4XWWA

Crystal structure of rnase j complexed with rna
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
545
structure length
545
Chain Sequence
b'PAPTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein/rna
total genus 182
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwwA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwwA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwwA01
2XF4A 4KEQA 4AD9A 4UWSB 3Q6VA 2I7XA 2BR6A 4C1CA 2FM6A 1HLKA 4UWPB 3ZNBA 5AHOA 1JJTA 4AWYB 4NQ2A 2BG7A 3DHBA 4DIKA 4UAMA 3L6NA 3RKJA 2P18A 3AJ3A 5ACRA 4EY2A 2BG2A 2AZ4A 2BC2A 5A0TA 1SMLA 4CHLA 2XR1A 5LE1A 4EYFA 4KEPA 4F6HA 3RPCA 4GYUA 3SD9A 4Z5YA 3PG4A 5FQBA 3BV6A 2FU6A 1VJNA 5LCFA 2BGAA 2FHXB 1Y44A 3T3OA 3IE2A 3KL7A 2NZFA 4ZO2A 4AWZA 3LVZA 3IE1A 3WXCA 4AX0B 2BG6A 5ACPA 2BTNA 2M5DA 5EVKA 3DH8A 3X2XA 3DHAA 5K4MA 4D1VA 5FQCA 3X2YA 3VPEA 2AIOA 4EXSA 2GFJA 2FK6A 3P2UA 1DXKA 5AEBA 4DILA 1KO3A 2Y8BA 4TZ9A 4UBQA 3QH8A 5K4NA 1X8GA 1BC2A 4C1FA 4RM5A 2Q42A 4UWRB 3IOGA 3AF5A 5B1UA 2QDSA 2I7TA 1WUPA 1KR3A 2NYPA 1JT1A 2E7YA 2NXAA 4ZO3A 2OHIA 5K4KA 2UYXA 5AHRA 2GMNA 2HB9A 4WD6A 2A7MA 2R2DA 1A8TA 5LCHA 4J5FA 2ZO4A 4D1UA 1DDKA 3TP9A 5A0VA 4FR7A 4V0HA 1P9EA 5ACQA 2WYLA 3ZR9A 3T9MA 1JJEA 5KILA 3FCZA 5LSCA 5HIPA 3G1PA 5FQAA 4TYFA 4D1WA 3I0VA 5IQKA 4BZ3A 4RBSA 4NQ4A 3PY6A 3X30A 2WYMA 2M5CA 3KNRA 1A7TA 2BMIA 3I14A 4PVOA 4EYLA 1YCFA 3VQZA 4HL2A 2BG8B 2ZNBA 5LLDA 2YNVA 1X8IA 3F9OA 4GCWA 2YNTA 5A5ZA 5ACXA 2NZEA 4C1EA 2Q0IA 2P1EA 3A4YA 3BC2A 3IE0A 4FSBA 3BK2A 2P97A 4B87A 4RL0A 1WW1A 5ACSA 5EVDA 5DPXA 2YNUA 5ACVA 2WRSA 5B3RA 2GFKA 2YCBA 5EW0A 1ZTCA 4HKYA 3SFPA 5LMCA 3R2UA 3X2ZA 4Z60A 2BFZA 4C1DA 5HIQA 1QH3A 5HISA 4O98A 2FU8A 2H6AA 4HL1A 4PVTA 4RAWA 3SPUA 3ZWFA 5ACWA 3ZQ4A 5EHTA 5K0WA 2VW8A 2Y87A 5HH4A 3DHCA 4Z67A 5A87A 4TZFA 3ADRA 2GKLA 2WYMC 2DOOA 4NQ5A 4C09A 4UWOB 5ACUA 4NQ6A 2Q9UA 4FEKA 2Q0JA 4XWWA 4Z7RA 4YSLA 3SBLA 3I15A 3I11A 5AXRA 5EWAA 2YNWA 3IDZA 2OHHA 1K07A 1MQOA 3IOFA 5AXOA 4U4LA 1DD6A 2FU9A 3KNSA 1QH5A 1VGNA 5HH6A 5EH9A 3MD7A 2I7VA 1L9YA 4ZNBA 4XUKA 4YSBA 5AYAA 2BFKA 1WRAA 5ACTA 4BP0A 3H3EA 5LCAA 4EFZA 1YCGA 2QDTA 1E5DA 4J5HA 4D1TA 2BG8A 2WHGA 4F6ZA 5EV6A 4YSKA 3IELA 3PY5A 3SW3A 1X8HA 4EYBA 2FHXA 2DKFA 2ZZIA 3RKKA 2P4ZA 5B15A 4ZEJA 4RAMA 3S0ZA 3SRXA 2QJSA 1YCHA 4H0DA 2YNVB 1BMCA 4EXYA 5EV8A 2Y8AA 3I13A 5LM6A 2YNTB 4TZBA 4P62A 2GCUA 2ZWRA 4GYQA 5EVBA 4RL2A 4C1GA 3FAIA 3IEKA 4XWTA 4C1HA 1BVTA 4TYTA 3BK1A 3AF6A 3T3NA 2OHJA 2QEDA 4UA4A 3ESHA 1XTOA 5HIOA 4AX1B 5LS3A 1ZKPA 1WUOA 2BFZB 3JXPA 1ZNBA 4TZEA 4Z6XA 1XM8A 5KIKA 2CBNA 4Z5ZA 2BIBA 4JO0A 4D02A 3IEMA 5HH5A 1VMEA 1M2XA 2YZ3A 2BFLA 4LE6A 2FU7A 2QINA 1KO2A
chains in the Genus database with same CATH superfamily
5EA2A 3I30X 5IBQA 3DT9A 5I6DA 2ZITA 4R7GA 5BSEA 5TMDA 1C3OB 2IPXA 1JLHA 1RYEA 2UYCA 2YDXA 2PWBA 2Q7OE 2FMKA 3EJWA 1BIFA 4MUEA 5DCUA 4Q02A 3LZCA 2VKTA 4NH0A 1HFKA 3KETA 2DPHA 4B3SB 1Y1RA 3G0BA 4HX5A 3H3XA 4AKEA 3IVGA 1K8YB 1BXKA 1E2MA 1HE4A 1T9ZA 1EF5A 4NOMA 1RC0A 5KQMA 1VGVA 2G9ZA 3UKDA 4PN7A 1ISGA 1HYHA 1SKBA 3AETB 4GM0A 1KY5A 2LRUA 5A6SA 1K8QA 3EVTA 1N63A 2QRLA 1M3SA 4D5EA 1EESA 4IZIA 2O5EA 2YN2A 1Z4IA 2KE5A 2YWXA 2XBMA 1W5EA 2PMFA 3H5RA 3AONB 1UDRA 2R00A 3F4KA 2CHEA 4R8VA 1BCRB 1NMQA 4Z0TA 3H86A 3ZW3A 3RVLA 4B3XA 3EQ2A 1YVUA 1BKSB 2OHIA 4MCAA 2B82A 4FONA 4Y7CA 3L40A 1ZICA 1B3RA 2CZGA 2Q4BA 2O7SA 2Q3FA 3AE6B 2NXCA 2RAFA 3UJNA 5T8IA 2NLOA 4TYMA 1FOEB 4XD2A 1BX0A 1SULA 3CF4G 3CUKA 4TS4A 4DHEA 3NUHB 5C1ZA 3OLVA 4E5SA 4CMEA 2J48A 4CUKA 2OCDA 3UI3A 4OIMA 4WUTA 3L7MA 4KRFA 5EIAA 3RAJA 2JHAA 3Q3JB 5DGIA 3ONVA 4LWZA 1R0KA 1B23P 1RCUA 1UJ2A 1I80A 1OQAA 3NXSA 2HD4A 4Q9AA 1GDTA 3L0ZA 4MS1B 4LJPB 4FX2A 1R10A 1QGUB 4XI9A 4D3XA 2A0FA 5BMIA 3OVMA 3MJWA 4Z60A 4S24A 1O2DA 1KAOA 4MQFB 2AOVA 2VDWB 1WUKS 2MR5A 1MKYA 4X65B 3PFHA 4FCTA 2YXPX 4WBNA 1ONBA 4X63A 5L4NA 4JVMA 4IXDA 4NOJA 1FSFA 4G5OA 3CF4A 3AMZA 3DKPA 4ZKEA 4AYTA 1YKFA 2R68A 3ZS8A 4Z4IA 3CUWA 3KKLA 1QOZA 5I7AA 2KJHB 3B1ZA 2WTMA 4L0QA 3L46A 1UBEA 4MKIA 4G9GA 4ANVA 3O84A 1T2EA 2XQIA 2UZ1A 2X22A 5C8YB 1FS6A 4Q15A 1EFCA 4ZAGA 4BX0A 2CD7A 1QH5A 3D81A 4W99A 2JY6A 1H94A 1EJ6A 1PE0A 2PV7A 5T8KC 1O6GA 2M9MA 1U63A 1OFGA 2R97A 4KN9S 3PTLA 3CJRA 2WHRA 5T4FA 4CCWA 2ZPNA 2V7PA 1HL7A 1PDWA 4KL8S 1X7WB 4DMFA 1EF1A 1JNYA 4JGIA 1B8OA 3HVRA 1JWAB 1HDCA 4HL6A 1FXWA 4MDHA 2H2FA 5L8VA 1QOFA 2XSZD 4PPNA 3R3MA 4ZRKA 3S2YA 3NS7A 4FYWA 4BVUC 4A03A 3K31A 3CZ4A 1ZS9A 4QEZA 4TKZA 1BN6A 3E9CA 1L5ZA 1FNNA 3NRZA 4M1TA 5M3BA 2HA0A 4ZYNA 2WWYA 4EF4A 2KLCA 2NACA 4HFRA 1FVHA 1XWWA 3MRTA 4FNOA 4RMNA 4HWGA 3GUHA 4C5BA 1IXKA 2JJQA 3Q3OC 1WOMA 1XZJA 3MOIA 4B1FA 4R05A 1IBKB 4BB5A 3O2SB 4EW6A 1QHGA 3ADKA 2HBQA 4UDNA 1J5XA 1YI0A 1UWVA 1DIRA 3UTCA 4Y9RA 1Q0ZA 4LE6A 3ROXA 1FE8A 4YACA 2GEVA 1CMXB 5HEKA 3AR7A 4CMKA 3G2LA 3KZMA 1UJ6A 4ZV9A 4ZCSA 5JV5A 4I3GA 2O8FB 3K8ZA 4CIYA 1L8AA 4UAMA 4JEUA 3AYXB 3TOSA 4BRSA 3BB1A 1V1JA 1Y4AE 3C7KA 3R9IA 4TWZA 3WYDA 5JG7A 2JASA 2ZNVB 4DKXA 2M1MA 3K16A 3O2NA 2L00B 2R8BA 1Z37A 4IUCS 4BMNA 3LW8A 1UP6A 3V2IA 1CTQA 2ZANA 3KH0A 4RFLA 3EAFA 2JBAB 4F97A 3HRHA 