNA 5HIOA 3I15A 2BG2A 3X2YA 3IEMA 4EFZA 4F6ZA 5ACQA 3IOFA 3PY6A 4FEKA 3A4YA 1ZNBA 2BC2A 3QH8A 4HL1A 1XTOA 2NXAA 4RAWA 2BG7A 3KL7A 4ZEJA 4RBSA 1BVTA 2YNVB 2QINA 4ZO3A 2M5DA 4UWRB 2I7TA 2YCBA 4D1VA 4NQ2A 2M5CA 2WYMC 5K4KA 1BC2A 5ACUA 4TYTA 2BMIA 2WYMA 2Q0IA 3BV6A 5KIKA 4EXYA 3SD9A 3H3EA 2GFKA 2YNTB 4D02A 3FAIA 2BTNA 5AHOA 4BP0A 3I11A 1DDKA 4U4LA 2YNWA 3RKJA 1K07A 1X8IA 4JO0A 5LMCA 4RAMA 4GCWA 2Q9UA 3G1PA 3F9OA 1WUPA 4PVTA 3IDZA 1JJTA 3BK1A 4C09A 1Y44A 3ZR9A 1KR3A 4Z67A 5HISA 2FU8A 3ADRA 2P1EA 2FM6A 2YNVA 1X8GA 5KILA 3JXPA 2YNUA 3T3NA 2WRSA 5B3RA 2CBNA 2OHJA 3T9MA 3T3OA 3ZNBA 5ACWA 5FQAA 3AF6A 1DXKA 4UBQA 2I7VA 5AXRA 2FU7A 2YNTA 2BFLA 4TZBA 2BGAA 5B15A 4XWWA 1P9EA 5ACXA 2ZO4A 5LCFA 5HH6A 5HH5A 4J5FA 2YZ3A 4AD9A 3AJ3A 2FU6A 2QEDA 2XF4A 1YCHA 4DILA 4EYFA 5LSCA 5ACRA 3ZQ4A 3BC2A 3P2UA 2NZFA 5IQKA 5K0WA 3RPCA 4XUKA 4NQ5A 2A7MA 2WYLA 5AEBA 1JT1A 2AZ4A 4GYUA 4RL0A 2P97A 3KNRA 5ACTA 2QDSA 4WD6A 5K4NA 3VQZA 4EYBA 1YCGA 3I0VA
chains in the Genus database with same CATH superfamily
1U0GA 1F06A 3PD1A 3URMA 1MW8X 2HMAA 1Z35A 3Q0IA 1VP9A 4NSNA 1GSHA 2OJRA 4FSBA 1MF7A 1S7GA 3SJ7A 2E4ZA 3KB1A 2NVUI 2PK3A 4OYHA 1M83A 1CY1A 5JMWA 1DMRA 5HDQA 4E1BA 1JRLA 2XVZA 5FX2A 4OD0A 3TLGA 3W5VB 1EEXB 2IYNA 4P3NA 2WXMA 1IBCA 3KQLA 2YMMA 3S99A 1L5YA 3L6EA 2Q5OA 4DC9A 2GNAA 2JFPA 1D2HA 4WKNA 4G5RA 2NVBA 5F21A 2WYWA 4PRKA 1V3QE 2PQ0A 3NBAA 2IP1A 4HUQA 4UU7A 2I67A 3NI2A 1KO8A 4X8HA 3AEKA 2C2WA 4CYMA 1YCFA 4E1VA 1SVUA 2ICAA 1KDVA 2XVXA 3HYRA 5K5EA 2XZPA 4E2ZA 4C04A 4JJ8A 2N0SB 4OLHA 1IAQA 5BVHB 1P7WA 1IU9A 3NJRA 3F5SA 4D43A 1NMXA 3PVZA 3X1XA 3W5HA 2A86A 2JRHA 3QTTA 3ED5A 4DZRA 3S8YA 1NC3A 3EVFA 1CJTC 2Y0BA 2YV5A 5EH9A 5IAAA 3PZ7A 5TPZD 3L4BC 8ABPA 5EW0A 4MS4A 3IJRA 2Y68A 2XXAB 1GNTA 3RC7A 4GI2A 4F5WA 1R9JA 5EHXA 3O7MA 3LDFA 5ADVA 4JC8A 4E12A 4KPYA 2ZB7A 3AL3A 2C0QA 1A98A 1QQ6A 1P2BA 4KVFA 5JXVA 2ZJ7A 4MUMA 4R6XA 4EA7A 1RCUA 3TPZA 3UWPA 4BP9A 2RDBC 5CDSA 5AJZA 1UBFA 2Y0DA 1VHQA 4DYVA 2JZNA 1DO8A 3RRYA 1CCWA 5CTRC 1S2IA 1CRLA 5F7XA 8OHMA 2V55B 2SHKA 3WSWA 4M0PA 1LS1A 4MYRA 3NQ41 3C43A 1IBXB 1O6FA 2ODQA 4RYLA 4NYIQ 3V9AA 2NU9A 5FPTA 1N9GA 4WH0A 3R75A 1Y8ZA 1Y4DE 3KC2A 3MCUA 1YQUA 4K6GA 2WY2D 3DDZX 2Z58A 5D3DA 4AY4A 3FILB 4B3TB 3KSZO 4KDIC 3QX7A 1GNUA 4C29A 3FYUC 4IOLA 1XPUA 5LYJF 4RELA 4NONA 3ROQA 2OO5C 4EB8A 2XSZD 2I78A 2ETXA 1W9HA 1V8FA 2RG1A 2HZBA 2XQKA 1Z08A 3GZNA 1RWMA 1ZCAA 1BMDA 2BVCA 1EZZA 5CGQB 2FCNA 4EXYA 1YU6A 4QNRA 3QBVA 4ZI7F 2BTNA 5TEWA 4TTQA 3RABA 4CMIA 4WEOA 5JYEA 1FUIA 3MM4A 1IYFA 1V8DA 3F0TA 1SHKA 3A70A 4FYWA 3AE8B 2G80A 2PGOA 4WV3A 3FX2A 3V6EB 3QENA 1BE6A 4DQ0A 4L23A 3HVZA 1WWTA 2G0TA 1ZUNA 1ENZA 1QFYA 1HV8A 3AI7A 3CF6R 4ZD6A 1JWBB 1VLJA 1YWGO 4P35A 5CT5A 3W1VA 1L6IA 5BWBA 3GCWA 1H85A 2AOWA 2DVMA 4UHFA 1NMZA 4NZLB 5G55A 1DI0A 3CSSA 1NFRA 3T7CA 3UAZA 2ID8A 1UXGA 1U4NA 1OFGA 4XUKA 2QQ0A 4KWHA 1VA5A 1CQIA 2Y8EA 3ZZNA 4AIRA 1PTKA 5EXDA 4K6CA 1WCV1 1OZHA 3TZBA 3ETJA 1P75A 1ZGAA 1E5XA 1R50A 4KXWA 4HGPA 1Q7BA 2NQ2C 4KQGA 1CDDA 3LUDA 4Q37A 2OQRA 3HCPA 1AUVA 1THTA 3FCOA 2EXXA 2AV6A 5IX8A 3EHVA 3P0FA 3L6DA 3SYLA 1H4RA 2JG3A 1RLIA 4DA9A 3AK4A 3AKZA 4O2RA 4EMBA 4ZO2A 2G0AA 1DBWA 4WK4B 3KB2A 1OLXA 5T64A 3RIXA 4I50B 2GD0A 3QARA 5F5LA 2FSPA 1XM8A 1YJIA 1UIMA 1FJHA 3DWGA 1MO3A 1QP7A 1A7AA 2MR6A 1R0SA 4L4UA 1FDRA 3OKAA 3OZRA 1W87A 3GAAA 1HEZE 3ZXUB 2JPDA 3CEMA 5JZBA 3SVLA 3AE6B 4PC3A 1QE3A 3L0ZA 3O5AA 3S1LA 5J2TB 1PFUA 5DHQA 1VM6A 4J2TA 4QEDA 2WF5A 4A6DA 1PYDA 4B3DA 5K3SA 3LC2O 1CQWA 3FZGA 4ZVSA 5ALKA 4BGDA 3P96A 3EQ8A 4UHHA 2GH1A 1GZSA 2ZZKA 3LBIA 4K3UA 1XZPA 3D6TB 2AQ8A 4BGUA 1BQEA 2A9JA 2EWVA 4D96A 3WLKX 1XD3B 3ILSA 4MGIR 3OKCA 1VLVA 4HEA1 5ALFA 4ZANA 2H5LA 4GMDA 2G09A 1YGPA 1PS8A 4M83A 1DP4A 4CM9D 1RAXA 4F3YA 4F4FA 2ZB2A 4GMVA 4GVPA 1JLLB 3LCVB 2WIKA 4PFSA 4GBED 2Y1LA 2WJZB 1XP5A 1KZYC 3BVGA 3MOSA 2IBSA 1EM7A 1RPJA 1SCUA 2W2LD 3BHIA 1QYIA 3AEXA 4JEMA 5C8DA 2NBUA 3I5JC 3LT2A 1XRSB 2QMOA 3ZWCA 5JWOA 1YZYA 2ODNA 3GFBA 5BMOA 3VM6A 2VHTA 4Q3LA 2DULA 2GFJA 2Y5PA 3L7OA 5FD8A 1BEUB 3VNSA 3CSUA 1SZPA 3CT6A 2UVPA 1WZIA 3GAFA 4RY9A 5F1YA 2WKWA 1XZQA 2MA9B 4ND1A 1JR4A 5BN3A 1AK2A 5HMLA 4L5CA 3U26A 4TM8A 8LDHA 5KX5A 2BR5A 4UOZA 3HCRA 3ORHA 4XTCS 3DBIA 2HQ1A 4NZMA 4GOND 3X3HA 1W8DA 4WADA 2F4NA 3A9JB 1GZ3A 1DQYA 1C41A 1WXEA 3UTDA 1DJLA 3D81A 3PDCA 1YJ5A 3AI1A 5HBGA 4KDLB 3UMSA 1DWOA 5KDDA 5ICCA 1M5RA 5IJZA 1L7NA 1M54A 3OF5A 3NJ8A 2YZKA 1NNI1 5B2FA 4AUKA 2WTAA 4D1VA 3MMSA 4ZAWA 1USGA 4RDXA 2CSUA 3F9IA 3S5JA 4WAAA 1JHOA 4FGZA 4IDCA 5BQ5A 4E70A 3O8OA 4ZPJA 2RONA 2O2HA 1C81A 1H3FA 1M0SA 4A5OA 5DI9A 1OI2A 3SFDB 1OXVA 3IDZA 1LPMA 1A96A 4MS1A 3EXG1 4P0PB 4OMCA 2IHYA 1NXOA 1Q21A 3QXJA 4KC0A 4Z3DA 1I4QA 4J75A 2A7QA 4DNOA 3L5KA 2XKBA 1GTG1 2CLMB 3NOBA 5JQGB 1J7KA 2CKMA 2CHVA 4MMYB 5FA5A 2GJ4A 1N2OA 3QAQA 1P62B 4V3BA 2RCYA 1NTOA 3EYWA 5EPOA 2XB8A 2NXCA 3OM0A 2XD9A 2XJ4A 2FEOA 