4XWWA

Crystal structure of rnase j complexed with rna
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
545
structure length
545
Chain Sequence
PAPTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 182
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwwA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwwA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwwA01
2FU7A 3RKJA 4V0HA 2P1EA 4EYLA 2GKLA 1ZNBA 1JT1A 2BTNA 4UWOB 4EFZA 4NQ5A 4F6ZA 2YNWA 3ZR9A 5AHOA 2BIBA 4AX0B 5K4NA 3ZQ4A 3DHAA 5A0TA 2BFZB 5K4MA 4PVTA 4TYTA 3IE2A 2BG7A 2FHXA 2Y87A 4C1CA 4XWTA 5ACPA 2Q42A 4NQ2A 3SBLA 3IELA 5FQCA 5ACQA 2ZZIA 3S0ZA 5A5ZA 3AJ3A 4O98A 2QJSA 4UWRB 2HB9A 1ZTCA 1XTOA 2XR1A 1L9YA 4FR7A 1A7TA 3ZNBA 2WYLA 2GCUA 4UBQA 4C1GA 5ACUA 5EWAA 5K0WA 5HIQA 4FSBA 2FHXB 4AD9A 5ACXA 4RAWA 4YSLA 4UAMA 5LM6A 5HH6A 4D1TA 2QDSA 4D02A 2WRSA 4UWSB 3ADRA 4HL1A 4GYQA 3SPUA 4Z6XA 1M2XA 2R2DA 3SD9A 3TP9A 3H3EA 1ZKPA 1VJNA 3FCZA 2Q0JA 5FQAA 3KNRA 2AIOA 1X8IA 2A7MA 5EV6A 3VQZA 2QDTA 3BK2A 4FEKA 3IE1A 2E7YA 3G1PA 5A87A 4Z67A 1YCGA 5AHRA 2I7XA 2BMIA 4PVOA 4DIKA 4Z60A 3X2YA 5LS3A 3I15A 5AYAA 3JXPA 4GCWA 5AXOA 4KEPA 1BMCA 2XF4A 3KNSA 3I14A 2P97A 2DKFA 4XUKA 4EXYA 5LSCA 2ZO4A 3I0VA 2CBNA 3L6NA 1DDKA 3X2XA 1WUOA 4XWWA 4C1EA 3P2UA 2OHHA 2YNTA 5EVKA 1KO2A 2Y8BA 4RL2A 3PG4A 3PY5A 4Z5YA 5A0VA 1QH5A 4BZ3A 2P18A 1A8TA 3T3NA 3I11A 2GFKA 4RM5A 3I13A 2FK6A 3T9MA 3RKKA 3IEKA 2NZFA 3PY6A 3R2UA 2YNVA 5ACRA 3SRXA 3DH8A 2BFKA 4J5HA 2FM6A 3VPEA 2WHGA 5EVBA 4KEQA 4H0DA 4NQ4A 3IOFA 4NQ6A 4C1HA 1X8GA 2WYMA 2Q0IA 4TYFA 4EY2A 2WYMC 4WD6A 5DPXA 4Z5ZA 4ZO2A 4DILA 3ESHA 5ACWA 1Y44A 3KL7A 5AXRA 5HH4A 4U4LA 4TZ9A 4JO0A 4YSKA 3SFPA 1P9EA 4TZBA 2YNUA 3AF5A 5LCFA 2YZ3A 2Q9UA 3BK1A 1KR3A 5HIPA 4C1DA 1K07A 5LCHA 2FU8A 4GYUA 2VW8A 2BC2A 4J5FA 2BFLA 4HL2A 5EHTA 3DHCA 4ZO3A 4EYBA 1JJEA 2BR6A 2BFZA 2FU6A 4YSBA 4UWPB 3BC2A 2I7TA 5B15A 1KO3A 1SMLA 3DHBA 4UA4A 4ZNBA 5FQBA 1WRAA 1X8HA 5B1UA 2BG8A 3F9OA 5EVDA 5K4KA 4D1UA 5HIOA 4TZEA 2NYPA 3IE0A 5LLDA 3RPCA 1BVTA 4C09A 5HH5A 1BC2A 4B87A 5KILA 2M5CA 1YCFA 2BGAA 3X30A 4RBSA 5ACSA 1YCHA 2BG2A 3LVZA 5LMCA 2FU9A 4RAMA 3AF6A 1DD6A 5EH9A 5ACVA 4EYFA 2GFJA 5IQKA 1JJTA 3BV6A 5EW0A 1WUPA 1DXKA 1WW1A 3QH8A 2BG8B 2NZEA 4HKYA 3IDZA 1QH3A 4Z7RA 2P4ZA 3X2ZA 4ZEJA 5ACTA 2QEDA 1MQOA 4C1FA 2BG6A 4EXSA 4F6HA 5B3RA 3FAIA 2NXAA 3SW3A 2YCBA 3ZWFA 2YNTB 4LE6A 5EV8A 2ZNBA 4AWZA 2Y8AA 4RL0A 2H6AA 5KIKA 2OHJA 3A4YA 4CHLA 4BP0A 4TZFA 2M5DA 5LE1A 3MD7A 1VGNA 2GMNA 5HISA 2DOOA 2OHIA 3IEMA 3WXCA 1VMEA 5AEBA 2YNVB 4P62A 2I7VA 3IOGA 4D1VA 4D1WA 1HLKA 2UYXA 1XM8A 5LCAA 2AZ4A 4AX1B 2ZWRA 3Q6VA 4AWYB 1E5DA 3T3OA 2QINA