2KMAA 3KXPA 4RJKA 1L3IA 4WWPA 1CUYA 2PFGA 2FW6A 3NH9A 4UFNA 3RSOA 1P6QA 5AW6A 5JFOA 4ZU1X 3BHJA 1A1VA 3THWB 3MCAA 4RTJA 2WYHA 3M6LA 1ESNA 1NPTO 2WFLA 4HAVA 5FL7D 2AKAB 4NAWB 4C6TB 3UN1A 1J9EA 1W0JA 4P4NA 4BBAA 5F3DA 3W9CB 4R40A 1ZGUB 3TGLA 3ADOA 3Q12A 5KDLA 1GGEA 5KHLB 4IG7B 2D8MA 4CM9A 1HEYA 2YY5A 3U37A 1NJ6A 4WXHA 1MH1A 1QJCA 3TYXA 1DAIA 4RHUA 1ZM9A 2IPLA 4NAVA 4R2IA 2HDOA 1FYWA 1EYZA 3RTGA 4JP5A 3AKDA 1M6NA 1USKA 1GZUA 3AI2A 4DRXA 1U8ZA 2F3PA 4BFCA 3LW7A 4HH4A 2F1IA 5EQFA 2BG8B 3Q2KA 5K0ZA 1CUZA 2NZEA 2PZFA 2ZAIA 1ZCJA 1A5SB 4A91A 5C5IA 3ESYA 4AXXA 2AFIB 4JB8A 3M6WA 5EVDA 3EPJA 2NTVA 4DQDA 1L4YA 1NMXA 4TMYA 5J18A 2YCBA 4IIXA 1Q2XA 2WJZB 5DM2A 4RAQA 2FW8A 3VNSA 2BGWA 1BCSB 2MCFA 1WB6A 3BQNB 3EVNA 1QH3A 2C95A 4QFCA 1TU3A 5EMHA 3JQFC 3DFZA 1PT9A 3I04M 2ZZPB 4ZT5A 2WAAA 1XKTA 2KJ6A 1G66A 2EKLA 1ZK4A 1YC5A 3UATA 4OBBA 2J45A 3B1JA 2XK5A 1BVRA 1ZL0A 4DV4B 1RYZA 2F62A 4GT1A 3MOSA 4ER6A 5K3FA 4GNRA 4LCDE 1I5OA 2HHCA 3VHXB 2GWHA 4YJHA 3QBDA 4F1WA 2NG1A 1UOEA 5KTTA 2ZYRA 4G3XA 3C6ZA 1XLTC 4L51A 5LZ2A 4L6IA 1LVGA 4ZC1A 3F9CA 2W7TA 1DAGA 1EX1A 5H4GA 3PKZA 3P0IA 1TZ2A 4LWOA 2IEGA 4KV7A 4JLVA 5C4GB 5EV6A 2CFSA 1XO1A 4XYBA 4PIVA 1KFYB 2ZZIA 4CM5A 2J7KA 3L9XA 1IN7A 5IN4A 1FTYA 1GAJA 4YPFA 5KYTA 4OJYA 2O3SA 1U0GA 3AH8A 2O6VD 2M6LA 4FYIA 3ZY5A 1AY0A 3KOOA 1Q7RA 4QO8A 2JD1A 4BLUA 1UFVA 1N2CA 1P9LA 3VYRB 4TYTA 4RMGA 1YJIA 2D1RA 1KEZA 4X94A 4CR7A 1ZNBA 4FIZA 1A5AB 3W5BA 2QRHA 4QLBA 1B0PA 1PLJA 4J94A 1OJLA 6REQA 1MW9X 1N62A 2HQSA 2PX4A 4R5HA 4DARA 2JEOA 2HSDA 4OFXA 5DPWA 5GXGB 1MXHA 4XWKA 1RJ9B 5BNZA 3ONFA 3W1YA 4X97A 5ALMA 3OE1A 1P31A 2GAFA 1RAIA 3PLRA 4PWZA 1HTOA 1VL1A 4LOIA 1X94A 4UU7A 1Z7BA 4N65A 2X14A 3SFVA 2RH5A 3FJYA 4OJKA 5BUQA 4V02A 3I9V1 3WMXA 4DHJD 2YJ3A 4PTZA 2BFBA 4WJLA 2RAVA 2RK3A 4GZ5A 1E3TA 1AXEA 2M19A 4J4TA 5ACRA 4YTMB 5TC4A 4REQB 2MSED 4R8RA 2EKQA 1MAHA 4IOIE 3EWNA 2NUTB 4L5CA 1YZUA 3M6MD 4PG8A 3INYA 1C3JA 3QTTA 4MVYA 1LRKA 1RRVA 2WD7B 3HZHA 1AKNA 1ODJA 3PHGA 4PQRA 3JYOA 3Q69A 1OYVA 3SF0A 3K5HA 3VI3B 4EG8A 3RU3A 7ADHA 1MHPA 3S8MA 1OTYA 1R4ZA 2VBCA 2INNE 4F6LA 4O0MA 2GJAA 2MJ3A 2FSVC 1YT5A 4WN3A 3ROGA 1BD4A 4IZOA 2HLDA 2O3UA 3PRYA 3GF4A 1JU3A 2ECPA 4ROSA 2WFAA 4X1KB 1JWSD 1J2YA 2VQDA 1W9MA 2BCJQ 2MA9B 1RXVA 4Z0NA 2D74A 4ZYUA 4NRDA 1BW9B 4ZGGA 4MEJA 4BBZA 5AI5A 1CUAA 2JVJA 3GFRA 3T12A 2PRZA 2WF9A 4DXDA 3PNOA 1ISPA 2ZCUA 3I73A 4HG2A 3CU5A 5LWQA 1PDOA 2VN8A 2OVBA 2DJ5A 5KWIA 4FDAA 1C14A 1SELA 4RBSA 2XQGA 4U1RA 2ZYVX 4WN9A 5FADA 2IW3A 3L8CA 2V55B 3T9BA 1ZMRA 5LLSA 4KOEC 1TJEA 1VGQA 2Z04A 3W90A 1A0OA 4BNGA 3NATA 3UJBA 4BQQA 1G2IA 5FORA 4DV1B 1WXAA 2DWCA 2GBIA 3ZNHB 1ZXHA 3D2CA 2QUKA 2XE4A 1KH0A 5HNKA 5LMUB 3GDOA 1A8QA 1FMJA 1SUBA 3KOMA 4KI7A 4RMIA 3EVZA 4G9EA 2V9CA 3A9VA 1NENB 1F7UA 4CM8A 4NOLA 2J7PA 2GFHA 1K8RB 5ES4B 2OG1A 4BNYA 1Y9JA 1MTZA 1REQA 3L08A 1AT1A 4JJ4A 3G68A 1L6VA 3ZWFA 3TNLA 5A3SA 5AOCA 4CPDA 3IV6A 4MZXA 3BWMA 2PZBA 1C4OA 1B7GO 2JHPA 1MDFA 4DMKA 3FCAA 1BD3A 1AS0A 2Y5BB 2IYPA 3WAMA 3SBLA 2CHFA 3CF0A 1XF1A 1I6WA 4CGZA 4FLMA 4TN5A 4PHTA 3L1IA 3OD1A 3I5MA 2ZB2A 2O2EA 4FC7A 2ID8A 1C9DB 5IDWA 2IZ0A 2OZLB 1OF1A 4TXLA 1C1DB 2R3SA 1V97A 2YJ5A 1TJNA 3A8TA 3IUQA 4P7IA 1SUEA 5EH9A 5C1DA 1HNWB 2VPQA 3RFUA 5FV4A 4K81A 2EW8A 2YZ7A 3RSQA 1E3WB 5DZSA 1PSZA 5EJ4A 2L76A 3A05A 4U2EA 5CB0A 5IJZA 2X76A 4GMDA 2QMZA 4IMRA 3TQOA 4G4JA 4M7WA 2GNOA 4TWRA 4I4NA 1YVEI 5THXA 4RTLA 3UWMA 1OPXA 3PPVA 2YNTB 3QTLA 3W5JA 1G0OA 5CFMA 2W43A 4K3CA 3L8GA 2XXAA 3AV3A 4OF4A 3Q6MA 5DSZA 4LBYA 3C16C 1VLMA 3FCCA 2I9PA 3I37X 2HGSA 2PW9A 4UA4A 1N6LA 1WPGA 3LRTA 1O95A 4P32A 4KXXA 3LY5A 3VR3A 4CEIA 3U7QA 5E4JA 3WWPA 3Q0EA 2BEWA 3UAWA 2OLKA 2OCYC 3H11B 4URZR 1PF7E 5EIFA 4B6FA 3I01A 5DT9A 3A06A 3BH7A 3DYIA 3EEYA 1QV6A 4HSEA 2XF4A 2BW0A 5AM0A 5SY6A 4R84A 5FPKA 4R4JA 1LK0A 4D2KA 1V4VA 5F4BA 4LZOA 1W6RA 2ZE7A 2FM6A 2ZT7A 2WMDA 1BTOA 5CBKA 4X20A 1ZA2A 1T5OA 1Y5RA 2Y0EA 3H0EA 1WZCA 2H2GA 3TAHA 2DUWA 3CLKA 4BNZA 1LW7A 4H18A 3QK7A 3HL4A 3WGGA 3B2NA 4J0KA 3ESAA 4Y0AA 2A9KA 5TF4A 4PX2A 5HKKA 2IDZA 1AUOA 1W36B 1IFXA 2H63A 2ZTMA 4DBLC 1A70A 5A04A 1T24A 4EKDA 2LPMA 1EEXB 4MRVA 5MFPA 1ZM7A 3HWX1 5H59A 4PC6A 3OI7A 1FMAD 2VDUE 4HF7A 1BX1A 1S2NA 5IU6A 1LRLA 2PD6A 1EMDA 1XHFA 2QM0A 1KP9A 1U31A 2CF6A 4GMGA 3HI4A 3L6BA 5DMHA 3R9XA 2JIDA 2W83A 3ZY4A 3N9YC 2K7ZA 3DLCA 4L07A 5EQTA 4JJAA 4YYEA 2I2XB 1ULTA 3ROMA 1FIQA 2HTHA 1E0SA 2ZS7A 5CG1A 4V1CA 2NYPA 4BJHB 3E8SA 1HZZC 4RHEA 1H4TA 4YMSA 3T5PA 4MT5A 1YASA 4C6HA 4PNEA 3KWFA 2ZO4A 2I66A 3UK6A 4D4LA 2C5SA 4KODA 2HF8A 4QBIA 5HBGA 2I4NA 3RIHA 4XVQA 3EWSA 3ZNOA 2OBFA 4PN3A 3P2OA 2OBLA 4MJSA 2YRXA 1WZIA 4YAJA 1N75A 3B6JA 3TSOA 3BJRA 1EJBA 5EUQB 3A9SA 5GGYA 1YZTA 2BKEA 3JAKA 3PXBA 2MLBA 2PH7A 3FI9A 3MF4A 3WL6A 4DR6B 2KWIA 1QJ4A 1AQUA 2QUBA 4M1WA 3CZAA 1E7PB 1M2OA 4WZAE 1EDZA 4TYQA 5IAEA 2ZBFA 1UZMA 5AOVA 1MJHA 2BFOA 4Q4JA 4BMSA 1Z06A 1U2QA 4PM4A 4ZO8A 2LUEA 3W8DA 5A6SB 1KFCB 5AICA 4L4YA 4OM8A 2FDRA 1FJ2A 2W2MA 2GZAA 4PLCA 5KOYA 4F5EA 2HIAA 4YUYA 1BCRA 3A11A 3OUTA 1E0JA 5EXXA 1Z5OA 5GMVA 1NAIA 1Q0WB 3BGVA 3ZQ4A 3NRCA 3O31A 3N2NA 5IAGA 