3IEXA 4BEJA 2W6MA 2YXEA 3W1YA 3Q3FA 2HU7A 1S8NA 5DE3A 3L7CA 4ER7A 3CY6A 3UMRA 2PM8A 1R9MA 4EPYA 3TDMA 1P81A 3I34X 2C9MA 1LRLA 4X7RA 4F11A 3IG3A 2WTNA 5KWJA 3R9IA 4LK2A 3GA5A 1TQDA 3AESA 1Z36A 1KYQA 3WP0A 3M83A 2L00B 1KDPA 1G291 2X0RA 4X44A 1F60A 2WMOB 1A9XB 1TCBA 2V7BA 3QITA 3GZ4A 4LF5B 2O3SA 2REXB 4FMPA 4UHCA 3AETA 3VH1A 3AJ8A 5KCZA 2BBOA 3RB8A 4FWTA 1PAUA 4EYSA 4B75A 5TS2A 2ONKA 4HDSA 3RUFA 3BEOA 2DLNA 4F21A 1PLJA 2WWWA 1IJFA 1Z5WA 2C1ZA 1VPWA 3QVJA 3L0BA 2Q2NA 3VVCA 2GBJA 4PIVA 5LQJA 2FLKA 1PVOA 2H4YA 3LQ2A 5DLEA 1WKVA 4KKVA 1ZRSA 1KK3A 1KBOA 3AEEB 3SC6A 4Z5YA 3H8WA 4XARA 3ONNA 1B1AA 1H2AS 2IYSA 5AXBA 1V3TA 3NX4A 2C54A 1NL3A 4G5GA 4FGLA 1XEFA 1PGJA 3DEYX 3TZ6A 2C7QA 3NS8A 2R87A 4TKZA 3PPYA 1YI0A 1TMGE 3CW2A 1TM7E 1XZLA 1QH9A 2B21A 2BKEA 3F7MA 3E2IA 2WEKA 3BG5A 2QMEA 3ZGZA 2Y9PB 3SZ3A 5L40A 3I14A 2AJCA 4GPBA 4C4SA 1DDOA 4L9AA 3ENKA 4AJ2A 1AGPA 1NM5C 3ONVA 3QF4B 4YLGA 3DAFA 3SVTA 2NPTB 3R6TA 3G49A 5JMTA 3FFTA 1JP7A 1V5OA 1CZHA 4GN1A 3SXUA 2M8SA 2QV7A 5CVEA 2WXNA 5DT9A 4B4VA 5DNDA 1G8MA 4RIEA 2B2CA 3NORA 2QJLA 2Y0EA 3HJRA 2I8LA 4PSVA 4EFDA 2J7PD 1YVDA 1Z0ZA 1U4OA 2RI0A 1ORWA 3X23A 5AWFC 1EUDB 5ALPA 2IU6A 4UCWA 3R7WB 3LQFA 1NVEA 3RTBA 3EGOA 1AD2A 1A71A 1PL8A 2G8NA 1H8ED 3L6UA 2PPLA 1U3CA 2YZ7A 4P5DA 5FI0B 2V6GA 4FLMA 3R9KA 3PR2B 4OJKA 5BR1A 1PWYE 4QWWA 1YDWA 4B4WA 1NF9A 2OV2A 3TL3A 2EW1A 1JVSA 1UXIA 1CP2A 5JC8A 4OAPA 3KJGA 4AV7A 4Y67A 3KTFA 4LCBA 3KDAA 4Y9RA 2EFHB 4HPMB 2OLEA 1ZA2A 4EJ6A 3ITNA 3CRMA 1ZC4A 5KYYB 2Z2IA 3K8YA 1WXWA 3UXHA 4H3KB 5CJPA 4M36A 1MNAA 1JU4A 5EY5B 3GFQA 4K6KA 2H7VA 4PTYA 3LHSA 2D1FA 1EM8B 1E0KA 3FPBA 1Y5NA 2YNMD 1IULA 4HH4A 2EKLA 1RM3A 4CMEC 3KT6A 3O74A 1QO9A 4R71A 1QNLA 3H6KA 2OKCA 5SYNA 3C3MA 1L5MA 4N9WA 5F2KA 4DWWA 3K0HA 1VI6A 5CT8A 2H2GA 2VVTA 3PK0A 4FB4A 3L7KA 4EEKA 1HZJA 3IPRA 2CDCA 1FSZA 1ABFA 1YAJA 3I9V1 2CDNA 4UTOA 2YQ4A 1UXHA 3LA8A 4JYZA 3NC4A 3X1YA 2PKQP 1MQAA 3ZE8A 1DARA 3ZZUA 2Z8YA 3QEOA 1RYMA 4RGVA 4BVHA 4RK0A 4Q05A 3EDYA 3H7PA 5CLFA 1X7ZB 3UOGA 1U7PA 5CB0A 2W6QA 1DOXA 5K05A 4RZHA 1Z7GA 3FPKA 3BZWA 4M8MA 1JPJA 3OZGA 4HDMB 2FF5A 3NXSA 3EY9A 2ECFA 3L8MA 4E03A 3DE1X 1TO2E 5AKIA 1LJUA 5EP4A 3ZQJA 1F8FA 3IFSA 4EAAA 1NVXQ 3S1AB 4WJNA 1OLUA 3BCSA 3LCCA 2EV9A 2NZ2A 4IEIA 2G0NA 2XCOA 3KZ1E 4PRLA 2V4UA 1EJ0A 2C5LC 1ZJ6A 3OZXA 1TEXA 4NFHA 1NVID 1U2ZA 4I1IA 5B7PA 3HG7A 3WHLA 4LJSA 2QUAA 4NESA 4RAOA 3GVIA 1U5BB 4LYYA 2B7CA 1OU0A 2EARA 1RLMA 4EFKA 1QPBA 3EQ9A 5ECYA 4GPAA 3N2LA 3N75A 4N01A 3QA8A 2XVYA 3EZYA 1DAIA 3K9NA 1WMHB 1CDZA 1NRIA 4RL2A 3GPIA 3JAMA 3W8DA 2DP4E 3NBQA 1CUYA 5ICEA 1D0VA 2BG8B 1ZGHA 2BH2A 3D7KA 1XROA 3TX6A 1XHFA 2QRNA 4HX9A 1LH0A 4NS4A 5FR1A 4R2IA 4BMYA 1V4BA 1BA2A 2FUCA 4DV2B 5CEEA 4LV8B 1TD9A 3A6DA 4RNAA 5E2IA 3L1VA 5IHXA 4KEPA 2NU6A 4L8VA 5T6BA 2J46A 3ESHA 3DNMA 1DAFA 4BO7A 2BGLA 2ZJ5A 1EHIA 3MBIA 2DKFA 3R3YA 4NBVA 3S0JA 5CDYA 3DNPA 4RXUA 4BLQA 3E05A 5AYAA 1YQ9A 3EFBA 1MG0A 5MGNA 4QPJC 2PMWB 3LL7A 3O4JA 1OXSC 1V71A 3KYBA 2QMZA 1YBFA 2PYIA 2BHSA 3LP6A 2CXQA 4FB5A 2XNJA 1EVLA 2FPXA 3K1TA 1E9VA 4GWLA 4C1DA 3CX3A 2QW1A 1N1GA 3PDUA 2Y3IA 3QW2A 4NL4H 2HXGA 2UZ0A 3PHGA 3KXPA 4WY8A 2ZCUA 3R8BA 4MELA 3WYNA 3RKUA 1KZ6A 1NVKA 2X8JB 2MYPA 1UBRS 2H7YA 2GN6A 3OOYA 5K8UA 4B82A 3IOBA 1VJ1A 2OY0A 2R1VB 4FDMA 3WGYA 4BZWA 1LPOA 5AVYA 1D6SA 1D4ZA 1RKXA 1L7XA 4F3KA 4DFDA 1OF1A 2VDPB 3G82C 2X9GA 5HF5A 3P1MA 3WMWA 3ZWMA 3U4IA 1RAGA 1YFLA 4JYCA 2OAGA 2Q62A 5LZ4A 4WPGA 4U3JA 1FX0A 3JQGA 5C1ZA 1OH6A 2G82A 1Q92A 2EJBA 3OY7A 3LY5A 1DQZA 2ZVPX 1JQ3A 3P27A 4MB0A 4YEDA 3TKLA 1NG9A 1KJTA 2RGBA 4D6XA 3KQUA 2O1WA 4K6MA 2JFNA 4GXBA 4CMCA 3OHMA 3ADPA 3OJLA 3B82A 4HD8A 4D7AA 1A77A 4URFA 1EDDA 3BHNA 4O4LF 1P7ZA 4AG6A 1J6UA 3OZAA 3BZDB 3O4VA 4N6GA 5CA0F 1RJDA 2VDNB 4JWSC 5BOSA 3IOEA 4AJJA 2F43A 5E6PA 3L0YA 4LTMA 4XWYA 3DTNA 2JZZA 1XMJA 4AP4C 4QE3A 4EJSB 3ON5A 2N9PC 2E55A 4N3GA 1CUGA 2YIVX 2GBRA 3DUWA 4RTRA 3UN1A 5A5FA 2F8TA 3P52A 2KXJA 5LP6A 4IDNA 3EIEA 1JEYA 3HKDA 2VJQA 1JDVA 1XHEA 5MGBA 2IV3A 4E5UA 4FBMA 5IKXA 4Z1OA 2X5KO 1WMBA 2ONQA 3MXTA 2UYQA 4HLEA 1ZK1A 1OFFA 3ZG6A 2B1IA 4ZARA 1E3IA 1FMCA 1DJMA 2NACA 4NCHA 3CW8X 2PZBA 4AULA 2ZYWX 4ODIA 2H31A 3G68A 4L51A 5FPPA 4UNPA 4DYHA 4U2DA 1EA7A 4HS9A 1U8TA 2O6VA 4TWIA 2WUFA 1LI7A 1QG0A 4L73A 3T3MB 2VAXA 3GPBA 2BSQA 4JYPA 3UJAA 1UKZA 3OFND 2YFHA 5K0EA 2VXBA 2QG4A 3OX4A 4WL0A 4TWRA 2W42A 4EZJA 5LIRA 3SW3A 1TY0A 2IYUA 2WJJA 4DJFC 4ZAYA 3C6ZA 1EAMA 4QTZA 4C3UA 1WO8A 4M9RA 2Z5GA 2QTLA 4P38A 1YR8A 4KGVA 1I1QB 3H42B 2AA3A 1FFVA 1VHTA 3D8TA 3R7AA 3PO0A 4IXDA 4BWVA 3IUPA 4XKJA 2GBLA 1E99A 4XJTA 2CHZA 2BUBA 3REOA 5I9BA 3IT3A 3A1EA 2IHBA 3HGQA 4HAWA 3THYB 3TOCA 2FMHA 1XA3A 2FW7A 3CF2A 1E18A 4Y2TA 1QZUA 3ZI4A 4K6HA 4FFRA 3IH5A 1K8QA 3H2YA 3FPEA 4WCFC 5C7IO 2BLNA 4K46A 3G2MA 3DKVA 2BG6A 3OLQA 2DAPA 3OQPA 5AP9A 3Q9LA 4JP1A 4TKUB 3HRKA 5KWIA 5ICMA 1NW3A 1W5SA 4XWOA 4EYLA 1W73A 2AJ8A 