chains in the Genus database with same CATH superfamily
3FUXA 1F5SA 3LM8A 1PZEA 4PPYA 4E4TA 2ZLBA 1FNVA 4XQ0A 1XD9A 1B0PA 2E49A 3FFXA 2O8VA 2PCLA 3TZ6A 1PNRA 1K27A 4FB5A 1Z36A 2YFYA 4XFDA 1HEUA 2L1AA 1T9CA 3ZDQA 3AHDA 2DLNA 2MSKA 5AESA 4OUDB 1LWOA 3A6KA 1T2DA 1L7EA 3LOQA 4B43A 5C1BA 1DQZA 2G8NA 1E2PA 3THSA 1T8UA 3IQXA 3KIPA 1YC2A 4CF5A 1LXDA 4IICA 2BZGA 3HJBA 4G5QA 2W22A 3LX5A 3AHIA 1RXYA 4L74A 1Q22A 3ML8A 3GLHA 1FW6A 2IX9A 2Z5GA 3L1UA 2XGOA 4ZO4A 5GJBA 2VWHA 2PRYA 2HAEA 2TSSA 3F9RA 1OLUA 5HKAA 5IT4A 4I1PA 4EECA 2I4TA 2WWGA 1P7FA 2Q1UA 2P6NA 1IQ0A 3B3FA 3TTSA 4M0FA 4BLQA 1K6MA 4PSCA 2OCYC 2INCC 2XXJA 3GZNA 3GEEA 4EZJA 2P75A 2MHJA 2QMQA 2DAJA 5BUZA 3DZIA 2AOUB 5AWFC 3Q69A 3UENA 4Y0NA 1KZ4A 5MFZA 4R1LA 1XEEA 2HJ8A 4CV0A 3LO5A 4JQYA 3R9KA 2F7SA 4WE3A 3KDPA 5TR9A 1N2JA 3OQIB 4H0NA 2PGJA 1DC3A 1U1IA 3KUZA 5C7YA 3AVPA 2X42A 1GUDA 3MJRA 3MJ5A 1E2FA 1V8PA 2LCQA 5JV5A 4OBWA 4L5YA 4A15A 1ZM7A 1IBSA 4CN9A 1OXKB 4LJ7A 2BMAA 2JVIA 1JZQA 3PV1A 1L5HA 1P39A 2IDYA 4II3A 3O8CA 1A9PA 4CIDA 3U1TA 4JB2A 3UZUA 4JBWA 4LWPA 4LRWA 5IO9A 1CUVA 1AH2A 1ZSNA 2A8YA 1N9GA 1Z74A 3G2OA 1GGKA 4K03A 2WXKA 3VQIA 2XIQA 4ZDKA 4RSRA 3BFPA 1HFEL 5JDIC 4FYIA 2Q1XA 1VLJA 1E60A 4XQ9A 1BW9B 4B6EA 1JAIA 4TMVA 2B7CA 5ALYA 4YRLA 3V8EA 3VR3A 1GNRA 2F3QA 2P6PA 4PLHA 1V8BA 5E4JA 1N62A 3SJBA 1GDTA 3KPVA 1MHTA 1SVMA 2C4VA 1GO2A 2K7ZA 5LBUA 1J39A 2H57A 3FCUB 4JENA 2O07A 3PQ2A 3S99A 2X4GA 1IXZA 5BPFA 1V4NA 3IUJA 2I2CA 2WT9A 1AN9A 3ESQA 3RZWC 1PD0A 1GITA 3B9QA 2GN8A 3VGPA 4ZVLA 1IYZA 2E1RA 1AV7A 4IIEA 3PJDA 1FJGB 1K8XB 4FIZA 1CZPA 1UZAA 2CK3D 4DZZA 4K9SA 4NYJQ 2A0YA 1FYEA 1U4NA 2IXGA 4MV7A 2NSHA 1Z3CA 4V0RA 4EW6A 1KR2A 3MOIA 4TM7A 3U6BA 4QJ3A 1DAEA 4HRYA 1DPFA 1J0XO 1ZP6A 1SVWA 3PGLA 3VKVA 1A9XB 2EERA 1ENYA 2XITA 4KIKB 5HGJA 5BMHA 3R3VA 4J0IA 3F6YA 1UUPA 3D3KA 5DULA 4XX5A 3X30A 2QX7A 2PQMA 4ER6A 3MIIA 3NNSA 3K5WA 3WTBA 3TSOA 2CF5A 2B20A 2OFXA 4UQPA 1K9VF 4MRMA 2RPQA 1Z0AA 1WMFA 2Z8YM 3QOWA 2C9BA 3HCPA 4U7HA 3AE3B 4P86A 4H16A 3OZRA 5E6PA 2XNCA 5B3RA 3AYZB 3LP6A 2XNDA 3GNTA 5JALA 1HY3A 4LIPD 2CDNA 2WFAA 3N59A 4D9JA 4PX9A 4MDYA 1NRWA 3E22A 4DIOA 4OM7A 4YPOA 5E1DA 5EI5A 3GAZA 