3Q5EA 1JG3A 2IA5A 2WYMC 3U13A 4CIBA 2OILA 5KHOA 1P2TA 1BROA 1WCWA 4LYHA 1KZHA 1ABEA 1R0RE 1N5RA 2QRVB 5EUMA 5EJ7A 1UBOS 4OD0A 1I4EB 4M7RA 1AQLA 3PHXB 4RE5A 3NG0A 1A76A 5IPFA 3DEKA 2JLZA 4LYYA 2QW0X 1CUWA 4EZEA 3NBZC 4QYTA 1QCCA 1UKAA 1R8JA 1P60A 3KYDA 4YSBA 4G5GA 4KLZA 2B9EA 3LUBA 2H85A 3IEXA 1AK9A 2V3WA 2EZ9A 4YJDA 1TVKB 3W8FA 1DOXA 1OT3A 5JRJA 2WF5A 2DY0A 3HB1A 5C4IA 2LDXA 3RVPA 1XLOA 4MS1A 3HVUA 3K05A 1BMDA 1EVLA 3S0ZA 2FBWB 2Z2YA 4LDTB 2EU8A 1JILA 2ZRBA 2G06A 3GBVA 1V86A 1KR2A 4AF6A 4MMYB 2FCSA 4NBNA 1YJBA 4MQFA 1PR9A 3N0XA 4E94A 4OHCA 3LQFA 1UBLS 2A7XA 1BU8A 4GXBA 2LGJA 3N28A 1TKCA 2QEDA 2WDVB 3DOEA 1DXQA 1IHPA 1ESEA 1PNQA 3ZHRA 3H1UA 3QYFA 3GEDA 5DNUA 5TGDA 3L54A 3SFDB 3V62A 2XCIA 4YONB 4ZI3A 1JYFA 2V7WA 3A32A 1YL7A 4OEHA 3EE6A 5EMJA 5BN1A 1ULHA 4WBNB 4L50A 2YZKA 1IM2A 1L4HA 1J2RA 5ESWA 1X1DA 2JJ8A 4NEQA 3H65A 4J9VA 2ZUEA 1KA9H 5ALRA 3CT6A 4UATA 5TS2A 2DBVO 1QQ5A 3U3JA 4PTYA 2EG5A 1U0OC 2X40A 3DGFC 2YN4A 4MO2A 2VUSA 4N3GA 2PGIA 2BZ1A 1X7WA 3BZUA 1CUHA 3W6ZA 4RORA 4G5SA 1BJTA 2VSXA 1N5DA 5LMZA 3NHFA 3AGQA 2ODTX 1RPTA 3SJAA 2F1HA 4EYFA 1MJGA 3TRFA 2OV6A 1NX6A 1MAUA 1Y8ZA 4LYAA 1AGNA 5FBZA 1WXWA 3AB8A 2ZVOA 5B55A 1XU9A 1U3GA 1KZ4A 2G7ZA 1B41A 2P3SA 3G23A 4DW8A 5IM4F 3RSLA 2VFAA 4J16A 1YQ4B 3NGMA 1XVVA 1NUUA 3QK0A 4KLRA 4I2NA 5DW3A 1FS4A 1OXMA 2OHGA 3IT4B 3AOEA 4WLVA 4AO6A 1N6HA 3G7SA 4UBQA 3QH8A 3KJFA 2WJ4A 3Q6IA 1CDZA 4LJAA 4S2EA 3ZDFA 3GELA 4CQMA 5CD1A 2WHPB 2OM2A 1E5LA 2QQ0A 4YQEA 2DZJA 1HT0A 1CPYA 3QVSA 3DYBA 3GLUA 5B1IA 4U0JA 2IH4A 3N5CA 3S99A 4KVZA 3TLAA 4PVCA 3BWVA 3OU2A 4J5FA 4EUSA 4N41A 4DT1A 3L1UA 2X5OA 3AF1A 4CT0A 3QUSA 2JAOA 5ITWA 4RA9A 5A7GA 3UT5B 3GT4A 3G49A 3KOWA 1N2BA 3TLYA 1AA6A 1SBBB 3UWSA 4AS2A 4G1MB 4G84A 4LY9A 4GM4A 3CUVA 3KNRA 4PX5A 4EYLA 4LN1A 3V8PA 4XCXA 2AR9A 4OLBA 4M83A 3IP7A 3AU9A 1AYFA 5JALA 1TZMA 3OZFA 1S2IA 3AHCA 4WVFA 1DV1A 4UKDA 3QWIA 2HSGA 3NHYA 1GIAA 4X6YA 1FQOA 2JBAA 4NY1A 5JCPA 2J3JA 2PMCA 1G8AA 3ZWBA 1G5PA 1VZ2A 1EU4A 5DPSA 1CRQA 3AJAA 5M29A 2PIDA 1HWYA 2QD5A 5EC8A 3WHKA 3NNSA 3V4ZA 2PSHA 3THWA 1Z6PA 4BY9E 1CSEE 3B8HA 2Z56A 1XKLA 4LMBA 2XLBA 2P6OA 4NMMA 2IIPA 5EIHA 3VTFA 4C6TA 5TGTA 3MC9A 4F86A 3ZKAA 4PGAA 3R7LA 1E2EA 1TYEB 2E5LB 2GHTA 3DDCA 1E61A 4JUBA 2W90A 4HZUB 2WFLB 2Z8LA 3MOGA 4MKRA 2YC4C 3LDHA 5EVCA 1V41E 1OB2A 1E77A 3ABSB 3VYVA 4CFYA 3PJFA 3CO0S 1G0NA 1UWMA 3AFNA 2QPTA 2F43A 1I4HA 1GGMA 3HKCA 1LFDA 1JKMA 2Q3HA 2QW8A 4DSNA 3DDNA 1E2PA 1MFZA 5B36A 1P2UA 3HADA 3S2ZA 2PPHA 2D5IA 2BFKA 1JG4A 2O06A 3MILA 1YCGA 4RHYA 1DO0A 2JIZD 1TJPB 3NONA 2BG8A 4OVKA 4F46A 1LBIA 2F17A 1IBRA 4TTRA 2RHMA 1PGBA 4LMRA 3PUKA 4WJOA 2BYVE 5DNDA 3U4AA 3JTMA 3TPCA 5I9BA 1C9EA 3TXAA 1NWCA 1NBME 4DK5A 1PR0A 2ORIA 5JBQA 5AVSA 1AO3A 2D2XA 4U6SA 4LECA 3M9XA 3PFWO 4L57A 3ZD8A 3LPDA 1BCSA 2GGSA 2INCC 3AEUA 3TOXA 2DETA 3OG5A 4PRYA 4WIAA 4IH1A 2BE7A 3A6EA 3TIFA 3LYLA 1UKCA 3V05A 1Z6YA 4D81A 5BSFA 1IYZA 4ZOBA 1Y6QA 1G55A 3DL7A 3WY9A 4XM1A 1XPJA 1QUFA 4FOTA 3N3BC 2HHJA 2GN9A 4RF5A 5I7FA 3DDUA 1V1OA 2VWGA 3VHXA 1ZOSA 2V7UA 5IH7A 1IM8A 3I9OA 2YZ3A 3NC4A 5DIFA 1WY8A 1OGYA 2XK5B 4A6EA 1FEZA 3EC7A 3LSTA 5FTLA 3HR4A 4XDZA 2EWMA 1IRXA 5K3FB 3U52E 2HV8A 1L4DB 4HQKA 3PQEA 2B30A 2V4MA 3O91A 4QU8A 4XJXA 1LLUA 2XCRB 1XT9B 3HGQA 3MMNA 1T1EA 2O1WA 1AUXA 3MJEA 4JXXA 2DHQA 4AJWA 1VZ8A 1ZXBA 5IP4D 3EQ6A 1JXQA 5EPUA 1ZD1A 1TF5A 3ZJVA 2VQ6A 3KE9A 4FT2A 3PRZA 2QIEB 2GD6A 2XAAA 3W8EA 2NXJA 2QDKA 3IIMA 2AA3A 3WIEA 3EF3A 3HM3A 4PXYA 1IQUA 3GT0A 5CG2A 2AYXA 4MV3A 3E48A 3ZBPA 5H3HA 2FWRA 1YZVA 4CQLA 1NM5A 2VUUA 3TZEA 3ZE7A 1PSWA 2HEIA 1UF0A 3F7OA 4B9KA 5LOVF 2R8YA 5BR8B 1N2CB 1X8JA 5HDQA 1U8UA 1M8PA 3FRJA 1KR3A 4RMAA 2B4TO 1RWKA 2G6TA 2I91A 2C2KA 2Y9MB 1HA5A 3V80A 4MV7A 4R9VA 3TRIA 1MJNA 1K27A 6REQB 4YCNA 3N6RA 4Y1EA 5I3CA 2CNBA 2DUMA 2QE6A 4OIFA 5C4MA 3VNUA 3NHSA 5JAZA 2OAP1 3O5AA 1WCV1 2B92A 2HREA 2FCRA 3ONEA 4BJ3A 1Z17A 2YJTD 3KAQA 2Q2QA 4BV9A 1NUQA 1FU7A 2SECE 5AW3A 3UT0A 2QM3A 5JJCA 4HB0A 1VHLA 1WQ4A 1XV5A 2WBLC 4REQA 1WUIS 1A4UA 1QRAA 1Z33A 4E6EA 1WB9A 2PZAA 3F9IA 1N2OA 5FKAC 2FMUA 2NUTA 1FLDA 2PA0A 3JVVA 3LT5A 4U2KA 3ZVNA 3ZDRA 3DZKA 4MGIE 3N0TA 4DDVA 1IM5A 1XD9A 4G26A 4MKHA 1L7QA 3G0OA 4UTOA 4QVKA 2F3SA 2D0IA 3OM8A 3WRWA 1M0WA 4N6GA 2GCOA 4PS0A 3Q14C 3WGVA 3ICPA 5LOVB 4KSYA 2JFZA 1NZDA 4A6XA 3ZDZB 4ACBA 3ETNA 5KHAA 3H6GA 4X1KA 2HJWA 5AWFC 2P2DA 3FVRA 3JAWB 1GG5A 3N75A 1UK6A 3WIVA 4ALKA 1JSZA 2DB3A 3SD5A 4YXWA 1EBFA 1YFZA 5IZCC 3GPLA 2P5TB 2IC5A 3N59A 2A67A 3MT8A 4EBBA 4HFNA 2W70A 3OZCA 3PREA 3TM4A 1JHZA 3E0XA 4QGBA 5C7YA 2QJTA 2FFRA 3Q87B 3GAAA 1NHGA 3TBLD 3KYCA 3ZRFA 4XUKA 4CR6A 5FXMA 1KYVA 1IU9A 4ZO4A 4WOPA 2JJ1A 3EZ9A 4H0NA 5CLIA 2DWQA 1UODA 1SXIA 1X8HA 1OX4A 3ODGA 4XDYA 4WN9B 2NMQA 1SVNA 1HYEA 3T99A 3IIKA 3HDHA 3IEPA 1SOAA 1QRUA 2QVZX 1NEKB 4CDNA 2P2LA 2HU5A 3KW5B 3A4MA 3ND9A 2PD3A 5LM6A 3SYLA 2GUGA 3NDIA 1C7QA 1YV9A 2MSNA 1P39A 2JIZA 3NWOA 1N6KA 1NI4B 2QTLA 3ROPA 3ERCA 3WRXC 4OI2A 1ITZA 3OLZA 4AU1A 1E3LA 5IMBA 1RRBA 3IBGA 4ILEA 3EPPA 1PLLA 2YWCA 2WD8A 4CM8B 4IRMA 5G53C 3G5LA 2MSKA 4EMUA 1UZAA 2A9OA 1REQB 4DIFA 4PK1A 