2EQBA 4EDFA 2BFKA 4EOGA 4FILA 4TT3A 1SHZA 4ZYYA 4RHEA 4IJMA 1HG1A 4LF4B 2VHVA 1U8FO 3WIDA 3WB0A 1KMNA 4WKBA 1W36C 4QYTA 2JS7A 5BNIA 4JP8A 5EMNA 3ERCA 3BVPA 1QH3A 2ZWIA 1FRNA 2Q0SA 2FSVC 2R4TA 1E1QD 1Q44A 1S3SG 1JALA 3A4MA 3DAGA 4LFAB 4J94A 3BM5A 2QRQA 3M81A 3GO4A 5GM2A 3UGTA 4DJ5X 1C7IA 1Q91A 4N9QA 1SQSA 3KSDO 4OXXA 2O0LA 3DMTC 3OC6A 3FCYA 3SKXA 1N60A 2BWFA 1AGXA 4ZRJA 4BOZB 4PX2A 2R68A 5FR3A 2DERA 4FKZA 2KJQA 1TYAE 4C7ZA 3RYIB 5JJBA 4RMNA 1MHHE 4F4UA 3L8YA 4YRGA 1GZ5A 5JMOA 3GCGA 4N8DA 1W30A 5JW6A 3PNQA 5MDHA 3A9CA 3SIWA 3CZMA 4B33A 4F0JA 3MGAA 4EFNA 4K26A 4G1UC 1YBVA 4UARA 4W7HA 1GT91 4S2UA 4DK5A 5HKLA 3TLYA 1HQYE 3SHFA 3KB8A 4FINA 4QQFA 3V3KA 1AO0A 1L7DA 1OTRB 5I9NA 3PLAE 2XCSB 4V39A 1I3NA 5L9AA 2FPPA 3QXSA 3R2JA 2QPOA 1VJKA 1I7PA 1PYGA 5IP4D 1FFXA 1FFCA 2QPTA 3JQ8B 3WK5A 1KI6A 2HDEA 1PHPA 5ES3A 1SPXA 4ALNA 1X9HA 3SSNA 2IY9A 1Y4SA 4B0EA 4MVCA 1QFJA 2WAXA 3AKCA 3MILA 3G6KA 4DR1B 1RLUA 4OTZA 1QQBA 1K7CA 3TEMA 2EIHA 3OPYI 4N6OA 2FPOA 2QB5A 4E3ZA 4URVR 1PL0A 4XGNA 2QUHA 2Q3LA 3FETA 3LWBA 4ZHQF 4Z4EA 2M17A 3UFXA 2IUYA 1OAKA 1AXEA 3W6UA 4PLCA 4IIJF 3VC7A 2H1LA 4H7HA 1YI8A 1VJ0A 4ANVA 4ZO6A 3ZNZB 2HMTA 3SEQA 3RLFA 3W5JA 3H9BA 4Z0TA 5CX1A 1JW9D 3KSUA 2NU7B 1M34B 3ZIUA 1R5NA 3H9EO 1UBCA 2MSKA 2ZEQA 2B4KA 2GK4A 3NNNA 4C7VA 1KEKA 3ASYA 3F9CA 2NSHA 4M60A 4I3GA 5C0OE 4XD7A 4G0NB 3ML1A 2AZ4A 4GYUA 3NVZA 5J40A 5KOIA 5AT1A 5EKXA 4PGFA 1NSFA 3IBCA 1XV5A 3THOA 3SYMA 2JAUA 4WUTA 4KGXA 2WSSA 4EYOA 3ZKWB 3BRWA 2O07A 4I6LB 4NV1A 2BE7A 4FBGA 5CB4F 4C43A 2EL9A 3GE8C 1I4WA 1JIQA 4WN9B 2CV2A 2XAUA 3DLCA 4MSMB 1KO7A 1CZLA 4ER3A 2O6LA 4J3OD 4BNDB 3DVNU 2WTMA 1OTYA 1RRFA 4YUVA 1TB4A 1B0AA 5ELXA 2D74A 5HPYB 4DKXA 4DG9A 2WLBA 1DDGA 1II0A 3P0EA 1BHJA 3PR3A 4HN2A 2XW6A 4A6QA 3JAWB 4GMFA 2DWOA 3X2EA 5JNSA 1ZH0A 5H8YE 1M1XB 1HYBA 3K5IA 1CUAA 2EHJA 2I33A 1DG3A 5BMVB 1UZMA 5AOVA 2BR3A 4EI7A 2W98A 4B3JA 5KYWA 2X8LA 3ZHUA 3RC8A 3DP9A 3LDUA 2GCUA 4FYVA 4RKEA 5A4IS 1HQKA 3GGCA 1EFRA 4KMOA 3REQA 1HTWA 3L7LA 3SNKA 3E35A 4U7HA 4EI2A 3CE9A 2D00A 4CDMA 1VBFA 3QIVA 2A4KA 3DZHA 1XQWA 5ITZB 1ZJ5A 2DTEA 3RIMA 5J17A 4ZIRB 3OC0A 2HFJA 5HQTA 1MEOA 3M4NA 1KSFX 3WGGA 2JIOA 4JL9A 3PEYA 2VH5R 3C3EA 3E82A 1UBOS 3IIEA 5LNK6 2QQFA 5IYZF 4JBNA 3I3TB 2GR9A 1E1RD 2AOUA 2RPQA 4WCDA 3DFIA 3B5IA 5E6NA 3IEIA 1ZW7A 2WDRB 1U0EA 5AW3A 1IIRA 3DBHB 2CXTA 3IALA 1MT0A 1GU7A 2EBUA 3RKRA 1BW9A 6ABPA 1I2CA 4KGDA 4V0LA 3VNUA 1T9HA 3T9CA 2ZKIA 5HJ5A 4ANXA 4Q4HB 1KTKA 1EWRA 3L8CA 1SMLA 4QYMA 4ACBA 2WPDA 1NR1A 3HFJA 4C07A 1F2UB 4RSRA 1PSZA 2N75A 2RHGB 1J19A 3HJNA 3ZJUA 5CPFA 3RYHB 4FXCA 5JYBA 1UP4A 1WHTA 1B6GA 5AW4A 5DPTA 1ZNBA 2IYWA 2WF8A 1Z6XA 1OQAA 2AZTA 4ARCA 3GLKA 4TZKA 3CWCA 4Z2AA 2CD9A 4KYUA 4L4YA 3GBSA 4L2YA 3WGOA 4J9UE 4RTMA 3KKEA 3EWAA 4K5QA 4CFSA 3KAKA 4MOWA 4LBWA 4H3HB 4QDTA 4JB8A 3IVFA 2GETA 1C9DB 4OP2A 3B3GA 1TFUA 4NTZA 1K07A 4MO2A 3N5KA 2XH8A 1D0IA 1HQDA 3EGDB 3U3MA 5EIBD 2UXBB 4TQGA 3LYHA 1O94C 2GKOA 3SOPA 4Z67A 4AWXA 5HF9A 2OHGA 5TEVA 3T3DA 3W2IA 3A10A 2V7PA 3G2NA 5G41A 4GS5A 4LKRA 2QAGA 4NDZA 1SXJB 1BU8A 5A04A 2E4UA 2BTOA 5ERGB 3DMRA 3EC8A 3PTFC 1WJ6A 4G0ZA 3IHTA 3AFOA 3ESAA 3RSCA 2WSSD 3DT9A 4H6PA 2OXCA 3C5WP 4R83A 3KYJB 5DXJA 4IINA 3L54A 1GPUA 2IYAA 3W90A 3ZXXA 5LOVB 5LMNB 1OH5A 4IW0A 1AZWA 4NDNE 1FS6A 1DX6A 3EZ2A 4K7JA 1N2IA 5FULA 1M2HA 1FCJA 2R62A 2FZ4A 3CE6A 3IAS6 3SR6A 3M5DA 3BD8A 2A9QA 1FFBA 1E2PA 4ZYLA 1OEYA 4BFUA 3ZQKA 1ELOA 1CIPA 1P17A 5TJ9A 5I9MA 4OBBA 1IWBB 2QYOA 4V0NA 5BPHA 5AMXA 1DXQA 1P8AA 2VTVA 1WHSB 4FNMA 1PBTA 1PK8A 2XUIA 3BF8A 1CIVA 4AO6A 3G7UA 3MCTA 3AH8A 3RFCA 4Q9KA 1G3RA 5CMLA 2FG5A 1V1RB 1VI2A 2ZGVA 3HTXA 2VRCD 3KHKA 5KNCH 3FCAA 5KOHB 1WRDB 2NYRA 2B0JA 1DBSA 4OQMA 4XX1A 1KFJB 3P2KA 3EXHA 2O9JA 3C6MA 1XDWA 1NJ1A 3EVEA 1VE9A 3M2PA 3SD5A 1W1UA 2BEKA 4EF6A 1QQRA 2XYRA 4BNFA 1BD4A 2BFAA 3BK7A 3NO4A 5EWJB 2V6FA 1V16A 2LCQA 1C0LA 3PUKA 2FX5A 1P80A 4F3TA 2OBLA 1H0KA 4NBNA 4W99A 3G0IA 3Q87B 4DJDC 1V5TA 3OJXA 4OQZA 2XGOA 4FLFA 4F6CA 5A5DA 3ZRFA 1SEVA 1PT7A 4XVQA 3PGKA 4UAUA 4BNMA 4XW2A 2DG2A 5IJAA 1OBVA 3AEGB 2IV2X 5BYQA 2QU8A 4RCYA 1ORHA 3H5TA 5AKGA 4GR9A 4PXAA 3ZW3A 4JX8A 3PZRA 4PYQA 4KQEA 3TEJA 2AFHA 3ZV6A 2FP4A 2BKUA 5BR4A 4JXXA 4MP3A 4POOA 1AMUA 2BJVA 5LLSA 1ZXXA 4ZEWA 5AI5A 3X44A 1XLOA 2NO6A 4AXHA 5FWXA 2GM9A 3FYUB 2C61A 2FPSA 3GY0A 3PT2B 3NYQA 1FDUA 2AYOB 3RD2A 3RBAA 1I10A 4FR2A 1GXSB 3NT5A 4EKGA 4K81B 1XNJA 4XSHA 1UUPA 3I9LA 3LYLA 2VPYA 3C6KA 5EZYF 4GX2A 2JLXA 2WDPA 4KDCA 1Z6AA 1QG6A 4GKAA 3EVNA 4KR2A 5CLLA 2I3BA 3S5UA 2DLCX 2ZREA 5JG7A 3S55A 1U7OA 5FWNA 3PZ8A 2O5CA 1V96A 5EG5A 4L8LA 4OX9B 2LPMA 3DOFA 3LVRE 1Y6GA 3U3OA 5GONB 4D3DA 4HMPA 5TV2A 5HKAA 4OFXA 1XTOA 4EVRA 4WLVA 5DO9A 3KUDB 3PFIA 3MOIA 3FVRA 5B1YA 2M5CA 2RPVA 5JCJD 5KB3A 4PVDA 1OFHA 3QV1A 2P6MA 2NYAA 3SM9A 1PFDA 2NNWB 4MQFB 1BDHA 3UZUA 2AL6A 1PG5A 2PGNA 2OP1A 5IC6A 1J8FA 2PMBA 1NY6A 1FS5A 