1HLFA 4YMLA 2HIAA 4KXQA 2VJMA 5KTKA 5LD2B 3IDQA 3R8XA 4TQ1A 3JZAA 4G9BA 3MFQA 2YWEA 4XJTA 1SEBD 3UJ7A 2XW6A 2PXXA 1JJAA 4X1IA 1K3FA 2JXXA 5T4BA 2OO5C 1FRDA 4C21A 1P7WA 1FVHA 3E84A 3HBFA 2WWHA 2V6MA 1SUAA 1ZRMA 4QDUA 1NFRA 2RHTA 1B6GA 5DIZA 1U2GA 4X66B 3KE8A 2GNAA 3LL4A 4RDCA 4EF4A 5FNVF 2JATA 4NAHA 3SHTA 1AIPA 2CG2A 3I64A 3I05A 3ZZUA 2X7HA 2J3LA 1T0RC 2X38A 1NVVQ 3UXHA 4BHTA 1YD7A 3EJ6A 1JYSA 1E2LA 2BG7A 1SC6A 4OXRA 2G67A 3UEOA 2ZPUA 5CW1A 1GGVA 2HK7A 2QA5A 2RHJA 2HSEA 2FUHB 2N46A 4AJ1A 5FUWA 4CW7A 1UANA 1I4DD 4WLFA 2XCSB 4LXXA 5D6JB 5CA0A 4MH0E 1H85A 4I3GA 1GU7A 4OK6A 4G0WA 1RKBA 2V59A 3ONEA 4MGYE 9LDTA 2R5WA 3W4KA 4IKPA 3L7IA 4B81A 3RKSA 2CFRA 1TADA 4HNTA 4R9UC 1W7AA 5HF9A 1T5IA 1YE5A 1PP4A 5BNZA 4RETA 1RHUA 3SXUA 1I94B 3ZS9A 1ICEA 1P0FA 1JUDA 2FQWA 2Y6VA 3BEDA 3MYRA 2UUBB 2DECA 2WJZB 1E8ZA 4GQAA 2H17A 3ZBUA 4IJWA 3RC9A 3TQTA 4BO1A 2VPWA 3KSBC 1YR2A 3WMGA 3CVUA 2QW1A 1G64A 4JJAA 1BMCA 1X1BA 1HYEA 3HM6X 1HDYA 3R3HA 3ETNA 1OA1A 4KQ2A 1A2OA 5CVTA 1QNFA 5EZYF 3UKJA 1MAHA 5IC5A 4XWWA 2IY0B 4Z9YA 1WM3A 1CUJA 5CEJA 1SIBE 1ESMA 1Z4QA 3CNNA 3AETA 4IFBA 2CNKA 3GGGA 4M02A 5EP4A 3RKKA 4QOFA 4DHWA 5HILA 4EVQA 2R8ZA 5GM2A 1X8GA 3C7AA 1JPVA 2OBMA 3OCXA 4W9EA 4U9HS 2JCVA 2IYXA 1UOOA 3QEKA 2XECA 5DXFA 3D43A 3TW4A 1SUIA 4Z8XA 4HRXA 3O6VA 3N0VA 3GQBA 1K51A 4LSGA 1JA1A 2IYTA 1M0EA 1BD4A 3FWNA 4OU4A 3SN6A 4BJ6A 1L4EA 5I7VA 4PGGA 1A70A 2J32A 2ORVA 3CCFA 1KQPA 2V8OA 4KXYA 4V0KA 1E0DA 1DC7A 3ENQA 1ZRSA 3OY2A 3B85A 1SAYA 3UV3A 2BFDA 4BP8A 1XXGA 1NMEA 1Y7TA 3NVZA 2VH1A 4HLNA 2Y1DA 4JX1C 1NU8A 4LY0A 1WD7A 1DJNA 5EIEA 1NUTA 2GNPA 4PAQA 4XARA 3GJ3A 3IBEA 5LMCA 3HJUA 4L50A 2WF5A 4PNPA 5TNXA 4ICIA 5DGIA 2HFJA 3E9CA 3Q0EA 3CR7A 4H6PA 4AJYB 2N1WA 5A6VA 3DWIA 1A5ZA 5ECDA 2ZCJA 2IV2X 3TZCA 4IUMB 1I0ZA 2CK3A 3NOVA 2X14A 3HZOA 4OA5A 2QT9A 2FK7A 4G37A 3QPAA 4D41A 5HIAA 1ZK2A 5JXIA 3ZHTA 2L69A 2WDVB 2ERYA 3TB4A 4E46A 1FFBA 2ZJ8A 1UKVY 2DETA 3QBJA 5DDIP 3HR4A 1LTHR 1K6IA 2Q21A 3R3MA 3TW0A 4EHJA 4EM6A 4MCAA 1USWA 2GETA 4OM8A 4NS1A 2GN6A 1E2GA 2D5CA 3R5TA 5AZGA 3KB8A 3NRCA 1M2KA 1TS4A 3URYA 2VR1A 2Z8YA 1KH0A 2X8AA 4CDGA 5F7ZA 1K53A 3HXOA 2E6UX 2Y5BB 2GXQA 1XF9A 2I38A 4A6QA 2WV9A 5K7SA 4UWOB 3R3JA 3PD7A 4QDXA 4WKCA 1JG7A 4TLDA 3AVQA 3UPUA 1J24A 4LZPA 5LMNB 5I9IA 2OFOA 4KQKA 4UULA 3IE2A 4CMKA 2ADMA 1E2HA 3SVZA 3ROKA 1ZUD2 2FN3A 1NI4B 4UUOA 2NS5A 4MWBA 3BM5A 5JJIA 3CPHA 1WYGA 