4M9UA 3L06A 1X80B 3C5CA 3EVBA 5A6VA 3LUAA 2PN1A 3RCZA 3ONWA 4HQFA 1CY4A 1J1IA 1AG9A 4MH0R 1ORWA 2OZLA 5CT9A 3FMPB 4NNPA 3CMCO 3L84A 1QHYA 3I9FA 1R74A 4CV3A 4Z3KA 3CVWA 2XV1A 3WBJA 4L8WB 2CNWA 4EATA 3W5AA 5KX5F 1G6HA 3FOWA 1LX6A 1EFDN 2XUDA 2WPDA 1R8YA 4YO8A 3F1KA 1A8SA 2RHCA 2D7CA 3SIXA 1RAFA 5LE1A 3VJKA 4L0CA 3QKSB 1B6RA 2A30A 4K81B 521PA 3KJNA 5TNXA 4BV3A 5BO4B 4I9HA 4OXNA 4ZT6A 1XLWA 4WV3A 2O8EB 4N49A 2HW8A 2YVUA 3O83A 1TLFA 4IQ4A 2E21A 3R7FA 4QRHA 3V3XA 4A8JA 2BTNA 3DBRB 3T8MA 5ED4A 5EJEA 4LXIA 1ETHA 2OWEA 3TJRA 4R01A 3RUCA 3EH2A 3AV0B 4E14A 2MEKA 1E20A 1UBTS 2PLWA 2VA9A 2PL1A 2JI8A 2BF4A 1RQ2A 4NVRA 4UWRB 2GBLC 2QDSA 3NAZA 4N58A 2RI6A 5CGZA 3HBJA 4CEIB 4MP3A 1W8IA 2F3UA 3EWAA 4QOJA 2BEWB 2GMNA 2HU2A 1WGRA 1YNOA 5EXEA 3WZLA 1OWPA 2XMRA 2IEBA 3M6XA 3ZDEA 2YV3A 4EEXA 4MJ7A 3E8XA 5GM2A 3NP7A 4P34A 3RKSA 1NVDA 5JS8A 1M4VA 4HEQA 3EGOA 5LYJF 2J0MA 3U8ZA 4DR5B 2VWHA 2VNKA 3IUYA 3H5VA 4U7TB 5BSUA 1QGZA 2JZPA 5G0SA 2N9PC 4JLWA 5FUQA 3SHTA 2UYGA 2W98A 3KVVA 2D5CA 4LTUA 1ZK3A 2GHIA 2GT1A 5CURA 1T9KA 4KQFA 3JQ8A 4P4GA 4QSHA 5C23A 1X8LA 1XZNA 4CLOA 3NBUA 4QG7A 2OOKA 5DPXA 5KYGA 4JP1A 4C03A 2AWNA 4AG3A 1CK1A 3DL0A 4J8PA 1VSQA 3ZZ0A 1Y7HA 2W6JA 2VK8A 1ISSA 3VDMA 4HB3A 2VK4A 3GB9A 1M0TA 3KD2A 2AZMA 4QFBA 4NE2A 5AI9A 1XZMA 3OTIA 3AQ4A 1FFWA 2C0CA 3LX5A 2AC2A 2P9HA 1E8MA 3NWEA 4JJIA 1Y48E 4RAOA 2H7YA 2ZJYA 1K1EA 1RS0A 1EFUA 3D64A 4PS1A 1E9SA 1H6DA 3DHWC 5B58C 2WI8A 4PIPA 3BG5A 4GOOD 1I0ZA 1Y98A 4P58A 3RASA 1MTOA 4M8LA 4V1CB 4IHJB 3ER9A 5LYJB 1UBQA 3DE1X 2P9JA 1OI7A 2X1HA 2IIVA 3H9JA 4BE9A 2P5SA 1XDZA 3EUEA 2OKCA 2V4ZA 4JYZA 3SX2A 3E5RA 2X0IA 4XDCA 5HG2A 1BHJA 4EX7A 2GAJA 4LYEA 1FTQA 3ZDMC 1CUBA 3AR6A 3FKSA 1L5WA 1P2VA 3QLVA 5GZ6A 3H6HA 4BP0A 2H51A 2YXLA 2AJDA 4NJOA 4E1VA 1EVKA 5CT6A 1KH2A 4AWXA 1RPZA 1HYBA 3PSEB 1L5QA 1CU1A 4MJSB 5K0FA 3JX9A 2AQ2B 2RGRA 4FFMA 1N36B 4FCCA 3JAKB 1UJCA 3ZDCA 3MPUA 3K0EA 3UCXA 3NHKA 3IIEA 2ANBA 5KNBH 2GNPA 3RQSA 4FYMA 4OGKA 4QTZA 3WFZA 3WB2A 1AJEA 4UUOA 1T6YA 4TWIA 1M2OB 1W0JD 4ZVVA 1FFHA 2DZDA 3D6FA 1G9XA 1TM4E 1KQ3A 5GQSA 5EJ9A 3SLGA 1C0IA 4I5EA 4Q4JB 5BW8A 2CLMB 3W6UA 4CM9D 2YZNA 2QNBA 5D3QA 4DQXA 1XROA 4BRUA 4M60A 1JI0A 2PR2A 5FOWA 4J7XA 1T35A 3PFNA 1Q20A 4KFUA 5JPCA 4N6OA 3WICA 4MWDA 4AJKA 3O9MA 5BO5A 4ISBA 3X1YA 2QRVA 2OCAA 5JMWA 1F6BA 4N5HX 4OHRA 2JKZA 1JQEA 3B1YA 4U2FA 1G2PA 2IO2B 3D7RA 2V5AA 4LHZA 4C1CA 3GCGA 5HIKA 4X7PA 1SHLA 1T2AA 2NV6A 4Z7QB 1J8FA 3OE5A 2HBYA 1TVKA 4LF4B 2ZFUA 3RIGA 2CNDA 3TTSA 3HJUA 5J4VA 4W5RA 4NV0A 1LLCA 1HDRA 1TGYA 2HQOA 3KYDB 1T2DA 3PRPB 5IBCA 4TV9F 1XVAA 4UU8A 1L8QA 2ZE8A 1WG8A 4KR2A 1CZNA 1H93A 1K7XB 3LLSA 3QXSA 4DOMA 2Z1NA 3KE8A 3K9GA 5DASA 3M6UA 4PAQA 3Q40A 3L0BA 1S5PA 4PR0A 1DMSA 2O52A 3K9NA 3UAVA 4PSCA 1O6FA 2MJDA 1JXMA 2QVXX 2I4MA 5FX2A 4LW8A 3AIOA 1ECLA 4ZYXA 2Y1GA 3HJFA 2WE7A 3DZCA 2FP4A 4UE6A 2ZVDA 1IONA 5A1TA 2PKWA 3PK0A 5HYVA 1TC2A 1EUCA 2ACVA 2R2DA 4M7PA 3UEOA 3DEAA 2P7IA 1R5BA 3PYMA 4HPMB 1VJGA 3GGPA 1RXYA 3K0FB 5ECWA 4C6RA 1ENFA 1E2IA 1OXUA 2CKDA 1D1TA 4D1WA 2AX3A 3OTQA 3ZHCA 3CLUC 1VGRA 5KVQA 2FSGA 5CW2A 4F11A 3WNVA 2OZVA 1PBTA 1IN1A 5AHXA 4UC0A 3LYUA 2ZZKA 6LDHA 1MG5A 4LC9A 5J58A 1QGED 1WMEA 3L8YA 1I7SB 4YT0B 1N25A 3BBPA 1XAJA 4D3SA 2XUAA 2HF7A 5LLDA 1JV2B 3FA2A 3BJIC 4N7BA 2V6JA 4R0MA 4IJ6A 3K9QO 4IQFA 3CLTC 3NDRA 4B0PA 4S0XA 3NT5A 2PT5A 4AMBA 3WKCA 4YRCA 3Q15C 3THOA 5E7JA 4YP0A 4P3KA 4EB6A 4RD6A 1V5GA 4O63O 5A4JA 3ENZA 1APBA 3IXQA 3GPIA 5LM3A 1UGMA 1VJCA 2XBUA 4S3MA 4PQFA 4B81A 4I99A 4O1IA 2EKDA 3VX4A 5MGBA 1TGZB 3C1UA 3R66C 5A23A 2WHPA 4NICA 2ZG6A 3H1AA 3M6VA 3WLQA 3EOBI 1EM7A 4G11A 2WY2D 3PQ5A 3IAXA 1YN3A 3V8QA 4UAJA 1ZCBA 4BGDA 4YFYA 2VJKA 4CQMB 1JRPA 1NGSA 4W9DA 1LQUA 3QZUA 4F3TA 4UM8B 1IZZA 3RTEA 3H2ZA 5JD6A 4EF6A 2PQ6A 3IAM6 4YY3B 1ONOA 3UT5A 2K2QB 4LOHA 1EWKA 5PNTA 4RJLA 3QU9A 1FC0A 5AM5A 4DT1B 3MCZA 3TTVA 1K3UB 2BKLA 2GZ3A 2P2CA 3EVAA 2Y1EA 1VKJA 3RRFA 3LD9A 1WM1A 3OMWA 4RA9B 1E3IA 2ECFA 2QLMA 3LF1A 1YA8A 2CLFB 4LYJA 2IBSA 5H83A 4BEWA 5IM4A 2WQZA 2OB2A 4HSGA 3GFTA 4BVHA 4TRJA 5IN5A 1T4BA 3VPAA 3QH4A 2QSYA 1TYBE 3EUFA 3UJHA 4I8IA 3SFEB 2OAGA 3RBVA 1M66A 2QJSA 2E48A 5ITSA 2HLDD 4EXYA 4FJ2A 3MXTA 3F6CA 2C4VA 1VMIA 4DCJA 1T1RA 3L93A 1LB1B 1E7RA 1UAGA 2FUKA 1BH6A 2UUAB 1G3MA 1J0CA 3WYGA 1V37A 4QOHA 2XZOA 4XX5A 3VR8B 1DXOA 1A9ZA 2PBFA 1U3DA 3EPHA 3HSSA 4F4JA 2K1FA 1NMYA 3QPVA 3ZJ4A 4GR5A 4HZUA 2CBNA 4XLLA 3MLBA 3UMCA 2WAXA 1OAOA 1I4LD 4JNCA 2ACWA 1CZKA 3P71T 3Q9NA 4GX1A 4EYGA 1U02A 1NYTA 3O4GA 1UPCA 2XMDA 1NSTA 1TC1A 2O0MA 3JWGA 3DDCB 5DTEA 4UBLA 1YRYE 3EQ7A 4X7RA 4AC9A 2FPPA 1QH8A 4LZJA 3DWFA 5E4YA 4IFEA 4UASA 3SQNA 4KQKA 2PVSA 3MYRA 4ND1A 3RHZA 4PYQA 1WD7A 2ZUVA 5IUJC 3SBXA 2I99A 2IU4A 1M7HA 3ACCA 2F43B 1OU0A 2Q6KA 3HKCB 1KK1A 4C01A 1LFDB 1T34A 3OQHA 2HEGA 5KOHA 1EVJA 1NQ5A 1UMKA 1CJEA 4KGSA 3VVWB 1Q7GA 3GUYA 1TEXA 4XM2A 2C4KA 2J7PD 1F1JA 3GMSA 2OA0A 1DUIA 2IGTA 2WNSA 3C8HA 4Z4GA 1R6DA 1OBFO 4KLAA 3PG4A 1LXCA 1Q17A 1XAGA 2ZBQA 2XRMA 5J4KA 3EYWA 1JIIA 2YUIA 5IMSA 1Y0BA 3TQCA 3CPSA 3W5VA 4AX0B 3HZZA 3SS8A 1JLRA 2J9FA 2FVXA 1ZGZA 4BO6A 2AR7A 