3EXFA 4FEAA 1PQWA 4N03A 2BEUA 2ZJYA 1BFDA 2NZVG 4A2WA 2W6CX 4LQCA 3EOBI 1P2TA 1BGXT 4OQPA 3PSEB 2Q6KA 1VE6A 5IN4A 9GPBA 1W75A 3AM5A 3U5TA 2UYZB 1G59A 4N65A 3BXOA 2XZTA 1OTHA 3VMFA 1PK7A 2XWSA 3A2KA 4OM7A 3WALA 1TKEA 5B15A 4MUHA 2I7CA 1XFDA 3AQ4A 2ZO4A 3E18A 2X5NA 1IFXA 1RWKA 2JLQA 2C84A 5IG2A 1TKRA 1U1DA 3KVYA 1NBIA 3LXXA 3LL4A 3TK1A 4CW7A 2D7CA 1IYZA 4QVIA 4AC9A 1N5OX 1WCYA 4K9PA 2X7JA 1GUAA 3KKMA 3BT7A 4RL0A 4TV9F 3HEAA 1EEHA 1Y5RA 2WIBA 2VT7A 4NFLA 1SRRA 3KDPA 3GJTA 3U44A 1O57A 1KDRA 3TKAA 3FYDA 4BZ3A 2LFIA 5F4BA 3DUFB 3UT5A 1H1TA 1V97A 2IO0B 1KDOA 2V7XA 4BTLA 2C20A 4JLSA 5D51S 3ROTA 3KLSX 1H1LB 1YBAA 3K2QA 3CVOA 1ZOSA 2HRBA 2XA2A 4NARA 4LSWA 1V5GA 3OCYA 4GWGA 3V2IA 1R8SA 5CTAA 4G89A 5JR3A 1J0EA 3MCWA 2D8MA 4NHOA 2HF9A 2FMFA 4B87A 4KK4A 4XX0A 5E7QA 1SA0B 1TS2A 5HRCA 2VUTA 1WJNA 5EQJB 4RIHA 1BCSA 3O03A 2RIRA 3GGGA 4NYIR 1BX1A 3G2JA 3PXAA 2VAWA 3NHWA 4Q21A 4N6EB 3TBFA 1C0KA 3M6FA 2ZPTX 2EGUA 2CUTA 4BMOB 5T4FA 2A9RA 1D5MC 4BL5A 2E4VA 5JNRA 1PW5A 1Y8QA 2V3NA 4FEGA 1EDBA 3QKIA 5EJGA 1QUEA 2CEKA 4OKIA 2DYMA 1JWSD 1Z5OA 3C8UA 5EXXA 4O4IA 2ZDGA 3K6SA 4YUXA 3ZHCA 4KGSA 2CXUA 5AXOA 1G17A 3NBMA 4BBNC 4HMQA 2LZ0A 3TNLA 4YASA 2YUTA 4DV5B 1DOAA 1LTKA 1LQ2A 2Z2JA 3T9LA 5DLYA 4KACA 2W54A 4Z5ZA 3NAGA 5DOZA 4FIDA 1D3AA 3R24A 5AKZA 3U4HA 1MB2A 1KWGA 3DZCA 2P40A 3NJTA 3NY5A 3CGWA 4OCZA 5DMHA 2ZW9A 1U0TA 4JLJA 1OT3A 2AOVA 1CLUA 5A7FA 3N7TA 4GX5A 4Z8YA 4Z6XA 1GVNB 2WLSA 1J49A 2Q3JA 4ZEXA 3PIRA 4P3OA 2VDJA 1IBLB 4EG6A 4LHXA 3P2BA 1LDBA 3HXMA 5FWAA 1SOMA 1M34E 2Z6AA 3TTSA 1RQRA 1L4ZB 2XQFA 4ATNA 1GILA 4FCTA 3ETLA 3URKA 5F4ZA 2ZR0A 2D1RA 3QWHA 5J47A 3FVWA 4PLZA 1N5JA 2CMKA 2J59A 5KTSA 4YTNB 5FAXA 2NTVA 1V1PB 5FB3A 1NP3A 4YXDB 1IQPA 3R2UA 4MULA 4F5EA 4AYXA 1JQDA 1RWXA 2RDGA 1R6VA 2ZEJA 2JI6A 4I55A 5ACQA 1EZ1A 3IOFA 2IXDA 2I34A 2PKQO 4HP8A 2CE2X 1TYZA 2YW2A 4B3HA 4HV4A 2AUNA 3GLHA 4X6YA 3UJ7A 2XEDA 2UVQA 4KN6A 1UKBA 4KQFA 2Q27A 1HMPA 1ICEA 3B51X 4TTIA 2VXOA 3VR5H 1Y42X 4MRVA 1TW3A 4DIUA 1QFSA 1I2AA 3B85A 5EHQA 5JH5C 2XB4A 2V58A 3DKIA 1YA8A 4MUBA 3JPWA 1AK1A 1RMYA 4R8MA 5HS6A 3JAKA 2BUCA 4OFBA 3K94A 1GV1A 1EGHA 3KAPA 2MMCA 2NMQA 1PR1A 4QT4A 2C2GA 2ZXUA 1K4YA 4RVDA 1VCOA 3OT1A 4UCXA 4G4SO 2PLPA 4CF7A 3B2GA 2XQJA 3DW1X 2KX3A 3N20C 5JY6A 4FR5A 3H99A 3C1OA 2VA9A 5T57A 5HH6A 4XQCA 5THXA 1UM9A 2IO3B 4B6QA 2PLFA 1Z62A 1RFAA 2FG6C 3EFHA 1MC4A 2O23A 2XLCA 1KQPA 2QRPA 1TX4B 5ACRA 4PO3X 4JLNA 1YS4A 2PSDA 4QQRA 4IV8A 2AVDA 2Q5JA 4ZAVA 4YRQA 4Q7MB 1Q2XA 2Q3HA 1MQ8B 2L0TA 2MBBB 4MEBA 4BIMA 4X62B 4AM8A 4KBYA 5FR6A 1X13A 1KZ7B 4Y0NA 3A6HA 4GH5A 3CMMB 4JVLA 2VAMA 5A9TA 3EEBA 2P9YA 3GT0A 4J0GA 1JDUA 3PLNA 3RT9A 3P9QA 1T35A 3E9RA 3LV8A 2ZM6B 4P58A 4LJ9A 1IN5A 3O75A 1FQWA 1XYGA 2J33A 3BYTB 5EP2A 4J91A 1RI5A 1BGWA 2NIPA 3OF2A 4EUSA 1E94E 1Z4MA 1WAMA 1J1UA 1S9HA 2EJCA 3DO8A 4UTZA 2DSNA 5LA6F 1Z2PX 4F96A 4NU5A 4W9KA 3JWIA 3OA2A 4C0SA 4CV3A 1JTEA 3VV2A 6REQB 3IR7A 2Z0MA 3VHXB 2FW8A 3GCZA 1UWCA 2OK7A 4RH1A 4BNWA 1BQ4A 5CA1B 1JE1A 1AX9A 3T1HB 4E2XA 3K70C 3NAZA 1ZVKA 2J09A 4DXGA 3HXLA 4DDTA 3KOUA 1TT5B 4W5NA 5F9FA 2ID7A 5LZ9A 1YKSA 4KSCA 1Q6ZA 4F60A 3RS5A 4CI0B 5FLKA 2ET6A 5AVJA 5A4JA 3W04A 3A3KA 1TKYA 2XUQA 4JJGA 4R0MA 4N47A 1YMUA 2FWIA 1L5PA 5DGDA 1V5WA 1X1RA 3T5DA 3T0FA 3N2NA 4MI1A 1Z2AA 3BJEA 4HCPB 4LCJA 3ZBQA 3VDMA 2WP8J 3RNLA 4UMVA 1QCCA 4DCMA 5EYPB 5BY2A 4H60A 2INPE 4NATA 1TIPA 3WGQA 3ABRB 4HDQA 5DCWA 4QDJA 4HJKA 2J4DA 1TVKA 1A5TA 2AXNA 1KPGA 2IWRA 4WXEA 1XYYA 2KYWA 1JV2B 1SE3A 4HWIB 3LO8A 4NQ6A 2QX6A 3WYFA 3P0JA 3U9TA 2QN9A 2XDYA 3OETA 5CUQA 1N25A 1NYLA 5ARCA 1I4LD 3KAQA 1YMVA 1SXJE 4WDQA 2X0KA 4FI3F 5LS3A 3ADDA 2Y5CA 1UBJS 2W2KB 1JPUA 4D5EA 3UI3A 4AY2A 1HLKA 1M2KA 3QKRB 3GP3A 5DPXA 2AN1A 4JXZA 1C9EA 2IYXA 2ZRMA 1DKOA 4PWZA 2QR5A 4V24A 2H1CA 5G0UA 2KJ6A 4YHHB 2YIDA 2E1RA 4CHLA 2HCBA 3R44A 1ECBA 4YRCA 3BMXA 5M3BA 2PHZA 4NCJA 1IUPA 3O93A 3HYTA 5EC8A 4JGIA 4AK9A 5HVNA 4NYMQ 3KPUA 1Z07A 4UULA 1XXHE 4G67A 3R77A 3OT5A 4RS3A 1CC1S 2I76A 5JHAA 1IZ0A 3B8HA 4WY2A 5E1BA 3ZD9A 4AW9A 2WP9B 4ZO3A 3DFUA 3TN7A 2BV3A 2RSLA 2X41A 4FZ5A 4WTOA 4K3CA 3MJWA 5KOJA 3H04A 4WEQA 2V0NA 5C1DA 1XMOB 7ADHA 3MUNA 3Q2OA 3TG2A 1UM8A 1AHNA 1S1MA 5AD1A 2OZVA 3KQPA 4INJA 5AUIA 4M02A 4CM6A 4BZZA 5BORA 2OCKA 3F9OA 3HU5A 4W5OA 4FMDB 5CVVA 3DA8A 3EDQA 5DIZA 1QH1A 1WJ4A 1OXMA 2NO4A 2FM6A 1M2OB 3NBKA 4P83A 2YASA 1KBQA 3KKLA 1KLVA 7REQB 1DMSA 4WNAB 5BVGB 4CMHA 1XZDA 1W94A 1WW2A 1WX8A 1UZLA 4AMUA 2ZYDA 1TM1E 3F7OA 4F93B 4UJ5A 2A1TS 4KQKA 5LQDA 1FDTA 1Y5MA 4UMDA 2TMGA 1G60A 4PYUA 2FU7A 1E9FA 2RBGA 1FDSA 4GLBA 1C3TA 2I1QA 3ELYA 2ZTUA 4JUIA 4CTKA 4YCAA 4EY7A 1E8NA 1EG2A 3I6ZA 1XMPA 2ZPYA 4CTJA 1L7OA 1ZBDA 5K3OA 2R6ZA 5KTTA 3ZHOA 2DOKA 3OMWA 4FSDA 2ZETA 2QZ9A 1QH8A 4I4IA 5HR5A 3ZU5A 4Y1RB 3KU4A 4K7UA 2N7DA 1L8XA 2NW6A 4FR0A 1GRQA 2YUIA 2R48A 1N6RA 2QTVA 5AK4A 1RQ7A 5AVTA 1EJBA 5HKKA 3BGWA 1ZICA 1WG8A 2GCGA 