4JWSC 3N30A 3Q3HA 1NONA 4R7TA 1S4MA 3UJHA 4AP5A 3FUTA 3II6X 8OHMA 4C76A 4UBJA 4FYVA 1JQAA 4ZN6A 1DOZA 4LSMA 1KLGD 1BEEA 4KQCA 5FR1A 4RK1A 1KVSA 4YREA 2C82A 3I2YX 1FIUA 3IFSA 5DK6A 1JJIA 4XR9A 4KR7A 3TQCA 1ZMRA 4D1TA 3VKGA 4DWFA 3ZJVA 3T1QA 2XEXA 4TL9A 1R0RE 1YQ3B 1OIVA 4RH1A 3RNCC 2Q4OA 3NANA 3V8NA 5CTRC 4G5YA 3WGIA 4UTRA 1GEEA 3ZDBA 3CLHA 2E7YA 5KKAA 3TLAA 3L9WA 1MF7A 2WIAA 5JAUA 1JR2A 1G3RA 2G25A 4ARCA 1OQAA 3I76A 2DHRA 3EEBA 1OHHD 4EG8A 2WJYA 2WSBA 1T2EA 2X7XA 3QV2A 4RMHA 2RCYA 2IVFA 2F1JA 2JQRB 4ND7A 1UFKA 1E1CB 3QA9A 4KNYA 2QIEB 2XF4A 3L7AA 1WZEA 1PT5A 4BFVA 1Z26A 4CG3A 3A04A 5HQJA 3E15A 5CDTA 1ZUWA 3ZBTA 2CBNA 2BW0A 4MB6A 3UGKA 1EFVA 1MB2A 1SPXA 1TKBA 3WWDA 4CQLB 3O95A 4JCOA 2W6OA 1R0SA 1CEEA 2ZIXB 5LU8A 1EFPB 4IRUB 1V7PC 3ZBPA 3SF8B 3P94A 1OXBB 4JITA 1E9AA 1V7CA 3OKPA 1NRIA 2VSFA 2ZTLA 1DKOA 4Z7OB 4KRYA 5FOSA 5I6DA 1CZOA 3LY7A 1K63A 4JV5B 4WAUA 3T5TA 4OZAA 5JXGA 4F85A 3RAPR 2IYDB 5CP8A 1R9GA 3SYRA 3EG5A 3P2BA 2WHIA 4LI0A 1J99A 1M34A 3U7QA 3ZWPA 1N2CE 5LJLA 1IHDA 2O1WA 1BDHA 3VJMA 3A32A 1YH3A 4XUCA 4DBVO 3BFJA 2FFRA 1TKEA 2FGKA 4NBKA 1BGVA 1V1MA 4XPIA 4I9HA 2ODWA 2AS0A 1M72A 1QTQA 2HDEA 1P29A 5JW6A 2BR5A 4NZMA 1VLHA 3KKOA 5F35A 4YT0B 2GHIA 4CWAA 3RR2A 4FI3C 1NBMD 1KLVA 3KUCB 3PA8A 1X15A 3KB2A 1U8CB 4DARA 3VSAA 3TLJA 3T06B 3RAEC 5C3MA 1CEYA 3KQTA 2ZNVC 3OE5A 1U2GC 3EXAA 4ZAXA 3VVWB 2XJ9A 2D1RA 3U7IA 2XBMA 3TKAA 1XMQB 1EM7A 2Q1WA 1R88A 1OIWA 1C7QA 2J4FA 5LXIB 3VR2D 2OGZA 1SXJD 5AVJA 1E1MA 2C1XA 2DHCA 1TDJA 4DV1B 5JANA 4G23A 3F3KA 2XTAA 3I5UA 2Q3EA 5CHEA 3H0EA 1IGDA 2G28A 4EJMA 2HCRA 4HGPA 3IQEA 2I78A 3KQLA 2Z6VA 4L8VA 3NYQA 4QPZA 5H80A 2CJFA 4OBBA 2OJWA 1VGNA 3FYUB 3ZH2A 3O8NA 3L6UA 4RYDA 4NH4A 4JAVC 2YNVB 2HFKA 1U1CA 2DVMA 1XQ9A 3EAGA 3IIIA 1GTVA 3FBGA 4RJTA 1QFJA 2BEVA 1C80A 1TM2A 5KDDA 3E5RA 2DFLA 1M2NA 3WQQA 2RGDA 2KN5A 4MJSB 1KVTA 2ZM6B 2D5AA 1H0HA 1XQ6A 1HWYA 1WSWA 4TTPA 2JF5A 1U4SA 3LIIA 3H18A 4PZ0A 1LBSA 3U0BA 1ZOSA 4QUHA 4P4UA 4DVJA 1CNFA 2WB4A 3VTAA 1LJUA 4MQEA 1ABFA 3LA6A 3EVZA 5D5PA 1E7QA 3SJUA 3FCXA 1EWKA 5EL0A 4EBBA 3DG9A 1MJHA 1ETHA 3VTUA 1RDFA 1VCHA 3KV3O 4JPSA 4POOA 1XTOA 4K7WA 1VLLA 5HUJA 1PHPA 1YIAA 3KYCB 3AEDB 3OEWA 3KEFA 2GZ1A 2YL2A 4S1WA 3CLRC 2IPAB 2V03A 2QL5A 1V5OA 2JA1A 3RUAA 4QLOA 4MR9B 1P5ZB 1TCAA 5ADWA 3WY9A 3ZCXA 1GGEA 3AFGA 5TJ9A 3WNDA 4D02A 4EEWA 1Q1QA 4MQ6A 3WGLA 1RZ3A 1TYEB 3IEXA 2GKSA 4ZHOA 2VWGA 3N8GA 