4OYHA 2XCOA 3AUUA 1ADJA 1Z4JA 3AEUB 4EJSB 1MBZA 3I23A 2OBNA 4ESOA 3PFBA 4IR7A 1JA1A 3NEAA 1GGKA 3BT7A 3IL2A 2AWOA 1ZJYA 4IIVA 4EO7A 1UWXA 2C42A 4Q48A 3IXSA 3VO9A 1T5HX 2LEKA 4HAYA 1Z5PA 1KZGB 5LCHA 5I7UA 1XT6A 1PGNA 4EI9A 2Q5CA 1T1SA 4OA8A 1J7KA 5KZMB 1ECJA 2Q41A 3QVOA 5D5HA 1O1YA 2HJHA 4EY4A 4DUYB 1SE3A 2VDPB 2IQIA 1WAMA 4UHFA 1ORRA 4P4UA 3A6ZA 1QIEA 2RBGA 1PR1A 5DNVA 4I3FA 5ERYA 1Z5GA 3QPBA 4C2UA 2Z0MA 4W8OA 3VDNB 3QITA 4PX9A 1PAUA 4S1WA 2CJFA 4O3FA 4LRSB 2PTLA 4C0BA 3UXHA 4EB8A 1Q1NA 1KDTA 4LRYA 4TXMA 2Q2OA 1JBQA 2WHXA 5ALTA 2PG3A 1O95D 1V43A 1Z39A 4V3BA 4KYVA 5MFZA 3VR3D 4DHZE 3TL6A 3RYCA 4L4SA 1BHO1 3CF6R 1EQAA 5HHDG 4RDIA 4F0JA 1H65A 4KWEA 5DN9A 4D41A 1QZXA 4MUKA 1KO8A 1Q10A 5ECGC 4KYIB 2B9VA 1A8HA 3B7WA 1X38A 2V3VA 4BVGA 1HOXA 2NPFA 3QCAA 3VPHA 5C31A 2APJA 2H4FA 4K9DA 4KIUA 1WI0A 4CQLB 5HCIA 3TN7A 4K3VA 3BWDD 4RXTA 4FE3A 2QYOA 1EFHA 3J80A 4C7XA 4DREA 1HKHA 2VIIA 3LPMA 3OZSA 3WWZA 1D09A 3L82B 2MYTA 5CVDA 2I54A 3KJGA 2XBLA 5TVKA 5BV8A 3QWZB 4BFUA 3R20A 5KTOA 1G7CA 1QFJA 3GJRA 3R0XA 2AK2A 3L10B 4LCJA 3ILXA 2VRCA 1OEYJ 1GT91 1A98A 2CYBA 3PIDA 2NV0A 5HKKD 1SC3A 2D11A 4PO3X 4WDRA 1ZC3A 1HLDA 1DWOA 4AZ3B 1SH7A 3IP1A 2OOBB 2OP0A 3NZEA 1P5FA 3GGCA 4RY0A 5LDGA 1N33B 4DBLE 5HP4A 4HOYA 2AMJA 5F5XA 5K8UA 2H1HA 3ZHYA 2E4WA 2LKCA 4NYJR 1Z29A 1E5VA 4XAQA 4B8WA 4ENVA 1KFKB 4RPGA 5C5EA 1BYIA 1Z4PX 1JHMA 1YCHA 2H59A 3FYUA 2ZPYA 5E6PA 2HWYA 1YCDA 1H0HA 3I62A 4N9WA 1TU4A 1W8DA 2AIRA 2DWPA 3OLQA 5LOVA 3J9CA 3PQFA 4JOSA 3CM0A 3S0JA 5F4ZA 3BL6A 4HLEA 2WAOA 5MPOA 2V0CA 3SX4A 2YVQA 1Y4SA 2XUJA 1Y4DE 3JWHA 4RVNA 3K1JA 3D3QA 2DT8A 1T6BX 2GCOB 1R4MI 1C9KA 4YCAA 3JAWA 4TTVA 3ETLA 2VP9A 1UH6A 4P3YA 3W1SC 3LKDA 4Q37A 1Z0SA 1E9RA 1J0DA 4C05A 3OBIA 3WXMA 5HRUA 3FPCA 1UBHS 4IIFA 4MVJH 1SHZA 1Z36A 1SXTA 3K0AB 1OLOA 3OECA 1J33A 1P6XA 5HI1A 6GPBA 2A33A 2PVOD 5AYVA 3BILA 5JNLA 3ILHA 1UBFA 3SY8A 4LMAA 1JPUA 2JYEA 3ANMA 2FSFA 3MAAC 1DLIA 1FFCA 4LXQA 4PZLA 2MMCA 3KYCB 2CN1A 1VJ1A 2FRDA 3AKZA 2ZVPX 2ZE5A 1T4GA 1KHTA 1CNMA 3BD7A 3BWUD 3C19A 1YVRA 2XDAA 3U81A 1OX4B 1AMNA 4YC7A 4FFPA 5DYTA 3E03A 5F51A 3CGWA 1NI4A 1RE1A 2IXGA 3BJZA 2BG6A 2HNKA 5K4MA 1UANA 5FBVB 4DPMA 1UZLA 4DDKA 3C70A 3U60B 1N5LA 3QXJA 4O2LA 2JSVX 2NXEA 4HEHA 2NVUI 5J5CA 5CB8A 5HKHA 1I2CA 2CMGA 3FPEA 2I65A 2PS1A 2VHUA 2FQWA 2R6HA 3K09A 1X80A 2CB0A 2LDBA 3IOGA 4WFIA 3AF5A 3ZY6A 2EDCA 1ZXIA 1IXSB 1WUPA 5MHTA 3PNYA 1E8WA 4FGWA 2QZ9A 4M0EA 2IZ5A 3KYDD 4LBZA 3UYKA 4C07A 4MR8A 4M1MA 3UT6A 1HE2A 1A8UA 5DTRA 1N6OA 3DBHI 3MIZA 1JH8A 2JIPA 1QIIA 2GYVA 4FSHA 3X1DA 1ZH0A 1UWCA 1GCOA 1EE1A 3HLYA 2YYAA 3BXOA 1UDBA 2WZQA 4BECA 1J23A 2JCSA 2JL1A 3HB4X 1RMQA 4B45A 3ZHSA 4DQKA 3QSYA 1XEFA 3R7QA 3AHIA 2LW7A 5KNLA 3ZZMA 3UTDA 3QKSA 2AFRA 4CMHA 4IIUA 1RBQA 4J0FA 4E7PA 4Y6GB 1EWCA 5K7SA 2O8EA 3I04A 1YJQA 4QBKA 2P1EA 3SEBA 1W2GA 2Q27A 4R3NA 2XEXA 5AUNB 4X1IB 1CWUA 3DBRA 1JQDA 1WYWB 1T8RA 1CS4C 3EFBA 3EIXA 1XDWA 5KNDH 3RU2A 4KQJA 4U6QA 4CF6A 2JCYA 4TMFA 1KQFA 4A8JB 4L5BA 1L5NA 1LM8B 3LLMA 3S27A 4OQFA 4C4YA 3EGRA 2DC1A 3IPXA 1KJ9A 4XWWA 1EFTA 4DSUA 4XC2A 3GQBA 1JWAD 2PO5A 5GINE 3LDZE 2ZI3A 2EC5A 5KX5A 1E9VA 3VOSA 2OXRA 5A4IS 2K3UA 3C85A 3MGAA 1ICIA 2O6HA 1E2UA 3QMPA 2NVBA 3BS4A 2XYHA 2V6BA 4HDNA 2MWSB 1EK0A 4TTQA 1XZHA 3HMQA 1IY0A 4I2VA 2X3UA 3BE8A 4B4UA 3D54D 2V1YA 3KJHA 5I4IA 3U61B 1AKUA 1V3VA 4PZEA 5KTYA 5IDXA 4H7JA 4XX0A 1MX3A 3L4JA 5ESXA 3STYA 1GQYA 3FZGA 4UXJA 3EZFA 3HO6A 3BEDA 4MDYA 1KVTA 4FUQA 4CQMD 3DB1A 4ARSA 3JQ8B 1TIBA 4MB2A 5KU1A 4ITVA 2FUHB 1FRRA 4K1XA 4CLOB 3VC3A 3OQOA 4IVRA 4XSHA 1TVCA 2EERA 3FFTA 1KY3A 2HQ1A 3UENA 3BXZA 4GPIB 1JR3A 3QW4B 3PPIA 2E85A 2ZM6B 1GHTA 1DRKA 2LXAA 2RB4A 4DNQA 3PZBA 1THZA 1U7DA 5DNEA 4IHJA 1BHQ1 1IPEA 5DKFA 5LYJA 3KZCA 2QZJA 2WYIA 4HN9A 1P17A 5HIJA 4O25A 1DG9A 4LY3A 1UFRA 1W9HA 3PT2B 3NM6B 1X19A 2QTWB 2FPRA 2KDFB 2HIGA 1SE2A 1NY6A 5ARDA 5CFNA 2JH8A 4RCYA 4QDXA 2D1YA 3EYAA 5K2MA 1SSNA 1IRIA 2FTKE 2TRSB 2ICIA 1W5TA 1VRVA 3TLEA 1HSZA 4PG6A 1T2CA 2JGKA 4NQZA 1ZX1A 2K4MA 1BE0A 4QQ8A 5BUSA 2LWIA 4K8OA 4BTVA 5JEEA 5FYDA 1M2WA 3OSZA 5LKAA 3HJBA 2PUTA 6YASA 2Y0PA 2GVZC 3E9ZA 2R0QC 1T9GS 1XQ9A 4LJYA 3QELB 1P0RA 4AW9A 4D92A 1IPHA 4QQFA 4WSOA 3MTQA 3E7XA 3SSAA 4P3NA 4LOAA 5FF9A 3P96A 4HRVA 5A9TA 1EUQA 3LBYA 4ES6A 5DBIA 4KYUA 5K4NA 4OK6A 5AVRA 4C1FA 3ZZ1A 3HJRA 4YP5A 1LDYA 1KSJA 5E3IA 3SQMA 4DMUB 2G6BA 1AHPA 3EH1A 5A5EA 1LZLA 2RBEA 5G0VA 1L0BA 4GL4A 2PMVA 1OBHA 1T0UA 1W75A 4BDSA 4ZQCB 3HYCA 1X8XA 2LGYA 2ZJ3A 4B8ZA 2P1DA 5C7LO 3T7KA 3VKUA 1P1CA 5FQAA 3PHCA 2BFDA 1I3CA 1VB5A 4S2UA 1I01A 1N2JA 5JDCC 1GKKA 3V1NA 5IT4A 4AKIA 1DQNA 1Z83A 1G64A 1X7DA 3ZGZA 4GBGA 2H3EA 3V8EA 1H5NA 1PR5A 2XQFA 1XVUA 3P4PB 1EHYA 3KAKA 3MHPA 2VDKB 5FO0A 3TRHA 1E64A 2MBBB 1U9ZA 2CYAA 1T5IA 2FCQA 1GPKA 3UB4A 3OJXA 4WLNA 2H8GA 3EFHA 3QQPA 1N77A 2OESA 2QR3A 1XVTA 3B78A 1RC1A 4PPFA 1T0YA 3JQRA 1IBMB 1JFLA 5BQ5A 4DLRA 4JR2A 2FJUA 3RC7A 4M76B 4Q3DA 4B3RB 5ACWA 1FRFS 2IIQA 4HADA 3JSAA 4L16A 2L0XA 2Z2KA 1QDUA 1XNQB 1TMYA 5THKA 4A1OA 4HGNA 4BNIA 2DQKA 3STTA 5BRAA 1P4HA 7AT1A 2YHAA 3AINA 1U80A 2FP4B 4DUPA 4UFOA 4HTFA 