3B2FA 4ZHOA 4H7FA 4QYSA 1KLUD 3Q88A 2IYFA 4DC0A 4PZYA 3ESQA 4NG4A 4KG7A 1TGYA 4PZDA 2AXPA 2WU5B 3G3EA 4DF3A 3FSRA 5T4EA 3APFA 3V4LA 1VGVA 3LDGA 3EK2A 4G56A 4CKBB 3Q8BA 1F0PA 5E4JA 2Q0XA 1MVOA 1MZPA 2AJDA 1ECLA 3M3HA 3Q2KA 4GPZA 1FJ2A 3GLIB 1LEHA 3W6NA 4EECA 1LTQA 3E53A 3HRHA 4V38A 3BMCB 4NVRA 4YRLA 1TCCA 1SIJA 3JV7A 3SE0A 3LD9A 4TMVA 1DXHA 5BW5A 1RIIA 1FXAA 2MP2B 1BMFA 4LDRA 2C9CA 3BCRA 4ZA2A 2WX1A 3RNBC 1DADA 2GPJA 3NANA 3WGUA 2XUAA 2DUWA 3MELA 2B4TO 4KTVE 4Q9AA 1UXKA 1V2YA 2I4MA 4BO8A 1R0LA 3PA8A 5COBA 3AT1A 3U3XA 1QORA 1J5XA 1M74A 3DOIA 3K73O 4W6ZA 5GJWC 5K2OA 4UW9A 4X41A 1BIFA 1GHTA 4Q7QA 2H4JA 1IUNA 1JKJB 1U6JA 4TV3A 3QPAA 4W4TA 3S0ZA 3OZUA 5GV8A 3V9PA 1ANKA 1EK2A 1X1EA 3RVLA 3LX4A 3I3SR 2I6TA 1ZKMA 3O38A 1WXHA 4FSHA 3A1VA 2ON6A 1W93A 2OEPA 4EHHA 1NWCA 2NGRA 5GWXA 2ZR8A 3ULKA 6AT1A 2QT1A 3SPUA 4Q6WA 3PQ5A 3BWCA 4HQ6A 2NVUA 2FRVA 1G3UA 1J2RA 1B74A 1E4OA 1O9GA 4PGHA 2YZ2A 5L3QA 3GRZA 3OO1A 1ZTCA 4MH0R 4OK3A 2DYBA 3OQIB 2IVFA 4JOBA 2A8YA 1SUWA 3V2GA 2CHQA 4DA7A 5FF9A 5KTYA 4LEIA 3ZDCA 1UFRA 4YPVA 1NXSA 5FBVB 1K2WA 3GRAA 5JSQA 1WGKA 2CUNA 5INTA 5EUBA 3TJZA 4LLGM 4XPIA 2IHTA 1WKBA 3FD8A 4RJIA 3DH8A 3ZCSA 4KLRA 3MN1A 3EVDA 3M1IA 1ZCFA 4NMHA 1QV6A 2JB9A 1N5KA 3EY4A 3T35A 4RFSA 3G2LA 2F55A 2DWQA 4QUHA 3AG6A 3LLVA 3IAAA 1XE3A 1JHRA 1EBBA 1SC3A 3Q7TA 1PUJA 5TQ0A 1BN7A 1IGDA 5DTJA 2FE8A 1WLYA 1RRKA 1MP0A 1QKZA 4F56A 3CWQA 4Q4JA 3VYRB 3THWA 4Q66C 1NBFC 1B42A 1HOXA 3G1TA 4HNTA 2QL7A 5DGXA 4F45A 1A1SA 4TLCA 2WX0A 3SS9X 2G4DB 1Z5UA 2QQGA 2WDZA 5HK9A 2OQIA 2Q9BA 1G7SA 2DU8A 2WM3A 1LSOA 4HQOA 2R8XA 1Z2MA 1XT9B 2MWSB 3WRWA 3J9CA 1T2CA 4C7KA 4LRYA 1KE2A 1REQA 4LQLA 4IKGA 1AWDA 1N6HA 3HNRA 1R10A 1QO0A 3DBRI 1N7JA 1NR5A 2XCTB 3WDMA 1JROA 1WZUA 3FWPA 5HOEA 4U7GA 3G5TA 3ROEA 1DKRA 2AEJA 2YHUA 1E1CB 2X22A 4UUAA 2E6XA 1I9CA 1KP3A 1L5QA 1K92A 1T0PA 3D3WB 3HK0A 2FN8A 3ACDA 2NSDA 1H4SA 2GOWA 3EF1A 5HKKD 3GQVA 4O2BB 1NKSA 1E3WA 1KMMA 3JSAA 1GUFA 2YY6A 2GM3A 4MWOA 1BJRE 4OB6A 1KS2A 3BJZA 3NHFA 4B6WA 2QTCA 4FFOA 3WGNA 3OX3A 4AYTA 2X2PA 4CKYA 3QXXA 2A3NA 4M1SA 3VPHA 3DM5A 3H5OA 4QQNA 3TOVA 2KC2A 2PZFA 3LYUA 5EMKA 2GZMA 4MYDA 4KUGA 2O8CA 2NSJA 3VPXA 3LMKA 3W7BA 3KNRA 4D9KA 3HO8A 3KVVA 2V6MA 4JKOA 4DJEC 4ZDIA 3UK1A 3IQWA 4ZRPA 3MCZA 2FZGA 2HPHA 1Y8RB 3JALB 3I04M 5FV7A 2X4GA 4MVJE 2HBZA 2ERYA 4ZJZA 3T15A 3NAQA 4RE6A 5B58C 5ITVA 3IAM1 1K52A 1C1HA 1P6UA 2R11A 5JS6A 3L1JA 3TQCA 2EELA 3CG0A 3RWMB 4WCFB 3MPUA 3Q4GA 3HBFA 3DL0A 4XQGA 2PZGA 1OXUA 3MC9A 4YCMA 3FCUB 3A2LA 1IUKA 3FWNA 2FUG1 4IG9A 3R1IA 1NV9A 1PJ4A 2AOTA 2CZQA 3T7DA 2CT8A 4AAYA 1O6BA 5C81A 1P9DU 2OM2A 4PSAA 2UYHA 2OCAA 2R44A 4W9GA 4G1MB 1RABA 1P1KA 2F9FA 2IO2B 5CBPA 2DFKB 1OMOA 3WNQA 1WU7A 2LXCA 1LDEA 4OQQA 4JBIA 2W37A 2N9EB 3DEAA 3K09C 1W36B 5LCXA 4U5QA 1O4WA 2AL7A 2O8BA 3WZMA 2XKAA 1GG2A 1XZFA 3NKLA 2NZYA 3L7NA 4D8YA 2ZQ5A 2WK1A 3EA5A 4HZIA 4AY3A 4JI5B 5JADA 1AT1A 5LB4A 1NU8A 2GARA 1NN1A 5A5VA 4DBLC 2H54A 2Y1EA 1TZ1A 2YOGA 2XUHA 4BWGA 2R6FA 1D6NA 4EY6A 3ZHZA 5JIBA 1N78A 1T3SA 2X0NA 4R1UA 3PC6A 5HKHA 1I42A 2ZTVA 2QRLA 3FRIA 1TEVA 4BXOB 4A6XA 5I4IA 2R00A 3ND9A 4UAMA 1DO2A 5JISA 4BKOA 3L7AA 2IXEA 1MX5A 3RG2A 3CZPA 1NMEA 3KELA 2W3SA 5JARA 3I6IA 2Q3MA 5JSHA 1E79A 4F6HA 2O05A 2E4XA 5CBKA 3BTVA 4ZGWA 3A6GA 4IFEA 3VAWA 5LLDA 3VQIA 3HCWA 4R8SA 1SO8A 5DHUA 3SIPA 2CLFB 2NXJA 1HTTA 5CW1A 3PC4A 2QMQA 1WF3A 2AYYA 3N2IA 3GJXC 3NGXA 3RRZA 3B13B 3JQEA 1RRPA 1QHSA 3KSAC 3WCQA 4P1BC 4NJEB 3NVMB 5EZQA 1L4MA 3LW7A 3TZLA 5A7HA 1MABA 4Q02A 4DYDA 5BQFA 4HUTA 1J39A 1F2RI 2V3WA 5I6DA 4DADA 2I9KA 3EG5A 2D4AA 3E0QA 1ATIA 4RNCA 4I1YA 1H65A 5JLAA 2P0YA 3UY4A 1E9RA 3I62A 4WFQA 1QO0D 4ZEJA 3R8CA 3AMVA 2BFDA 1SUIA 4RK5A 3OOWA 4P3PA 1II9A 2OQVA 2E4AA 1PQYA 4BKSA 1N57A 1W0KA 3QKWA 4ER5A 2E5FA 2O0KA 1AA9A 4C7MA 2R8OA 1DXOA 1YOVA 3NEYA 1V86A 3K71B 2I71A 1VLMA 2WKRA 5HOQA 3ANMA 1NPDA 1J1ZA 2LJIA 3MTIA 1VJTA 1N8KA 2G40A 2VPQA 4HBGA 1LF5A 1ISPA 2JAQA 3S1SA 3WAGA 3PRZA 4EEWA 5KQPA 5FBKA 1Q50A 3A6KA 1Z8NA 2JBAB 2WF6A 4GFDA 4GP7A 1G3QA 1ACJA 3NRJA 5H80A 4IOJA 1R18A 1X9GA 4R1OA 1KP9A 1QFXA 3HDYA 4ZQIA 4JBGA 3QHQA 3PC3A 4PS3A 2BHTA 1QCDA 4MVJH 4YMGA 5JATA 3AE5B 3B36A 1KPIA 4JI6B 3UC9A 1UH6A 3F7TA 1EIWA 3MRSA 3EG9B 3MD9A 4PT5A 1B8PA 1U31A 3LQ4A 1ZDVA 1TDJA 4UBNA 3RS7A 4DXAB 3HU2A 1Z0DA 1CE8B 3SN6A 4HLDA 4WHMA 4M3NA 1O96B 2PEAA 1U0BB 2D0IA 3AB3A 5CHVC 5IAKA 5KINB 2ZAYA 4X61A 3GJ3A 1P0RA 3LBNA 1QX3A 2R751 3K6JA 2JGFA 1ZK0A 3K15A 3TVYA 1ENYA 3GRCA 4CTMA 1N2CB 2G4VA 1HLDA 4P3KA 4UJ3A 2NPFA 2O2VB 3D7NA 3JD4A 5K6AA 3BL6A 2B3AA 1ENOA 3HL0A 1BX0A 5E6UB 3GFOA 1OBFO 5IDXA 3ADKA 2AR0A 2JAPA 4DRYA 4I6EA 4MGZR 4NBRA 5DF1A 4CN8A 4O2AF 1BXKA 3JCZA 3AZQA 3P94A 1NEKB 1UBMS 3FVQA 3VVWB 4LNFA 4R1SA 4IUCS 5PGMA 3MJ5A 3GJ5A 2I3GA 3RC1A 3G0GA 3AIOA 1SVLA 3CN7A 1KI2A 4AQ7A 4MGYR 4IHJA 2P9FA 1NOKA 2BOVA 4C7OB 5ACSA 1JYFA 4OVKA 4EABA 3L3BA 3JQBC 3IVRA 4N1AA 