3DW1X 2ZPTX 3FCZA 4S24A 2BI7A 1K8ZB 3ZDYB 4MUGA 1LKZA 1W35A 3TEJA 3QKSA 1N6RA 4QQFA 2Q28A 2X8XX 5EDSA 2H2DA 4Q4AA 1FEHA 3PXXA 4IWQA 1M9NA 4HLQB 5C8YF 4XOIA 3O83A 3ZDEA 3RVQA 3P2EA 5B53A 4HSGA 4IIYA 2XB8A 4AIRA 5KO2A 4UUQA 4W9JA 2JIZD 3W6OA 4JLCA 3D0QA 4ANWA 5IMBA 3FPFA 2ANCA 4LMAA 4RGYA 4MEBA 5AW8A 1ONSA 2D2VA 2XLCA 1ZAKA 5C8XA 1YZUA 3M1YA 1U0BB 4ZODA 2ZANA 3DOIA 2J8ZA 3S7ZA 1U90A 3P27A 2WU0A 4HRVA 4DUPA 1WDLA 5BUQA 1JR3E 5EJ6A 1EF1A 1NLYA 3K3PA 1PL7A 1U8ZA 5JROA 3R0QA 2KTRB 1FMLA 5JBQA 3CTMA 3UJCA 3NHSA 4CM9D 2XNSA 2R7AA 5ADHA 2ZB3A 2ZT8A 3O93A 3UGBB 2JHCA 4EDFA 3P9ZA 4KU4A 3G5MA 3ZN2A 4X9XA 1QIKA 2AN1A 2YXNA 5ILQA 1ZM2A 3CUUA 4LLGM 3Q9NA 2UZ3A 3OZFA 2MSEB 3KLOA 1L5NA 2I7TA 3LDGA 2KSQA 3HFJA 2PTHA 3LUBA 4YCSA 4WOKA 5EUMA 1FIQA 4E7OA 1RI5A 4Y9UA 2CE2X 3I0MA 4DYDA 1I7NA 1RRFA 4CE6A 2F59A 4XW2A 4Q19A 4KITB 3PHWB 4NS4A 4TT8A 1QFZA 2WU3A 1L4LA 1CDDA 4PS0A 1ENZA 3Q8CA 2FCNA 2YV4A 3JARB 3OCYA 1MT0A 3RRXA 1JQBA 3PF8A 1ZM9A 5IDQA 3QE9Y 4HAYA 3KK0A 2JBHA 3ZKAA 2W2LA 1PK9A 3WB1A 3EUB2 2D1FA 3TXXA 3H0CA 3E9DA 1ULBA 1Y3IA 2V6BA 3W04A 4GQBA 2YOHA 5CB4B 1NBMA 1MQOA 1XDZA 3BTUA 5JC8A 4K7JA 4JR2A 4ZAGA 4D5GA 4E1AA 4NJ6A 1P19A 3ZWFA 2JI8A 5EHNA 4BP1A 3EOAI 3TK1A 3V33A 3FB1A 4YRJA 2QMEA 3ZKWA 3I6MA 1V47A 1GHTA 1AA6A 2IXAA 2NU8A 3O94A 3HB7A 4N8EA 5CFZA 2O2GA 2I76A 5ES3A 4L16A 1FVOA 1G8JA 3EVFA 1LRJA 5FF9A 4PLYA 1RYYA 5JZBA 4B3IA 3EGDA 3PJEA 4Q16A 5KSZA 1JNXX 3HCRA 3EBLA 5AUNB 1O7JA 4S0XA 2GAIA 5BV1A 4D57A 4F4FA 4A6EA 4GQIA 1SJED 1PWHA 3MLEA 3WWPA 3ENWA 1XZNA 4R3NA 1CQVA 1KYQA 2D3BA 3EGVA 3WGQA 4FNAA 1MO6A 4RVCA 2HYIC 4NYIR 3TOVA 3T7TA 3HSKA 1SB3C 2NO4A 1EWVA 3IT0A 1C7FA 1TZ1A 2DYKA 1QU2A 1WCIB 4KXWA 1DC8A 2HPVA 1ZD1A 2DBRA 4OU5A 5E3IA 4BL5A 2YINC 3U4HA 2IS4A 1II9A 3KAQA 1Z75A 1L5QA 5KUTA 2GJ4A 1L4UA 1JW9B 1BHJA 4RVSA 1Z6TA 2ZJ3A 2WHEA 2VIIA 4W82A 1G8KA 1HLPA 1YNSA 3CNEA 3KP1A 3MGKA 3AFHA 4R2JA 3NM6B 1YDEA 4XFJA 5T8KA 2ZZKA 2WYLA 1Z73A 5E9QA 1FVFA 1OBFO 3R8FA 3SFVA 1P7VA 2IXDA 4L5JA 2CMHA 1MG8A 2OMEA 3WLTA 4IIJF 3F98A 3LCCA 1L4ZB 2YY6A 4C7YA 5HF5A 1MXFA 3IR5A 4S0RA 3GNSA 1IU9A 4BFWA 3TLMA 5FH9A 2PYDA 1X8IA 3SZUA 3WALA 1O5OA 3EF3A 2REOA 5FV4A 2KWDA 1D2RA 3R7RA 5JTUA 4ZOQI 3PX2A 1SXIA 4QECA 4WEQA 2YMMA 1ZW1A 4HB0A 3V8PA 4PICA 3AOEA 4IIGA 3FHCB 4FFNA 2BMEA 3F7OA 5LYJF 1VTKA 4YTPB 4YCMA 4BMVA 4R51A 5EXPA 3K2EA 2A9PA 2PKQP 5DNEA 2EIXA 1KRXA 5K0NA 1RQLA 4KR3A 1PRYA 