3T1VA 2M1ZA 3K0FA 1J2TA 1GCGA 1EUCB 5BYAA 4KLNA 3DQVA 4Z4QA 1JSLA 5C8XA 5AW1A 1EBUA 2EKZA 1L7AA 1Z0JA 2UXDB 2X4LA 1BG6A 1Y4UA 4FJ1A 2HMWA 4TV9A 2G80A 1NRJB 2ZULA 2LBPA 5SZJA 2UYYA 2J0SA 4YSKA 1ZGBA 1XXGA 4D46A 2BFEA 3AP3A 4RAMA 4KXFB 3MJHA 2OD7A 4KACA 5K99A 1ZVMA 3PKJA 3FBTA 4QPDA 3KXLA 1M94A 5FO1A 1XRRA 3IKVA 2X1LA 3NUQA 2O8VA 2IOHA 2J0VA 4YVFA 4AKHA 1ZVQA 2ET6A 2WF6A 4NZ9A 4RDXA 2IH2A 5J4YA 3C3CA 1Z6ZA 1OBOA 4RL2A 1JYEA 3JYLA 2OAEA 4DVGA 4ACFA 4LZAA 1EPUA 4EB6B 2IF0A 7ABPA 2JFNA 2HCBA 3SICE 3GVPA 1U1FA 3A70A 2YNMC 2XA2A 5LQUA 3RW9A 5HE9A 4PINA 1QTIA 1PT6A 3NFRA 5ADWA 4NZMA 4BNLA 1NN3A 3SIRA 2JVCA 3TPFA 4JQOA 3HYTA 1VMEA 3D6TB 4YXDB 421PA 4HGPA 3BZDB 1IH8A 1PTJC 3ESDA 3ZLJA 3A3PA 1FTNA 2Y0BA 3SSNA 2FR0A 1T4CA 2H4XA 2WJHA 2WWTA 1RBMA 2PL3A 4CLEA 4WXEA 1B73A 5TMPA 4M1OA 5J2RA 1M0SA 4M01A 3F7TA 2P8JA 3L16A 5F1KA 4Z4CA 2ZAGA 3C2QA 3JYNA 4GMHA 2IUYA 5DRTA 4Q9NA 1YZGA 3BVGA 1GTMA 2V8OA 2DJIA 4C9BA 3E7FA 2FG6C 4IOLA 1X7ZA 4F6HA 3QKRB 2IX9A 4QU0A 4HUQA 2CVOA 2FZ5A 3NQ41 4BNVA 4YHHB 1G5IA 4UPDA 2ZI5A 5E1OA 3UUGA 1NOJA 3WA7A 5JDIA 3FC4A 4BKOA 1YRLA 3JQBC 3QPDA 2J3DA 4AB1A 5A3VA 5AXDA 1DJNA 3O8RA 3TG8A 4CKEA 5KWSA 5H02A 4YXWD 3L43A 1J8QA 4QJ3A 4I8DA 3V3TA 3BWEA 1DBIA 4FI3F 2DQ4A 1B6TA 1H5UA 1KBOA 2I7TA 3T5CA 1Y3DE 1XELA 4HO1X 2JK0A 1YR3A 2ZIWB 5L53A 3KYCD 3VR2D 4ZHSA 4H7KA 5I7RA 1DAEA 1E2JA 1RPJA 2JAHA 4Q3NA 2JJ1D 2BS3B 3Q3FA 1LC3A 4V0HA 1N61A 1XCMA 1RKXA 1FMFA 2DZMA 4V03A 4QX6A 4FOPA 2QRGA 3AVQA 3T9AA 2CYCA 2G1EA 2FPPB 4JEIA 1QH8B 5HX7A 2GK7A 3P9YA 1DOYA 3J7TA 5IC5A 2C3YA 1IZ0A 1CRZA 1SWVA 3EZXA 4WOJA 1HLPA 1ZH4A 1XQQA 2Q3CA 3N1ZC 2HZBA 1L7RA 1ACJA 5AHKA 3FXAA 1DGQA 1DYQA 1DCKA 3VU1A 5CGQB 3PT5A 1PKXA 4Y6SA 3W9UA 2HMSA 5KOHB 3NOOA 1FTSA 5LDDC 3C8MA 4BFTA 2C20A 5C7OO 3IOYA 1VHJA 3GROA 4IV0A 3RK1A 4D5GA 1Z56C 2R1TB 3GLHE 3MEQA 3RD5A 5LJIA 3R3UA 4Q47A 2JS7A 1G8SA 4MI1A 2F6RA 1FCJA 2AJLI 4EJSA 2HA3A 4WGFA 3W5VB 2BPSA 1YKGA 2WJVA 5A7HA 2DYBA 2WTNA 3FB1A 2J9FB 2CLKB 2LHEA 1QORA 2XUIA 2UYOA 3FILB 3K1TA 1V3QE 1NXQA 1Z2CA 1JWUD 2WK1A 4UDYX 4LTNA 3EXIB 4RY2A 2CNWD 2BI8A 1KFBB 4IM7A 4MQLA 3LC0A 3C97A 2Y0CA 1KRWA 5LSAA 5D7NA 2WHYA 1M7GA 2A1TS 1NE7A 3ZC3A 2WPDD 3ZE6A 2WQ7A 4CG3A 5IVPA 2OHHA 3GG9A 2EJUA 1TJ5A 3UZUA 1AH2A 4GLLA 3JD2A 5KSPA 1FQJA 2IBTA 1ND6A 2H1FA 2TMGA 1E9EA 4DXFA 3TSAA 2B3TA 4GEKA 2WC1A 3ORHA 1IBXA 4TTPA 3WWDA 3RR2A 3P0EA 1D5MC 1KEWA 3A9WA 3T3GA 2D1QA 2AI1A 2C61A 1NBEA 1UZUA 1VLJA 4CL0A 1XOIA 2MHJA 2VRRB 4FZVA 1V1RB 2GESA 3K5PA 3DA8A 3PVZA 2RGNA 1F52A 1GILA 1CUCA 5HQJA 4AP4C 1YNTE 3H1FA 1KJZA 2CKHB 4ESHA 5LC1A 4OKIA 5EE9A 4FDTA 4M22A 4ZVSA 2Q5FA 3JR3A 1CJUC 1GNUA 3NBKA 5AJHA 2I2AA 5B5SA 2CVFA 3RYCB 5HKOA 1C0PA 2GUWA 4I1SA 1D2AA 3FVTA 4F2GA 2QZ4A 3WMRA 1A9TA 4HB4A 2GFQA 3E35A 1WO8A 3T41A 3CSSA 1DPFA 3HVZA 5CPFA 4YFVA 2WXHA 3ZCVA 1X77A 2FV8A 4UNIA 2PO7A 4MWEA 5CVTA 5A3RA 2VC2B 1X9GA 3DAYA 3WP1B 5U4QA 1DO8A 2WTAA 1Z35A 2JAPA 1ZW7A 3AUFA 1IEQA 1W36D 4P92A 2YV1A 4PZ0A 3ETCA 3LA6A 3TH5A 4AZ3A 1KSHA 4PAGA 9LDBA 3LZ6A 1YWGO 1YZFA 2RIPA 1PZNA 4E2WA 3QE9Y 1EGQA 3OKCA 3KQHA 2PEAA 2J09A 4I6LB 3PEFA 3PITA 3IERA 3H2JA 4FINA 2W6JD 4CG2A 3VKHA 1VMDA 2QA5A 2XNSA 3RRYA 3BSWA 4Y67A 1IZ8A 1TXGA 4Y8VA 2YOFA 3DONA 2Y3IA 1HNNA 2LKDA 5LQMA 3TUOA 3L01A 4IL5A 1B93A 4FT4A 1YB4A 2AJCA 3FRIA 1Z0UA 3PHHA 4MROA 3FYUB 1EGVB 3WE7A 2E4VA 1DJPA 3P2UA 2CG3A 3DKIA 1YZQA 4YAWA 2JB9A 3WB0A 4JBWA 1E5XA 1FSPA 4UCWA 4JWKA 3JD3A 3NU1A 1AX9A 2I6QA 2IYFA 4MUNA 4IM0A 1Q7BA 2GBCA 3K0AA 1GUDA 2YYZA 3FKSD 4KHPB 1W48A 4LNKA 1ODLA 5E9JA 1OSNA 3PCXA 4G5RA 3RFXA 4K86A 2G9HD 1H2FA 2SAKA 4DJJA 2BJWA 1I2ZA 3T9MA 2JIRA 4IRXA 5K3DA 5IFLA 3TKAA 1QF9A 4DDUA 2VLIA 2CFCA 3QF7A 4RULA 2QV7A 1JF8A 2Q21A 2VPPA 1NQTA 3KKQA 2ZB7A 1T5DX 4UNSA 4P5EA 1U8TA 4UHBA 3R7SA 3LP5A 1QRSA 4MB0A 2UVQA 5M7EA 2KBFA 3VR2A 3K0CC 4DPLA 1PVOA 5KDDA 1V0JA 1RXSA 3E53A 4JLUA 2CBXA 1H2EA 2BHRA 1UZNA 4F4DA 1LI7A 2ZYSA 2V0GA 1RYHA 2UWQA 2PYDA 4MYDA 2Z4TA 3DJFA 3VU8A 2NUAB 3HXTA 1P7CA 2F90A 4NFLA 4IM2A 5FNVF 2C77A 2RC6A 1B2RA 1DL5A 1JIVA 2QCZA 5TQVA 3W04A 1RYFA 4DCSA 4UOZA 4MRAA 2ECOA 3G8YA 4B3FX 4YBRA 4DM3A 4AOFA 1KPIA 4O98A 2ZRHA 4JWSC 3PVSA 3G1UA 1U0SY 4Q6BA 5FLXA 4C0WA 4YV2A 4KFRA 4AECA 4ZANA 1CQPA 1HDGO 2CLLB 4EHJA 3O1HB 2RHOA 1E5QA 4GDFA 3LXMA 2E4UA 5KJ1A 4LV6A 5KJCA 4IIDA 2YS7A 1UELA 3SNKA 3CKMA 3C8UA 4LDTD 4MR8B 2EWVA 2GR9A 3NZ3A 3UK7A 4V0RA 3RIMA 4J3NA 2WXRA 3JD1A 1YQDA 3UJ7A 4KPGA 4DLWA 4W5QA 4MV0A 2QUIA 1GC7A 1DQPA 4PRLA 5J47A 1SUIA 2PX8A 5IT5A 3JZAA 4H60A 4BKTA 1M2KA 4DV3B 1TM3E 2D0DA 4IWQA 5B15A 1G1MA 1BZYA 4CMBA 4X1IA 3ZDDA 3DVGX 5AVJA 4EY3A 3AEBB 4O1MA 3U56A 5FCDA 1ZPSA 4OLAA 2C3PA 2F3TA 5C9ZA 3C3KA 3B5IA 4CTKA 4KXUA 1ZD3A 5EZSA 4EBFA 4MQBA 3TGPA 5JD5A 5IJ9B 4MACA 1WVMA 1ZITA 2GLUA 3AF0A 1CRWG 5KCMA 4YJGA 3VV3A 4KQ9A 2ZIEA 2LCFA 3SDBA 1XTOA 2ZUTA 5LBTA 4GX5A 2WXLA 4LVOA 3SJUA 5F35A 3BCUA 1O7JA 3I5YA 2IY1B 4W8HA 1CYDA 5CB6A 4FFBB 2Q3DA 2AQIA 1Z16A 2R4UA 1KBQA 1CVIA 1HPLA 5L3SA 4HN2A 2HMYB 2XAUA 1YE8A 3UKJA 1K7CA 1WPQA 2I3DA 2FEPA 1OLUB 1IBLB 1MGPA 4ZWNA 1RLUA 1YVPA 3GQBB 4WRRA 3SQOA 4UHHA 2ABWA 