2J32A 1EK0A 4R1PA 4DIOA 4N7BA 1MX3A 1W2GA 1LDNA 1MB4A 3EXG2 3IHKA 2KC1A 2ZANA 1GB1A 3HRDD 3G8YA 2QM8A 1QTQA 2JCBA 3PXUA 2WXHA 1FW6A 4UXIA 2BJHA 1R4MB 2AQ2B 2LJ5A 4ZHSA 3HCCA 1EUCA 4WOPA 4PNZA 4Q7EA 4V1CI 5E6SA 3EJWA 4D9IA 4X45A 2AI2A 2HF2A 1TJPB 3UHAA 4JH0A 1OPRA 2WG0A 1STEA 3KUKA 3WTCA 2XV1A 1BWPA 1Q1NA 4LECA 4DUGA 4YAGA 3ROZA 3RTGA 2PRYA 1JG1A 2V4ZA 4NNJB 4LSMA 4KZPA 5K4GA 4XFKA 4E3CA 2ECQA 5H3LA 3HUEA 2FU5C 3T95A 1Z9BA 1S4MA 4Z7OB 2CDBA 3C16C 4RLSA 1FFGA 1DTWB 1RRVA 4ETWA 1H2BA 3KWVA 2RKBA 2OILA 3LY7A 5JDCC 4J1NA 1E2IA 2FH5B 2Q5CA 4AMVA 2O6VD 2EX0A 1T9BA 4ZU1X 5B5SA 4HTFA 5HUQA 4IDEA 4Y7DA 4PCUA 4XWKA 3A1UA 5EJIA 3A4TA 3RHZA 1PR9A 1TBEA 2BT4A 1FFWA 1UBGA 1ZP0B 1GGFA 1I1NA 3I15A 3AY0A 1LXCA 4YUZA 3MLEA 4MQUA 3UK6A 1C9YA 4WLOA 3VDXA 2G25A 3TGWA 4D1YA 1PF7E 1VIYA 1K8ZB 1CB7A 4W5WA 2GNOA 2PL3A 4X91A 2FE4A 1KI9A 4FEKA 3NWOA 2A1UB 5D1NA 2FN9A 3UGKA 2JX5A 2WMNB 4DNFA 3DJFA 1GRVA 4PQYA 1FBNA 4KFCA 5C34B 2QVXX 4HFJA 1XNGA 4E15A 4RYDA 3QKUA 3PLRA 1JXQA 1F51E 1E9AA 3ZW8A 2E89A 1USVA 3H7AA 3OH8A 4XIGS 1YC5A 2WE7A 2VHYA 1C1XA 1E96A 3DBLB 1Z38A 3Q3MC 4D41A 4D79A 3AEAB 4XDGA 3P4RB 4Y2GA 4QJ4A 2YLMA 2Y4OA 3DB2A 4QGAA 1NXTA 4BAXA 3EXAA 1RHRA 1SU6A 3GBPA 1EWQA 3ZYZA 2BGJA 4HAIA 5M2QA 2HA2A 1E61A 3ZNBA 2JAXA 3STVA 3QHAA 1QK3A 1JLSA 4TT3D 3O73A 4N5DA 4PFJA 1UF9A 3ENQA 3BL8A 1OU4A 2VP5A 5EINA 4P5PA 1SGWA 2ZI3A 3C0KA 1JI3A 5T3UA 3FMIA 4Z54A 2SNIE 3WHPA 1C5KA 1UMCB 4KV9A 2C3PA 3GC6A 4EZEA 4C6TA 5AOBA 4TYPA 3DR3A 4AWBA 4B81A 4BB6A 4TVBA 3E1SA 2FSSA 1JJFA 3B6KA 3H3XA 1A9ZA 2NP7A 1FRFS 4RGMA 1NF2A 5C32A 4R9VA 1DG1G 1OV4A 5BSEA 2YFQA 4LS3A 4BO2A 1TD1A 4CEHB 3SBEA 2SAKA 3GCXA 2WWZA 3SR3A 3BFKA 5EMJA 4BLVA 1IZ7A 4ZEMA 2WJAA 1SJ9A 1I4RA 4C4AA 5D3QA 2JIPA 4DCOA 1E0DA 5KBYA 4WBXC 4DNPA 1D5ZC 3LLUA 4M6WA 1Q19A 4OHXA 3SYNA 1X1MA 5CM2Z 3NAMA 1FJGB 5KAPA 4RANA 2I4NA 5EIFA 2ZT5A 4AMGA 2I6XA 5AICA 1D9XA 1Y37A 3EH2A 2D2FA 2QI9F 3HGTA 1JLHA 1FF9A 3F6CA 5H83A 3E8MA 5FBHA 1YE5A 2KWDA 2N42A 3GLVA 3ICOA 1QIEA 1KYYA 1RYFA 4DV4B 1RHKA 4AICA 2ZWAA 2K5PA 3LPAA 5DHTA 3FM9A 4FT4A 2D3BA 3OIWA 2YEPB 4EFLA 1SKBA 1CR4A 3T9DA 2IHKA 4MR7A 4KQXA 5I9TA 3HP4A 4MV6A 3IDAA 1S0UA 1QP4A 4BVGA 5HQ3B 2O8DB 5SV2A 1LW6E 3GNSA 1NHGA 4Z4FA 3UC5A 2GSWA 3V05A 5C8YF 5JNLA 3AGQA 2BMJA 4RE5A 1SU4A 3OFSA 2RHLA 1SUBA 3N3AC 2ZULA 5FFFA 3OJWA 4CODB 2C4NA 4A0GA 1RKUA 2PV0A 4JLWA 3Q10A 4Y9TA 4MCHA 4L5BA 2VPXA 5E8RA 2MDTA 4ZQFA 3UANA 2ZS7A 3AI5A 2WABA 1ZJYA 4DM3A 4TTPA 1SBBB 4JDPA 3N53A 4EUNA 3AW9A 2QNIA 1S3FA 4U63A 1R6TA 4MR8B 3AP3A 1EP2B 1QHFA 4OLJA 2VWPA 5ILQA 3BCUA 3E9SA 2WAYA 4HL2A 5FEUA 4IFTA 3JVDA 1IY0A 1J21A 1TJ5A 3E3MA 5IT9A 1P0IA 2VF2A 4UTVA 4EUHA 1C78A 1JG3A 1ZGZA 4N4AA 4YR9A 4RTOA 2KDMA 4CKEA 4XD7D 4LGYA 4QDXA 1QS0B 4P31A 4BC0A 3BIID 4CU2A 3AVVA 1CU1A 1MT3A 2RHMA 2V8OA 1ZGCA 4ZC8A 1GNQA 4RVNA 1VBMA 3BTOA 4MUYA 4CV1A 2O5EA 1FTNA 2VDKB 1HE4A 3WADA 3GDFA 4NF2A 4G0QA 4F8CB 3H2SA 2DJ5A 1KJWA 1PR3A 3BRWD 4URHA 1WB5A 3RBZA 1LK0A 3DBHI 2C2XA 3IT1A 3FZYA 5AOCA 1WE6A 4NPAA 2JLBA 2MCNB 1XX6A 5FRDA 2FZ5A 1XVIA 1KNXA 2IYTA 2PKXA 4NCAA 1BWSA 3TS1A 1SVOA 4JI1B 4GT1A 1G3IA 1CHNA 1J8CA 3EVGA 4HWKA 4ZOLB 3NV7A 4HYQA 4HDCA 3E5MA 1E5LA 4X63A 3KJXA 1BXRA 2A0YA 3FHOA 1RKQA 5F73A 1C7QA 1G1AA 5FCDA 3I2HA 4EPWA 4N5HX 1EVEA 4BE7B 2SKDA 3HKEB 2MT9A 3GJ0A 4JLVA 3RYTC 4IVPA 3VKUA 5FJIA 4XLZA 4C22A 4CKZA 3K3PA 3F78A 1QQ5A 4Z1MA 3W3AA 2VQSA 3I2FA 3H9JA 4B6EA 1YVPA 1T1EA 5BW6B 3BE5A 3ZJTA 4FZJA 2HREA 2QRUA 4M8NA 3CH5A 4GHWA 2ZYUX 5REQB 2KWUB 3BPSA 4IXMA 1EP9A 4TZ6A 1K6XA 3C7AA 3GUZA 1EFRD 3LHFA 2WKPA 2I4OA 1YMQA 2O2XA 2X9VA 3DFMA 4XB1A 4UPVA 1J8MF 2HAEA 2HWWA 1KM7A 1OB5A 5D1HA 4QFMA 4UNIA 1L6UA 3LK7A 4CLXA 3A58B 3OZFA 1H5NA 1N6PA 1ZESA 3FE2A 4MQ6A 2PANA 4HXEB 5AESA 4LDJA 1HT1E 1GUDA 4LJAA 4RJJA 2E4YA 2XMRA 4JYAB 2FN3A 2OHIA 1C8KA 4MCJA 3A1QB 3ETRA 3IQZA 2GUWA 4D8WA 4X8LA 1K27A 1KJJA 3RVKA 1EWTA 2BQQA 4MUKA 4ND8A 3EBPA 1R74A 5JHHB 2JH9A 2OUKA 3IMGA 1DEOA 3AFNA 2YHSA 2Y87A 5A4AA 1SQ6A 2ZBGA 2P2YA 1S8FA 1C3VA 5LLTA 4QGFA 3PNOA 4I5FA 4HDAA 3GLTA 4EOYA 4W1PA 1UJCA 2J31A 3FOAA 3WWOA 1C8VB 2YKGA 5JXHA 4RIFA 4CI9A 2COKA 2WPDD 2D2QA 3GPDG 4B5KA 1IOWA 1WGGA 3OLMD 2YL2A 4ARUA 2H2HA 3C19A 1VL2A 1VG8A 1YAHA 4PSKA 2R0QC 4CKCA 2VA8A 4QU0A 1L5ZA 3UO8B 1OKKA 1AHPA 2NZUG 2EU8A 1IATA 1UMBB 3NTRA 3K0FA 3PWTA 2IS6A 1GTJ1 3VMMA 3SZRA 3U19A 3AONB 3PRYA 4HGYA 2JBHA 3IVCA 1OZFA 4UKDA 5KEIA 3OQMA 3ZDMC 4L08A 3IQFA 2VTDA 2H1VA 4Y6SA 2GN2A 2B5VA 1DKMA 4ZQCB 4FYYA 1GA1A 1JT9A 4KN9S 1EK1A 4LQ4A 3LDAA 5LQAA 5JCOC 1C4OA 1RC8A 3QVOA 3LDZE 1X42A 4RF3A 5EJ9A 2ZT6A 2B7BA 1AU9A 2JLZA 4H2AA 2Q9AA 1JEDA 2OAQ1 1P77A 4TMTA 2TMDA 3ZW7A 3VO8A 2VKQA 1N2ZA 4EKDA 3WOHA 4RTSA 2ZJZA 1L3IA 2RI6A 4ZN6A 3DCYA 3PV1A 2GBGA 2AMYA 2J9GA 4CCYB 4LRQA 4EENA 3AIMA 5KYXA 2G71A 2ZIUB 2Z43A 2AX5A 5L6LB 1NYTA 2NTNA 1Q17A 4HWPA 3IKTA 5CRIA 5CG1A 3BJIC 1P45A 4R8LA 1D1TA 