1GCOA 1QB8A 2OT3B 4O1IA 1N1EA 3GLRA 1LDGA 2NTYC 1KOTA 4E94A 2JCGA 4AXXA 1GTL1 3F1KA 4HUQA 2I8LA 4XZ4A 2HWKA 2M19A 5DOVA 1JNYA 1ATZA 2FZCA 1CQJB 1TM3E 3E8MA 5KNBH 3H5WA 2D2EA 1EDZA 1MQAA 1HOTA 1VBMA 3GC6A 3SX2A 3L08A 1FRVA 2J33A 3DVAB 2WJ6A 3QF7A 2AR7A 1YJBA 4TSKA 1J9EA 3RMKC 2WIKA 1D8TA 2X5KO 2I2WA 4G1VA 1JFSA 2EYUA 4AKEA 2CJOA 3D6AA 3F4KA 4Y6QA 4AX8A 5M3BA 2G9QA 1W9HA 5F1KA 5HJEA 1Z18A 1JXQA 4XPZA 4KIWA 3ZE9A 3K9CA 2NLOA 2QN3A 3FDXA 4EGAA 2J08A 1IG3A 4OD0A 1RAGA 5CH3A 1JFVA 1BMTA 1L4DB 4M99A 1WRBA 3U80A 4MS1B 4R2XA 1P0IA 5DCNA 4Y7DA 1NPDA 1HXYD 3L4EA 5AK4A 4JL8A 1YDHA 3WKEA 3MHPA 3GUCA 1J19A 1RQNA 2CHWA 2DBZA 4Q6WA 2G4SA 3URKA 4A23A 3ND5A 3T1YB 4BQQA 2X5XA 4G3XB 3RPFC 3ZHCA 1LS6A 1XLVA 5ERXA 3MC9A 3QUCA 1BC2A 3TLZA 4R3UC 1FU4A 4N0EA 1W85A 4LS3A 4F96A 3ZDRA 3KPUA 2P30A 3KZNA 1YR1A 1W34A 1C0PA 4RAMA 1UZXB 3ZEIA 1P45A 1BXRA 3FPBA 1I30A 1AMUA 1DBVO 1WQ3A 1X80B 1G5HA 5M29A 3N6XA 3DXXA 4AURA 4NFYA 2H0QA 4UHBA 1RJ9B 1NMSA 1BCSB 3IVAA 4LA4A 4RL0A 3A9KB 4LOAA 2GD6A 4NCAA 1G38A 1WRIA 3AR5A 4CCSA 1TT7A 2HV9A 3NRJA 4ETMA 2PWAA 1WY8A 4QUBA 5G02A 5IXJA 3A1SA 1GRRA 1XTQA 4UTXA 1YS1X 3GLFB 4C30A 1T8PA 2OQIA 1B8NA 1J70A 4E3CA 4GXTA 1OWOA 4Q2JA 1PS9A 1W5AA 1ULHA 1XPJA 3FJ1A 3QU4A 1KO1A 1E7RA 2FMXA 3U39A 1SBYA 1QVZA 3HP1A 3HSSA 3MJDA 4C5AA 4DXAA 3FPLA 4REMA 3UAYA 5THKA 2H4XA 2I4OA 1Z33A 4E3ZA 4COKA 1P4GA 4JI5B 3R5HA 4M9QA 3FDIA 3O47A 1NDQA 3KLNA 4M4SA 3EC7A 2CWDA 3GOHA 1Q0SA 3PRYA 3S0ZA 3TF5A 5B4VA 5ALVA 5A2QA 5HP4A 1KIFA 3OZUA 3Q3FA 1R5OA 2WWIA 2X6TA 4HADA 2Y1LA 2G1UA 3NNNA 4U2GA 2GBFA 4OGGA 1AQNA 3QY9A 1OJ7A 2C8KA 4CO7A 4TROA 2QYHA 1O94D 2P90A 4MUJA 2A5FA 3U5TA 4AG3A 2X8JB 4JC0A 4XYBA 3V1NA 3PFGA 3U30A 1JEDA 4F2GA 3E9SA 4JVNA 4GB9A 5IW8A 2IODA 4YY3B 1YIWA 3N5KA 4TN5A 4HDMB 4WX2B 3IO3A 4M8SA 5AHKA 3EFUA 1Z6YA 3M1LA 4HWKA 3ICOA 1R64A 1U1GA 2QLTA 1R37A 1ZOIA 1LX7A 1ZYUA 3ML9A 3PPXA 1ZP0B 5AZHA 3U44B 2VHUA 1O08A 4W1SA 1W5TA 4XE5A 1PAUA 5AYAA 1IYFA 4KX6B 4MACA 2EFDB 4JR1A 3W1VA 5FUBA 1W75A 3L4PA 3L8CA 4OQDA 1AZSC 3UJAA 2A4ZA 1V5WA 1QHYA 1Z88A 3ZUGA 5E1MA 2UUOA 2BHRA 5DJ5A 3U3KA 1A8TA 3OJ0A 4V0QA 3DYVA 1A5AB 3K70D 1QVWA 4WNCA 3IPYA 1Y80A 1QLHA 1T29A 1NJGA 3V2UA 1P91A 2W70A 3Q6IA 5ACRA 1XRJA 1Q74A 1T91A 4WXHA 3FVTA 4R31A 1KEUA 4P4SA 5KWJA 3HM9A 5F3DA 3AVTA 4IGFA 3A2NA 2XBUA 4UCQA 3QM1A 2ODBA 1F9JA 1NXWA 4BFXA 1XRNA 1GCIA 3H6NA 4RHTA 4BKUA 3ZNOA 1N6HA 2LKDA 2OWEA 