5KX5B 1RD4A 1L0YB 3BH0A 3EQ8A 4AWYB 5ALGA 4CIVA 4LOJA 3QXHA 2VNSA 1T4DA 2GRJA 4BZXA 3N8KA 2LNDA 3IO5A 1UFOA 1LI5A 3KWMA 1E3SA 4D8UA 1M6VA 1D7OA 1KYIA 1PYDA 4HDNB 2NUBA 1FUKA 4H4EA 1K4YA 5AXBA 2G45B 2IUSA 1DEOA 2V97A 3K32A 5LUAA 1WABA 5HQ3A 1RI5A 2WTEA 1WJ4A 4XX0B 3E3AA 3N30A 2WSMA 2X38A 1JHOA 1FXTB 3LDGA 1E7QA 4PGGA 2GXAA 4REOA 1UXGA 2V3SA 3LHSA 3CLRC 4OTZA 4G0YA 3P0RA 4C4VA 5AEBA 2R61A 4I1VA 1OGIA 1GJZA 1LPSA 5GOTA 3D4PA 1IOZA 3SKYA 2EEPA 3F2IA 3LIPA 1GAWA 5J2UF 1YHYA 1LBQA 4R2LA 4F2PA 3HTXA 4YX9A 3H2IA 1GNSA 1ICEA 4BZQA 3ZOZA 4LJ5A 4BC1A 4GPD1 2UYXA 2ZRFA 3PRMB 3RYIB 3CLSC 3BVMA 1YGYA 5C35A 3VZSA 4PGFA 1GYRA 4F3YA 5LIPA 3OU6A 3U7GA 1V1MB 4JT9A 4LGCA 3IHKA 4BV2A 1AMUA 1NBFC 2NV2B 2TS1A 2BI7A 2H31A 3QARA 4DLLA 3HRKA 1N3IA 1D2MA 4G1EB 1M76A 3QM1A 2D0OB 3VR6A 2G9RA 4DSAA 5ALUA 2GD0A 2ZW9A 4KSKC 2IYLD 2FPGA 4LFBB 1OGJA 2BGNA 2FU5C 1YNSA 4AF7A 3GFFA 3JPWA 4N3BA 2DXIA 3A1QB 1D5XC 1IK6A 5FWAA 3OLYA 3EULA 3AM9A 3A37A 3QELA 3GVCA 1X42A 4JB2A 3FTCA 1BDMA 2EL7A 4G0PA 2BI4A 4BGIA 2VDOB 2GXQA 3AEZA 3BE4A 3HXMA 2BDTA 3P0JA 3UMBA 3UMMA 2V7TA 4YLEA 4UHKA 4Z9AA 3ZWMA 3DHGC 5J2UB 4M1ZA 2Q6LA 2FSIA 4MPTA 3RIXA 3C8ZA 3KSUA 2ZJDA 2P6MA 1KI7A 3L0CA 1SC9A 2KHZA 1JI3A 5ES3A 4NDAA 4HUJA 3CH6A 4NQ5A 3SZGA 2IS4A 1OXSC 1NXVA 1P3Y1 2HF9A 3VKVA 3R41A 4XW2A 1C3EA 4JC0A 3DOHA 1G8JA 1M8GA 3AW8A 4GI5A 4EARA 4PFQA 1YQWA 1JXOA 1GCUA 5JJBA 3W5SA 4B3BA 2QX4A 2PSJA 1WXHA 2P90A 2EX0A 1K7SN 2DECA 5AVXA 4EFMA 3ZDQA 4IDFA 1ECGA 3DYVA 1KM7A 1MJFA 2BFDB 2EJTA 3NTRA 5I01A 3AUXA 2TYSB 2Q5QA 5JLAA 1OH6A 4MZDA 2WT9A 3D8HA 3D7SA 3QQ5A 1GFIA 3AY7A 2KLGA 2JH3A 3G2OA 2MBHA 1KU6A 2HMAA 4RWEA 1E89A 2EW1A 4A7PA 2OGTA 4HT3B 4PZCA 1AU9A 2ATCA 3P26A 2O2XA 2BP7B 5TIIA 3H5NA 2WWXA 5DV9A 1OWNA 1M1YE 4BEVA 3CCCA 1VE7A 1S2GA 3IESA 2CDAA 3IUNA 1GAEO 2QGFA 2NW6A 4MB6A 2PLAA 2ZVQX 5T3UA 1OEYA 1A7UA 3HFRA 1DC6A 2PKQO 3PIIA 3F7NA 3BHIA 4G5HA 2CHWA 2NO6A 4PNZA 5GP1A 1IY8A 2P75A 5K0EA 6AT1A 1PDXA 2QM8A 1L5HB 3ESCA 4AO7A 4J29A 3ZWKA 2WU5B 4NYMQ 3BF7A 2ZR8A 2ZR7A 4NCIA 4FBJB 3HA3A 2ZJFA 3UJ8A 1PGXA 4X60A 1Z7YA 3JV7A 5KBYA 1MENA 3ZCUA 2XEWA 4E1AA 3WLPA 4HTFB 1HMPA 1NR5A 1T3TA 3UKOA 4NBUA 2XUZA 1W25A 2JGJA 4UW9A 1WXGA 3T1TA 2CL5A 3AKCA 1QQ7A 1GEEA 4KGTA 1KYQA 4WE3A 3TLMA 2H54A 1U4OA 2PLFA 4MGYR 3UIOB 3RVOA 3V8BA 3AFGA 3EF0A 4GP9A 2X23A 3W7AA 4ZAZA 2G1PA 4TV9B 4ARVA 1FU8A 3P9ZA 3P4SB 1EP3B 3BVPA 1LJ8A 4IX1A 4RNDB 2J9RA 5JRZA 4TWJA 2VDNB 2BFEB 4UU0A 1Y44A 5GZ3A 4A82A 4DLNA 3HYRA 4ZOLF 1T43A 1BXZA 3G0CA 1P0MA 2Z6AA 1O6BA 1KWKA 5KQLA 5G55A 4AWAA 2IDYA 2ZYWX 1GUZA 2AN4A 4JROA 3PXGA 3OZEA 3QUQA 1O0SA 2VKQA 2YJGA 2NM0A 4NZOA 4TTJA 1R0YA 5C37A 3EFCA 3HZRA 4WOKA 1QYVA 2XCTB 2VRCD 4ARUA 1XJQA 3AVWA 3OJCA 1AUQA 4TSFA 5H70A 1G38A 3F3MA 3I83A 3DGEC 2BBWA 4MYRA 4IAOA 2KJRA 1BQEA 3WHIA 2RD2A 5D51S 2FWJA 3JALA 4OHFA 2P1ZA 4ZRJA 4JJZA 2X5JO 3CTPA 3RKRA 3J81A 3TP9A 1SG0A 4KOAA 2WVGA 5DULA 2PZGA 4HAUA 2PAFA 4X57B 4XQ0A 3A6DA 1T4CB 5B53A 5JPDA 2AFHE 4KN8A 4LVCA 4LJ6A 2FHPA 3W77A 4EA8A 1E6EA 5GM1A 4DRZA 5AQ1A 3GCXA 1I2DA 1U28A 5AJLA 3NORA 3QKRA 1DWUA 3LZDA 3PVCA 3IIJA 1YX5B 4KR9A 3L4SO 1E2QA 5CR9A 3QE4A 4ZTBA 3WK7A 4D4IA 1Y1PA 4OZBA 4WT7A 1U4NA 1J8MF 1X7ZB 2B1JA 3SPXA 4CF4A 4HUQB 1NVVR 3HB7A 4OQNA 5FJJA 3TCXB 2QVLA 3ZZUA 3ESZA 2VYFA 3WAPA 3REFA 3N6XA 1KO1A 2ZKIA 2C4WA 2HPVA 3TG2A 3K6JA 1SIWA 3HPRA 3T5BA 4CKEB 3DHCA 1YR2A 1D2HA 1SWWA 1VLVA 2B36A 1XYYA 3FCUB 1K4MA 4U8GA 5FBWB 4NZLB 3LLCA 3JAMA 1TQ4A 1XK6A 1PSDA 3FNEA 3WLIA 2PQMA 4GKAA 3W8RA 2Z2ZA 4MPJA 1CCWA 4D3YA 2BRUC 3TOCA 2FPWA 1OY1A 1RYYA 1YQGA 1D4FA 3H5TA 1N6IA 4CEHA 3GJZA 4EGQA 4RTNA 3ONSA 3L41A 1Q15A 5EXTA 3UPTA 4FFWA 3A6HA 3WL4A 3OTWA 1GRVA 4MIOA 2QRMA 4LXHA 2D62A 1LS1A 2PKCA 2FLWA 3TL5A 3EGVA 2R1TA 1OILA 5FUXA 3RSFA 5IS2A 3KTOA 4ZRDA 4JXJA 4PR3A 4WWOA 1IDN1 4F5ZA 2FOIA 1J5EB 3T9EA 1DMRA 4YP7A 4HRAA 2ISCA 1JUDA 3D43A 5KKNB 5C5DA 1YIOA 2QN7A 2Z0DB 4GSKA 4NJ6A 5NULA 4UNNA 4E2YA 3UFXA 4O29A 4PYLA 3RTBA 1XEAA 4F85A 3LO5A 3FILA 3W4KA 2BMFA 4OKNA 2XB9A 5CT8A 3EXIA 3SS7X 2HYIC 1I6LA 1T25A 3H1PA 3EOAI 3II6X 1KFEB 3PGMA 3ET5A 5JZOA 4RD0A 3B48A 4BNDB 4GUAA 5HH5A 1WRBA 1NYRA 1JHXA 4HGYA 2DPYA 5KQSA 1U2GC 3KKZA 4XIYA 3EZ6A 2RONA 2ZBGA 2IO0B 4KKXB 2DFNA 2KPOA 3ML8A 1U99A 3M33A 1JMYA 4YL8A 2XKJE 4DBGA 3EVCA 1Y3IA 4UZEA 2W6NA 5LPNA 2Q46A 4Q5IA 1P0QA 1KIFA 1NW3A 4ZZIA 1V1RA 3CFYA 5FB3A 1GPH1 1QSGA 1IBXB 1RRKA 5WRFA 4YT2A 1GSAA 3COPA 5C2JB 3ZUGA 2VHXA 3PSHA 4PLYA 3WIMA 2IYUA 3T8YA 3PGEA 3HJGA 4EL0A 2CSUA 5H80A 3TLJA 5JS6A 3KQNA 1ZRHA 1L3BA 4C06A 3ZLTA 3ETHA 5F7XA 1A5BB 3UJCA 4CODB 5KREA 3RJTA 5K8TA 3EECA 1ADBA 1Y7PA 4EZLA 2XQJA 3PX7A 4A3PA 2Q0SA 4R1QA 1FSGA 4RE6A 4F84A 4QDZA 4QOSA 1IWOA 2Y92A 1XWIA 4MGZR 1R8SA 2YINC 5AZFA 3UK0A 4ZQIA 1MZVA 2EQ5A 3BIWA 3DL2A 2QRKA 2GD1O 3MT9A 4V0NA 2ZQYA 4BFSA 2Z6UA 2J87A 2R2AA 3LBIA 4DV6B 3BE6A 2PWYA 3AI1A 2CUNA 2Z5LA 1C41A 2YYYA 4ZREA 2J0QA 2HF2A 4DJAA 3HY6A 1ZGHA 4M9ZA 4L76A 2O19A 1VZ6A 4LRXA 2OPBA 1FS5A 3EN0A 2WVJA 3JQDA 5KEIA 1VSVA 4E6PA 5GIOE 5DISB 3I0VA 2IS1A 4RPKA 4OHOA 1G5HA 1ARZA 1M2FA 3TEZA 4B2PA 1SKYB 3PKIA 4YJKA 2GSWA 