1GPDG 2Z0DB 2G88A 4QBTA 2NXNA 3SIRA 1CVLA 5A87A 1E3DA 2QUZA 4D45A 4IDGA 3OZEA 4XCVA 1WPRA 4IMJB 5D3IB 1XTZA 5A0VA 4E6PA 3PXGA 2H6AA 1L4NA 1A3CA 3IFWB 3GEEA 1OBCA 2IIBA 1U81A 5TMEA 1RPAA 4Y6RA 3NDBB 4CLRA 4GEKA 1DIBA 1RAAA 3MFQA 4PANA 5LPNA 3TNDA 2OZKA 2G1JA 2C2HA 2OPHA 3N70A 3CF4G 1P5JA 3CMCO 2W55A 5HCIA 1RU3A 4XB2A 1N8SA 4KAJA 3GUCA 4NBSA 4H4DA 2X0JA 1ZKDA 1P4SA 3CR3C 4Y9UA 3TQHA 1SQGA 3PTLA 4W9NC 3W3AD 2IXGA 1XEWY 3N76A 3A32A 3LUJA 4UFOA 2C5AA 2VDOB 3GLFB 2JLSA 1SG0A 3V7YA 3AJDA 1G8SA 4Y9SA 1HE8B 4ECEA 1SCDA 4JEHA 2Q7DA 3B78A 2MTBA 1JEOA 3VYWA 4JLKA 4I6JA 5LDHA 1M6EX 5DYTA 3WQRA 2BPOA 3ZYCA 3TW8A 4II3B 1XRNA 3H0EA 8MHTA 1U7XA 1RZVA 2ARKA 5B6IA 3HKCB 4X20A 2G9RA 1GSOA 2GXSA 1WETA 3PRJA 4P4GA 1J8QA 2B1QA 1QSGA 4N3CA 4AJOA 5HJ7A 3T9MA 2ADMA 1PX2A 4YYZA 3V8PA 4Y2XA 3DQPA 3MIIA 4AZ0B 4XR9A 4PHGA 4Q1BA 4ZI2A 5JAPA 1LU9A 1O6ZA 2IEAA 4MB2A 3DKKA 3GAMA 1CERA 5AM0A 1L9KA 4ZYUA 1Z4PX 4JSRA 4FOOA 3NTOA 2WJVA 3SQWA 4FIZA 3R3UA 4D8VA 1VSUA 1YJ8A 2AQIA 3QWAA 2NP6A 1PJ2A 3OM8A 4HDKB 1KI1A 4F6RB 3QQ5A 4MW4A 2ISQA 2X40A 3JVIA 4BB0A 4QRHA 3RVPA 2ECKA 1U7ZA 4TLDA 4ZO9A 1H9CA 1OW3B 1EVYA 4WD6A 1GPBA 4YK7A 5E1MA 1DX9A 1OHHA 1O0BA 3P45A 3WMXA 3ISVA 3BQ9A 3Q5DA 2IOHA 5IRCD 4R5MA 3QHTA 3NW9A 3WANA 1Q0QA 3K70B 4WWPA 4MX8A 2VOJA 3DXZA 1U2SA 4CT4B 3DR5A 1Y8AA 4WVLA 4X60A 4HUJA 1NZFA 4EG0A 4ZCRA 3RAFC 1FTSA 4DIEA 3V7WA 3OPYA 1VGQA 1YACA 1WUTA 2ZZIA 1UPFA 4FE4A 4C1CA 4Z99A 1PJSA 2OCGA 4GDLB 3EEYA 4P7JA 2QUKA 4K9DA 3UV6A 4JZYA 1NATA 1IQRA 2C9ZA 4KFRA 3KEGA 3BH7A 3U7IA 4XUGB 4RTQA 4IJ6A 2VF8A 5JBNA 1YL7A 3GRKA 1YASA 2UZIR 2OFFA 4FFNA 3JR3A 5C1OA 2MQJA 2BTEA 3HDJA 2CBXA 3DL4A 1WOYA 4IV0A 4J4HA 3TTYA 1PFQA 1MPEA 5I51A 1MB0A 5IUKC 3L4JA 5KJEA 3HJAA 3UJPA 3G9UA 2G3QB 2NQ8A 4TZEA 2O2CA 1N62A 5FOVA 1BMTA 1PLLA 4Y2JA 2PZKA 1VL1A 3SEAA 5K0JA 4B8ZA 2OYCA 1U3UA 3URYA 3C1UA 5BN5B 4GLSC 3NLLA 3I57A 1JR6A 4RSMA 2Y66A 1JWLA 4QLBA 5E7MA 4ER6A 1ML4A 1EGMB 4X1IB 2B8NA 3K9LA 3SU8A 4ZKEA 4LNNA 2K4MA 1RP1A 4C80A 3LC0A 5JDIA 2AOXA 4KRYA 4BWYA 1PTJC 2E87A 3I9JA 3AVXA 4HPWA 2C7OA 5B2EA 3C8ZA 2Z8XA 3T5MA 1QVRA 3VR4H 5BRAA 1Z7WA 1EE1A 1P73A 4ES6A 1HZ5A 1E7RA 3L8FA 4GNKA 5FTWA 4MVJI 5LZ2A 4HN4B 2EKQA 1JFTA 2QX7A 3NGMA 1KVRA 3QVSA 3S2SA 1YS7A 1WPGA 2M1MA 1JMLA 5HIOA 1JBQA 1K08A 4XI9A 3IKMB 2JIZA 3TIXA 3EYAA 4TN1A 1T3GA 5AFSA 1HQRD 4OL0A 1BKYA 2RJ3A 2HT1A 4KXQA 2O0HA 4OHWA 2IV7A 2IP4A 2YCBA 3VH4B 4BNLA 2OESA 4QOFA 2IXBA 5TE9A 4GVLA 2IIPA 4D0RA 1KK0A 2HMVA 3RVBA 4OV6B 2Q0QA 2FPMA 2D0OB 1ZRMA 3RZFA 5AEKB 3ZCVA 4R69A 4DC1A 3Q9SA 5IMBA 3PNSA 3ZWKA 4IJWA 1NI2A 1JQKA 2FUHB 4EHKA 1WE2A 4EHIA 2WJWA 4H9GA 3SLRA 5HISA 4LOHA 1ZAKA 2AC4A 3V33A 5DNEA 3IMEA 3JRWA 2Y1GA 3Q0TA 1T2UA 3OU2A 4BVKA 3AUAA 3L10B 4NC9A 5E9QA 2GYYA 2EJTA 3JRXA 3B8EA 3FWYA 1OIXA 1TZMA 3ZV3A 3KKOA 4Z3OA 1HNZB 3AEDB 1NE2A 3OZWA 1NY5A 4NBWA 2XUJA 4M0KA 1KYZA 1D3ZA 1OC2A 3HUIA 1OHHD 1G41A 2RGCA 2BCEA 3BHMA 4I6NB 4I9NA 6GPBA 1PX0A 4NRDA 1LUAA 1FMLA 1XMXA 3LUKA 4QULA 5FBRB 1Z5VA 3WBJA 1Z3CA 2NPOA 3U09A 3OY2A 1SURA 4I4TB 2FEMA 3UATA 4WN3A 2JFQA 1IH8A 3RNCC 1WUHS 3FJOA 4O4JB 4RF0A 2BRUC 3G13A 1QYVA 2GK7A 3SDBA 3DYVA 3PGVA 5KNDH 4YV0A 4X5OA 3RU7A 3VTAA 4L6CA 5B4VA 2JJ8A 3ILHA 1TEHA 2EFJA 3PDIA 1U99A 1X7HA 1KTVA 2PXXA 2PJUA 1FRDA 2Z2YA 4F5ZA 1ZEMA 1PGXA 4TV8F 3CRZA 1DRJA 5JASA 1ZOIA 4EHBA 4DB2A 4NY0A 2X19A 1HYGA 3PWZA 2OGUA 1GGEA 5JJ5A 2MW5A 1RCFA 1U0HC 1S01A 5BUSA 4OQYA 1KZ9A 1E1KA 5JZSA 5D01A 3WR5A 1WS6A 3DMGA 4WD3A 4C1BA 2V6JA 1YT5A 4GE3A 3JATA 2W93A 3HWSA 4FX2A 3WO0A 3LQKA 4PYRA 1G5QA 4PYKA 3UQYS 2QILA 2GO1A 4XYEA 2DHZA 5CURA 2QWXA 3QYJA 4YVFA 2B5OA 1KETA 4OP1A 1Y8CA 4YMLA 1QYCA 1RXEA 1VLBA 3ZHBA 3TQFA 1XEWX 4NYMR 4E11A 4ZMSA 3F6PA 4KL8S 2P9JA 1MV8A 1E9BA 2HHJA 4DUZB 2WC1A 1I35A 5L95A 1GCAA 5ER9A 2JD1A 1OT5A 5CDHA 2YJ5A 3D7RA 4RV9A 3SQOA 3B2QA 3ZWFA 4NH0A 4HB2A 2PVCA 2ZJFA 2PTGA 2R25B 5FDFA 3GEGA 3O1LA 2WT8A 1RMTA 3CVYA 3ZHQA 2AXQA 4HEHA 1XT6A 4DHWA 4UVDA 5DXFA 4OQNA 3L0DA 1QVVA 4ZV9A 3S8EA 3OCCA 1WTCA 4HRVA 1SBHA 4PTLA 4AUQC 3IUYA 4O5AA 1A8UA 3K5WA 4QAQA 3WK4A 2CJWB 2KBEA 1RXYA 1HPLA 5FNVF 1PP4A 4GOCA 3MTEA 3TGPA 4D92A 2B34A 3BKWA 4QPNA 1D09A 5IABA 3P7MA 4XASA 3E23A 4IICA 2RHRA 3PT5A 1HE1C 2NXWA 3QLVC 2VZLA 1GGVA 4LHSA 3HB5X 1TS3A 2V98A 1VYVA 4WW0A 3SWWA 5A3QA 2VDWB 5J3JA 4PZLA 1YIAA 1XZ8A 2ACZB 1N0UA 2W7TA 1SHJA 5LXTF 1JJIA 3I76A 3EC7A 4V02A 1LGYA 1X0XA 1SFRA 2AYZA 2GWHA 1NT4A 3GYGA 2PQMA 3MQ4A 2Q45A 1FVFA 1G63A 4ZQHA 3QZUA 1N33B 3W3ZB 5EWLA 1GAWA 2D5IA 1JUDA 3DAHA 5DB4A 2I8CA 1L7AA 2QMHA 3HDGA 4KVGA 2G9QA 3O83A 2JVJA 4CF4A 3IP8A 3ORFA 3MMXA 3RVDA 3ROGA 2Y77A 1JU9A 4FYIA 1CR6A 4AJWA 3HK2A 1CR0A 3G1PA 1XTJA 3QXHA 1OV6A 3UVEA 1Y4ZA 3OQ6A 1PT9A 4FFSA 2GNPA 3AFIA 2ON8A 3DB1A 4QWMA 3IKJA 2J9XB 1GQYA 3IULA 1PKXA 2JJMA 3JQCA 1UQUA 3ADRA 1DEXA 1Z4OA 3LZCA 3JD1A 4M1TA 4GMKA 5F3DA 3MLAA 3F97A 3F2IA 1TS5A 4GVXA 1Z75A 4RL6A 1NXQA 