3TUIC 4ZYXA 3ZYCA 3KV1A 2BFBB 4FZ3A 1ZUNB 3SXJA 2BLLA 3NYIA 3AULA 1G3UA 1TTQB 4E07A 4XVRA 2BFZA 4YSBA 4MGZR 1II8A 1L4GA 4YJFB 1ENOA 2WA1A 2FE1A 2GX6A 1YL5A 3KYDB 1WA5A 4HPPA 2BTQA 4AFNA 5DM70 2GFIA 2JK1A 1UZMA 3VKHA 4PBSA 2V7GA 2O2IA 5B64A 3HUTA 1F8XA 5BSHA 5F21A 3D8SA 4XX0B 1KFYB 1SVKA 2B3DA 3R7FA 2Y99A 5B37A 1KH2A 3VFKA 3NDJA 2RH9B 1LJ8A 4LMPA 3FCSB 2HCTA 1VCBA 1VZ8A 2Q99A 1NSTA 1YQEA 3OJWA 2G4CA 2JLCA 3WDKA 3HVRA 4NF2A 1Y4ZA 4ASUD 3FYUA 1FU7A 2FSUA 2PZEA 4F4DA 2Y0CA 4Z3DA 2OQVA 1XELA 2HQ1A 3KWVA 4HFNA 1JAZA 3GLKA 3DS8A 5E1OA 1FRQA 3T7EA 3P9YA 2GNOA 4L0CA 1SE4A 3BN3A 1C4AA 4GGOA 1UFOA 1F0NA 5K8IA 4E0BA 3O90A 3FLMA 5LUBA 3CURA 2G1PA 1D6NA 5T8KC 3PC6A 3CN7A 2VOEA 4EY6A 1LRLA 4K6HA 3VHXA 4GVXA 1M83A 4U7GA 3AESA 1KEEA 2IOFA 1A3CA 5F3RA 2TRSB 3C8HA 3IL2A 2EMSA 2EG9A 3MTQA 2D62A 3N8DA 3HVZA 4FYMA 5AJHA 1LW7A 1TMGE 5EJ9A 3WGYA 1HFKA 4QXPA 1PQYA 1XJ0A 4EQ6A 2UV8A 1ODKA 4N12A 5DCUA 1NW8A 1EP2B 1I4PA 3CSFA 4I6GA 4KZPA 2MYPA 1JEQB 1KU6A 4HD8A 4RADA 1RHQA 4PLWA 1VL0A 4OIFA 2GEJA 3B5IA 3W6UA 2OG2A 1BRMA 4PR3A 3UN1A 3ZBQA 4QKQA 1DGQA 1DE0A 2P0AA 5BMOA 2G9HD 2X9LA 1J33A 4HJXA 2YNWA 4GL4A 4BMXA 1FP4B 4ZCMA 1FFSA 3AOEC 1HURA 1Q6YA 3VR3D 3ZQ4A 4WN9B 1WDWB 4ND8B 3M49A 3VAYA 1QRDA 2WABA 2G82A 4EE2A 3SEBA 5WRFA 1X87A 1MR3F 1JDBB 2HRZA 2J6HA 5HQ3A 2OZKA 3RS2A 2ZJ5A 2EP8A 4V0NA 2GF0A 3IELA 1QIEA 2VF5X 2W2TA 3QV1A 2HSZA 1F2RC 1NKVA 2PFKA 3F8TA 2FJUA 3RFVA 2NBWB 3D6FA 1OAOA 2JGNA 3I5YA 4JBLA 5I4IA 5C2TB 3JQFA 1H6CA 3AIKA 3OHMA 2PO7A 3SLRA 3GZTB 1HLDA 3SFZA 5B58T 4BFUA 1N0VC 1B73A 3OX2A 3A37A 2F3SA 3F4BA 3K0FA 5ARCA 2W37A 2QN1A 2XOXA 1C79A 4ZHQF 2ZJZA 3LYHA 1EVJA 4KQFA 1ETUA 4IO0A 4JSYA 4A0FA 2BRUA 1V5FA 5AKEA 4JUDX 4UM9B 5FQAA 3GCZA 4U9UA 3G1PA 3LMKA 3OLWA 3GBPA 4BKTA 3AIIA 3MNFA 5AM1A 2NO5A 2IYSA 1H9AA 1LC0A 3WLKX 2QJWA 2QBYA 4I1RA 5JMOA 3W3AA 3CNHA 2O2DA 4JCCA 3OCCA 4ZRJA 1O94A 2NUPA 1JI3A 5ILGA 1AURA 2HF9A 1S2NA 1PYWD 4M8NA 4H7KA 1N8KA 3OMLA 1ZG3A 1BZYA 4QM7A 3HU2A 2CF6A 4KE7A 4EELA 3QOFA 1XHFA 1R5NA 3RQIA 4DWOA 4HDKB 5DPRA 4MUNA 1H5UA 1SMKA 2O1EA 3SQWA 2R6GA 5JARA 3GHYA 1AHHA 2ATCA 3HABA 3A1VA 3NBKA 3FYDA 4N8SA 4LF8B 2E2WA 4Q48A 3IVCA 1L2NA 4KEQA 1G6Q1 1BWSA 5LOVA 2FK8A 4YXDB 1Q20A 2VPYA 3A0RB 1WABA 3H19A 3VPSA 4EWLA 1RQ7A 4WBSA 3ESZA 4J6FA 3LPNA 3TM5A 1QIFA 3SICE 4PLPA 2HJVA 2QLLA 3CGGA 1JKFA 1EE2A 2IWHA 2P5UA 3OICA 2YWCA 3BVPA 1PFKA 3FVQA 2W0MA 4LF6B 2QJRA 