4IUBS 4KGZA 1IN5A 2ZNBA 3ST7A 1EHIA 1OV6A 2Q4OA 3ZCXA 2P62A 1KGSA 4HATA 2AQ1B 4Y98A 3DXFA 1JR3D 3WB1A 4MPDA 1E6CA 1MO4A 3QYJA 4JSRA 2LFIA 2WXOA 4HMOA 1E32A 4XA8A 5D2CA 3OQMA 3ZLVA 2RI0A 3HCRA 4K05A 1Z2OX 3ZUNA 4AN0A 1YRAA 2BM9A 1BS2A 4ZI5A 4EA9A 3L0OA 3PENA 3X2ZA 2CXRA 3BXFA 1K0FA 3WIBA 5CB4F 2WA2A 2O8BA 3QU5A 3U4GA 2PX6A 3ZCSA 2UUBB 1WIWA 4PO1A 4TX1A 3D6VA 5BW4A 1NPDA 2JF5A 3MTBA 5FBLB 1ODTC 4MHSA 2IV2X 3K1AB 4Z9YA 1YH3A 3H84A 4UHDA 2O0HA 3EIFA 9GPBA 3VO1A 2AMFA 3RD2A 4KXVA 2XODA 4N8SA 2ZUWA 4KAXA 4B76A 2GPWA 2NQ8A 2Q4RA 4B6QA 3M1IA 5J4LA 1XMOB 1EVEA 2H7CA 2EFYA 3NIBA 3Q6NA 3QFFA 2JIBA 5AYAA 4DCTA 4LHSA 1LDMA 3ESBA 1HE5A 3GP5A 3SLRA 3QX3A 3ZXIA 2HQBA 3BOSA 2AN3A 2BF8B 4O5AA 5IKOA 3CF6E 2GVNA 4GU2A 5KI6A 3HZOA 1JEJA 2KDBA 2WDQB 4QXMA 2NUAA 3UBTA 3O26A 1F12A 1EAMA 1PD1A 1OLSB 3DAPA 2A1UB 3LU1A 3TEXA 4ZK2A 1OWMA 4L8FA 3N74A 3COSA 3R0QA 1PZMA 3L8FA 3LHDA 1CR1A 1R12A 1H69A 5JHGB 2ZSIA 3AR8A 4E1BA 1XZDA 1HZ6A 4RTKA 4J43A 4BRWA 4JZYA 2B37A 1WGDA 3L13A 3Q7PA 1TAGA 3GY0A 1RJWA 4KCGA 2L2QA 2HUPA 1LSSA 1U5AA 2QPOA 1QZUA 4BOSC 1EXDA 2LMCA 4H9GA 4YTPB 5EP3A 2BWES 4LHWA 2ILVA 1PS8A 1UM8A 1I4XA 1EJ2A 1RJGA 3OZGA 4GDKA 1HDEA 4CT5A 4ER0A 4C43A 1L5OA 3SXUA 1DSSG 2ZWOA 3D6NB 5A0TA 3ZWXA 4KEPA 1G20B 5JBIA 1E2HA 2RC5A 1O9BA 1PEYA 1XE3A 4MQ6A 3MWDA 3ANSA 1U0HC 3W2HA 1N8NA 1RP1A 4EP1A 5FNVA 5KTKA 1A7AA 1MNQA 2PZ8A 2VTBA 3I1IA 2H1CA 3HQ4O 5IJ9A 3VYWA 5CXQA 2H0RA 1CB7A 4XYLA 4RZQA 1WIAA 2ZYIA 4HJRA 3TNFA 4M0FA 1SVUA 1S2DA 3NV7A 2GF2A 2WPNA 5CDUA 3C3WA 4LX8A 3ADDA 1MC8A 4IDGA 3ZKJC 1MA0A 1NXXA 4IV8A 4FFBA 3LHKA 2ZK7A 5IXJA 3JRWA 4RD3A 4JVLA 4YJGB 1ZM2A 1VJRA 1YQXA 1DNPA 2YWFA 3FMIA 1AN0A 2ZAOA 1LTHR 1OLUA 1TQDA 1EA7A 3N2GA 3S5UA 5L3SB 3KWJA 5ITVA 2PE6B 1U65A 3HA7A 2AG8A 3HV0A 1OX6A 2HA2A 4KH0A 2AQ3B 3N7TA 1GUBA 5K3CA 4WA8A 3X43A 5I7WA 3NS8A 4C7BA 3AQIA 4LFAB 1QTRA 3TRDA 4FOLA 3C0KA 2XYGA 1CIVA 1QMGA 4NHOA 3U40A 1YOVA 2G1UA 1E8DA 3DV9A 5BSRA 2UUCB 3RNAC 4BAGA 3NVDA 1C77A 3DOWA 2VZ0A 3SS9X 1M6VB 1KO7A 5DM4A 1F14A 5LDHA 2XGSA 3GJYA 1O0CA 3VXKA 1GCIA 4AKTA 4KSCA 2CZCA 5EIBC 4B2YA 4AG6A 5FUWA 4I6JA 4DLAA 5BVHB 2IZ6A 5HQ3B 4EHHA 4J07A 2GEKA 4K7SA 5E1MA 3STVA 1OFUX 3GJSA 4UZSA 4ER5A 1ZOLA 1E69A 1SG6A 4R9SA 3URYA 5FT9A 3HDVA 1QWOA 4MP8A 4C4VB 4Z67A 4ZDJA 1BGWA 1X1EA 2EP5A 4NAMA 3D3JA 3DHNA 4M86A 1P9NA 2ZJBA 3RYIA 2IW1A 3BF8A 3PFKA 3OCCA 3F73A 2GVDC 3TTTA 5EWMB 4B7ZA 4KXNA 2OZPA 1V1MA 1X14A 2VCEA 1V9SA 3GHYA 1IZ9A 1AZLA 1GUYA 4RIEA 1UIRA 3SXJA 3O4IA 4W6ZA 3NYIA 1OFFA 4F9EA 1WS6A 1D1PA 2FN8A 1NNI1 2CMDA 1QG2A 3ZLBA 2RGWA 3ND6A 4F6ZA 2IODA 4EGFA 3A1QA 3DC2A 5BSMA 4QOIA 2EXXA 3KDPA 3JQPA 3QBJA 1BU5A 4IUDS 4RABA 1W73A 1RLOA 1L4BA 3R77A 2HRBA 3H13A 2QVCA 2FPGB 1QIDA 4G86A 1NUHA 4PC2A 1N4AA 2VHTA 3GLFA 3PGVA 3Q7RA 1TS4A 1AHIA 1KVRA 3L4BC 3PJRA 1LNSA 4H4DA 3R3ZA 1S3SG 5J2UA 4P4SA 1JIKA 3LXUX 4A8TA 3AECB 1P4SA 2QX9A 3DPDA 4YRJA 3OJ3A 1KZYC 4BKUA 3BTUA 4KBYA 5CFPA 1AQIA 1ZBDA 1GZHB 3UFBA 4RDHA 1WJUA 1F60A 3R6LA 2IEZA 3NLLA 3O3MB 3NTUA 4XUEA 1P1AA 4PZDA 3KFVA 2BGJA 5HOEA 1OVMA 1MO6A 4MV6A 2F7SA 1N7JA 4PSKA 4W9EA 3ENNA 3AJ9A 3APCA 4E3CA 3Q6VA 1RFKA 2O50A 3H2KA 5IKPA 3G5MA 2PL5A 2KWUB 3MK31 4AP9A 5BSVA 4A0SA 4G01B 2XI4A 5E3JA 4DNXA 3ZQ6A 2FEAA 3ZGOA 2I3ZA 5AJTA 5FDFA 2EKPA 2J5KA 5JMOA 1DINA 2CHQA 4I9NA 1S3SA 4TQ1A 4NH4A 3ZCTA 5HGXA 3JY6A 3KPVA 3DS8A 4ITRC 3GLRA 2BP7A 5GIPE 1KTIA 4B3HA 2A0KA 1C81A 3MGKA 1GGFA 3RB8A 3NIWA 2QILA 2ZDGA 2XMSA 3CSDA 2DBQA 4UUPA 3E3MA 4BNTA 4A1FA 4BP1A 2PKEA 1VZ7A 3AR5A 4IQ8A 4ABYA 1EFKA 2ATEA 1FTGA 4HRXA 2HE7A 2JVKA 3NJ8A 3LWNA 2OHVA 1JQ3A 1L5HA 1SZDA 4W1PA 4TVBA 3VC7A 1ZKDA 1FZTA 2QN1A 4UTPA 5JAHA 3OMXA 1Q1ZA 1L7MA 2GN6A 4YRBA 1WZ2A 3R3SA 3NS1A 1TEVA 2GDZA 5BSHA 3OC6A 4UBOA 1ZSYA 2N1WA 4KQCA 5LSCA 2MH7A 4W5HA 3LCMA 2ONCA 1UF9A 4PIMA 1AQ6A 3IV7A 4YR7A 3Q8MA 4DDHA 5BYBA 3F78A 3OMLA 3QX1A 4DC0A 4I50F 3ICOA 4BCBA 5AKYA 3F4LA 3TFQA 4LJRA 4V0MA 1DGJA 4YDQA 3SC3A 3L7NA 1MV5A 1GTJ1 3Q10A 2OORA 1Y9ZA 1Q6YA 1KJJA 4OX9Y 2BSXA 1TQHA 1DB3A 1ZYUA 5EP1A 3I61A 2GYYA 4C1DA 3DWGC 3FWNA 1IIBA 2ERYA 2CUZA 3HB9A 2WLTA 3HYSA 1P19A 4I1UA 4BLWA 3QHTA 1TCUA 4H16A 1QOQB 4HJXA 1MI0A 4DVJA 2P4HX 4QUHA 4TKMA 3PXAA 3K6SA 3JZFA 2WR8A 1CT9A 3FNIA 1VYUA 2RG7A 3BTOA 2IGHA 2XMGA 4OUDB 2PUVA 4GXQA 2C0QA 2Q3JA 4OVUA 1XI2A 3BFJA 4YRZA 3UQZA 3L0WB 2KSQA 2G07A 4R31A 1WCXA 4A2QA 5FQOA 2FJ0A 5A4AA 3AE8B 4M36A 5T67A 1C9FA 1AB6A 3JALB 3K1ZA 5I51A 3I0NA 2OD2A 4TVSA 4B17A 5JXVA 1UZXB 4FOOA 2WHIA 4QREA 3NGLA 5ACTA 5K0GA 4URFA 2B4AA 1L4UA 2QTCA 3TSZA 1N5KA 1E9MA 3U1BA 1E6EB 2FVYA 4R8LA 3T7SA 3I4FA 2FQXA 4ZOLA 4GR4A 5A06A 1UKEA 3QTBA 5IBPA 2Y4NA 1R1DA 3TZQA 5HIIA 4EMTA 2W2VA 5FYQA 3PXDA 4EJFA 5U1PA 4MCHA 2C9WB 4N40A 1DG1G 2OXIA 5B6IA 1XBTA 3G2MA 4G0NA 3GS2A 3LBHA 2IHVA 1POWA 4QTXA 2CXPA 1MU0A 1LLFA 3HC7A 4C7KA 2O6LA 5F3WB 3VSCA 5JS2A 5AKHA 4E5KA 1ZMXA 4RZSA 2X2OA 5DWDA 4B7AA 3HP7A 5JEDA 4ZZ3A 3AFIA 3G6KA 2AEJA 4OL9A 4Q3EA 4OU4A 3VQIA 1CBUA 1ZONA 1KLVA 4ZZ0A 2D3CA 4JJKA 4QPPA 1YACA 4BCDA 4G67A 4E15A 1OI4A 2GKSA 3BCHA 1DZIA 4RF0A 1JNXX 4JITA 1O94C 3D0OA 1KF0A 2DHCA 3DQZA 4B48A