4LK0M 1LTHR 5F7OA 2HSDA 1EF1A 4R1LA 1F8GA 4UBQA 4NECA 4R2KA 4KXXA 1HDCA 1PSWA 5JANA 1T8UA 2ZVDA 1U2DC 3VVBA 1L7BA 4DEYA 5CYGA 2B76B 4LNUB 4JLAA 4UEQA 1M6VA 1NOJA 1EGAA 4M87A 4FDLA 4OI1A 2P4HX 2KFJA 4TUYB 5BV0A 1LC0A 1MO4A 4OQEA 3ENNA 4FQ8A 3AIIA 3A1FA 1Q2UA 2EFGA 3E8XA 2WYUA 1B8NA 3D32A 3QMVA 2FLWA 4AX4A 5J4LA 1DNPA 1E92A 2BWJA 3DC7A 3DE6X 3GLGB 4DDHA 2PKRA 3P9CA 4FU0A 4QYXA 4BEBA 4P7IA 4MM3A 3FSJX 4TWAA 4BNTA 3H1BA 4QASA 4CT0A 4P34A 1J8VA 3T9BA 1SSNA 3OKPA 2VF7A 4KQ1A 1NUQA 1ZHOA 5LKAA 4PS8A 3QLUA 5LFAA 3UGBB 3HCDA 4ZICA 1OJ7A 2H85A 5SICE 3WA7A 5F76A 1SM4A 1TUBA 2HQSA 4TXNA 1HNNA 3ZHTA 1PDVA 4RKRA 3I52A 1J00A 1N3YA 3ETNA 3HXPA 5EV8A 1VE3A 1YIDA 2WXLA 4TMXA 1QKJA 2WS3B 5BXYA 2OBFA 4DVGA 3W9CB 3HEBA 3X1DA 2HCTA 4YPFA 3WRXA 5LQUA 3TCXB 2Z6QA 1SBZA 5J2UB 4BMCA 5T4HA 1F2TB 1P7EA 4RTLA 1XDZA 4RW0A 4IIGA 3GV0A 1NQWA 2ZITA 3W2EA 5K01A 5TQ2A 3AR2A 4LOLA 2ZRBA 2HDNB 4WLUA 1G2IA 3PS6A 2CHUA 3I2JA 1QHXA 4BFWA 1JSXA 1DAEA 1V35A 3TIVA 2PZMA 4OXRA 4ZZ2A 2AC2A 3EIWA 1A9QA 3LOQA 1XZNA 2ZZPB 5DP1A 2RI1A 2RKWA 4AMBA 4NV3A 1K6JA 2VHUA 2JIBA 4M8SA 2QL6A 3PQ6A 3M9XA 2VP3A 3BFPA 4U0KA 3VFKA 5CK4A 5FUMA 2QIPA 5JAMA 4MI9A 2ZXEA 3UJ6A 1T0BA 4D82A 2ZNBA 2Q9CA 1VJGA 3H2JA 2QJSA 3IDSA 2MBOA 3D1JA 3C7TA 2X15A 4AFNA 4AP5A 2NO7A 4MWZA 5AVXA 1L4YA 1EFVB 2P35A 4DANA 5GVSA 1M67A 3WYAA 3ZVNA 4KVZA 2WFLB 3EF0A 1BXZA 3DOCA 2P30A 2M6RA 3AC0A 1PQ4A 3JVVA 4URZR 1B43A 2FI1A 4ND7A 3GG2A 4X94A 3MJTA 3ONSA 5FJJA 4IZIA 4US2R 1FSGA 5IWAB 4G37A 2Q3FA 3I8XA 1H66A 4IO0A 2K3UA 5SY4A 2Z8ZA 4J0EA 3QH8A 1K75A 2PBZA 4DMUB 4ZK6A 1M75A 1I3CA 2XXBA 2J30A 1ZD4A 3Q8AA 1X7WB 1NIJA 1SZCA 3EPPA 2J3HA 3B1VA 2YHBA 1FY2A 5E3IA 3I01M 4NCBA 3HVJA 3QX3A 4G07A 3IQXA 3AEYA 5HA5A 4DMMA 1EB9A 3ICWA 4PC1A 2AWTA 2AIRA 3ISJA 4RGNA 1ST2A 2NV0A 3J81A 1QZTA 1SUEA 1BMFD 2YNWA 4YXWA 1WTAA 2FPWA 3JQAB 3SC2A 4RFVA 1UJBA 3ZOKA 2X3YA 4AMZA 1P1AA 3NHBA 1V7ZA 3U8ZA 3F74A 2QZPA 3HZHA 4ZCSA 2P65A 4MLZA 1NI4A 1VZ3A 3AU9A 2ZE5A 3MD0A 2WRSA 1A88A 3G2PA 2I8AA 4RM8A 5F33A 4BHTA 3LBFA 4QQKA 4U39A 4QNMA 3P2MA 3WFZA 1V8ZA 2XB9A 2GMIC 4XSVA 2WVHA 2O8FA 1AKEA 1NASA 3IAFA 3PXDA 3R8FA 1T26A 5H02A 1TPYA 3ENEA 2JFZA 4KITB 1J5EB 1FLDA 2YXLA 5A4FS 1F48A 1PSDA 2GHTA 1OR8A 1VSBA 4PRYA 4ZJYA 4ICVA 2W9NA 2WF9A 3DWMA 4PHFA 4Q00A 1BS1A 3R6WA 4Q3OA 4EYBA 3EFOA 2C29D 3CURA 3IBFA 5K7SA 3NHKA 2RK6A 2DPXA 4KO8A 3HY3A 4GP6A 1NVMB 3AE2B 3QBDA 4J2HA 3N8NA 2YTZA 2VJAA 1T25A 4I1PA 1T5LA 4YS6A 1O5OA 2Z3ZA 1XRMA 4NCXA 2ZSDA 2H00A 5JCXA 1US8B 2G67A 3TFWA 1Z56C 1ZY2A 1BTOA 1MQOA 3QFCA 5A03A 5CB6A 2XCUA 2CG2A 2CL6X 2PL5A 2L18A 4A15A 1YKGA 4XTRA 4UU1A 1Z39A 2J3MA 1S3GA 1AY0A 1YZTA 3PC8C 1AURA 5JS7A 3FAHA 4KOEC 4KN8A 2HEIA 1UOPA 4ZKDA 4AUMA 1GPWB 3RSSA 4OF4A 1P5ZB 5HF8A 4M38A 4B6PA 5DNCA 1MJGM 1F1JA 2XR1A 3WWCA 3DHAA 3LCMA 1J7AA 4BKMA 4B6SA 1RJ9B 2VTKA 5TR9A 1V3UA 1NUUA 2YS6A 3RVJA 4W63A 3WWEA 3ZVRA 1IUOA 2XCLA 2AD5A 4H1WA 2FFAA 3IX7A 1RKVA 5LMUB 4X3PA 1QTIA 1B6TA 2BL4A 5T8KC 4FS8A 1ABBA 4HX2A 5H70A 1HYEA 1T4GA 2VK8A 3PJRA 3ODPA 5DM0A 5A4MS 3LPCA 1XWFA 1FFAA 1TL7C 1M2VA 3LIIA 2CU3A 1XN4A 4HCNB 4HH0A 2ZUTA 2UZ3A 1C9FA 4ZAGA 4OGGA 1DAGA 3MD7A 1NP6A 2CKDA 3N1XC 5GGYA 5IT0A 2VRWA 2ZVJA 4O4HB 1I4DD 3H8VA 4URXR 5KUTA 4PG5A 4CM8B 3T34A 3IR5A 2BB5A 4IIDA 4HWSA 3JD0A 1X38A 2VJOA 1F3OA 1YDHA 4MDEA 3DHEA 1H42A 4JLOA 1XJ5A 2P9GA 3DPUA 3FNFA 1XKXA 3M33A 1IDOA 1XCPA 4TRNA 4IUDS 4WZBB 5FQCA 2DZDA 5I01A 2CYAA 5JS1A 1KH2A 5FUXA 4LF8B 5KNBH 4UEWA 4B7AA 3LGAA 4AO7A 3TI9A 3ETHA 1I3KA 5LQNA 2O5RA 3P2IA 3B7WA 2WU3A 1RVDA 4QJBA 3WGJA 5CU7A 1ZN7A 3CO5A 1QZZA 3MXOA 4HAOA 2WJYA 3RFXA 3EDRA 1SVIA 1G20B 3RHSA 1ULZA 2GCEA 4AYWA 1TQ2A 1MFPA 4I50A 4OH1A 3R3XA 1UC9A 3B6IA 3RAGA 1AOXA 3WL4A 2HEGA 3UCXA 3LY8A 4CEIA 2P9BA 3HKBA 3PFWO 5CIWA 1WUJS 2D2VA 2JIDA 2W6NA 2ROQA 3CONA 4TTTS 1ESDA 3OOHA 3S4YA 4KZ0A 4WBNF 4A55A 3KUXA 4LRWA 3Q1LA 5J2TA 1YHNA 1TADA 1O7JA 4QELA 1U7WA 2Y2UA 5AOAA 5J4HA 2PRJA 4J7AA 4NAVA 3WSTA 5KMGB 3ZYYX 1TQHA 3QVWA 4A26A 4ONEA 3STHA 4P81A 2ZPUA 1QGUB 2YWHA 3DE2X 3TEWA 2IU0A 5GP1A 2F1KA 4UFNA 4ZT3A 3LRPA 3A6LA 2R96A 1YVEI 2FMKA 4LY3A 5G3ZA 4BGVA 3HDVA 4XIFA 2VUSA 3DDUA 5F9HA 2X7XA 3G0DA 4E07A 1NW7A 1VZ2A 2R86A 3T3NA 3MEQA 1ADJA 1T1RA 2IF2A 2PS1A 1NW6A 3UJ8A 2Y1FA 2ZIGA 1PI3A 2PMCA 2I6QA 2WT4A 1A4UA 4UM9B 1OWLA 1YVUA 4OKNA 3E5NA 4MQBA 2JGAA 1TCVA 3MWEB 1ONSA 5JSZB 1QE0A 4MZXA 5K6TA 4JJKA 3F7NA 4X95A 1QAQA 3WGIA 1AARA 2GTPA 3GELA 2X5JO 1PNVA 3UYLA 2QDSA 2PJDA 4BP1A 1E79D 3C0RB 4FYXA 3JVEA 1MAHA 3QVGB 1Z12A 1XD8A 1VIDA 1GPAA 3U5ZB 4N0DA 1LSJA 2P6OA 4U0JA 3D0KA 2BGWA 3ABVB 2YMQA 2PQ6A 1WRBA 4IYRA 1LPBB 1NU6A 4IFIA 1RZ3A 3I12A 1EVKA 2FVYA 3BILA 5E1OA 2B35A 2JD2A 3EHDA 4NP6A 1D4BA 4UVGA 4JNCA 4I1OA 1OX6A 1JWAD 5IJ0B 3QIJA 2B8WA 1GL7A 1N92A 3MWGA 1U28C 3HDHA 1P3QU 2MSCB 2AEFA 4IM2A 1PNRA 4CN9A 3BERA 2OA0A 5A5ZA 1U0OC 4II2A 4UA4A 4E33A 4IH1A 4BVJA 3V46A 4MA0A 4I0WB