4G5FA 5B7GA 1XZAA 2OAP1 4R1MA 2QIOA 4FKBA 4EFDA 3QX7A 2GBNA 4FKMA 2XHEA 1KI6A 1RE0A 2OESA 4A90A 1Q7RA 2YN2A 1WRAA 2HMAA 1VPDA 1UH5A 3K9PB 3UY4A 1A69A 2QZZA 4FW9A 2YOFA 2ZIFA 2PLRA 4JI7B 2P4SA 2B8JA 1XCJA 4DJDC 1MA3A 2D2FA 2QVXX 3R0JA 2Q2OA 6REQB 5FKAC 1WUJS 5AVUA 3S28A 3NHFA 2HTHA 3Q4GA 1AS3A 1GCUA 4JFAA 2HIGA 3TMPB 2P2LA 2BFFA 3U4EG 1Y1RA 2B99A 2DEUA 3WHLA 4LMRA 3RC3A 2YZ7A 3OJLA 3L4JA 2PRZA 3X2ZA 5FADA 4TYWA 2RHMA 5GJWC 1OEYJ 5D3MA 1EJ0A 4JMLA 1A9OA 4P4TA 2ZI3A 3IAUA 3UJBA 4CQMB 2OPBA 3JWPA 1N6LA 3OZGA 3WIUA 1N1MA 1XZHA 3JW8A 4JBIA 1ONPA 3L10B 4EOGA 1L8LA 5JHAA 1SHLA 1KO7A 3APCA 2AXPA 3ROGA 4ASUA 3O1LA 1WCIA 1XM8A 1D5ZC 3O4RA 3RVBA 1YSCA 4J0HA 1M34E 1WP9A 4HDQB 4HS9A 3KKLA 3HR8A 4OZBA 3G0GA 1NKTA 2H9IA 1BN7A 3CLRD 2EQBA 3ZNNA 5HZMA 1UPXA 4MO9A 1QKJA 4K3UA 1Y9DA 1Y4UA 4X20A 2YVCA 3JD4A 1TLFA 5SV2A 5TMBA 2QL7A 3L40A 2VYVA 1STOA 1UODA 2XNAC 3A6JA 1NVDA 1ZGAA 1L1QA 2X0DA 1IZ9A 1KEWA 1CXZA 4J9UE 1B6SA 4R0NA 3PGA1 2QX4A 3WWEA 4AUQC 4WIPA 5CH8A 4BNDB 3H2KA 4H7EA 1UXKA 5K20A 3DBHA 4XIIA 3RNOA 5K0BA 1SCQA 5ERGB 1QP0A 4CODB 5MGBA 5H81A 4TV9B 3LRXA 3QSGA 4ZKEA 3G7SA 1G0OA 1EDEA 1YACA 1ULTA 4DWJA 1W59A 4ZTBA 1N6IA 3RJMA 3SJ7A 1OX5A 2BFNA 5T4EA 5LM6A 4LSWA 3Q3IA 4NYMQ 3LPMA 4F84A 3KXIA 3PP8A 1RM6C 2R2DA 2UZIR 1QRUA 2C0CA 4B7UA 5DTEA 4GN1A 2WG0A 1WX1A 2C1ZA 3QJ5A 3RVMA 4DA0A 5FPYA 1WDMA 1W4ZA 4V0LA 4RD1A 2A7MA 4MWEA 1RAXA 1TVCA 3LCUA 1VYTA 2CLEB 3O8DA 5A5FA 3OQJA 3WNCA 4XYGA 4QOEA 1KZ9A 4J0DA 4KR0A 3WKBA 2IYAA 2JVCA 1H8EA 5FKJA 3CNQS 3DVAA 2VP0A 1QZUA 4OYLA 3KM0A 2RBGA 1G3QA 3C7DB 3E58A 4D8XA 3EXFB 1KLUD 1WU7A 3ZY4A 4LBZA 3K0HA 1U8AA 2JIOA 3K20A 4IW0A 4BXOB 4ITKA 3WR5A 4XUGB 2GFKA 4BO3A 5CDUA 5MN5A 3FYUC 5HNKA 2UYHA 4P31A 5TE9A 2Y4OA 3NWEA 4RIFA 1K97A 4B0OA 2HW8A 4RGBA 4WY2A 4M1ZA 1KBOA 4U8GA 1D2GA 2G1EA 3RYHA 2ISQA 3BYZA 3KOMA 3VR1A 1QK5A 1XJWA 2KJQA 2GDZA 4ENUA 4ZK2A 3UT5A 3WLPA 2QQ5A 3BMOA 1G63A 2X86A 3OUUA 4DNPA 1MIOA 2XE8A 4G4JA 4RX1A 3FB4A 1FMTA 4WZBE 2NCNA 2CLLB 5EHTA 3CXRA 3E2IA 4DQKA 4GXBA 4BZAA 4N7RA 2YIDA 1BAPA 1N7GA 2WIJA 4MPJA 4HTFA 4Q21A 1RP7A 2BD0A 3GLSA 3IP7A 4PRZA 2VJQA 2VZ8A 4NPHA 5LDDC 3VZPA 2QTVB 9LDBA 4E5DA 3GXOA 2CLCX 4WXYB 3SU8X 1B14A 1W36B 1YDMA 5HIOA 4ZMSA 5HW0A 4CM4A 2COUA 4GZ5A 1MG5A 1JVBA 3DGEC 3ABIA 3VUYA 4IM7A 3EUFA 3NHKA 2DHQA 5J4VA 1JB9A 4ABTA 1DD6A 3R1IA 4Q1BA 2AQHA 2E85A 3C3CA 4LY3A 4ZAVA 1QZTA 1YX5B 3A4SC 4MYHA 4Z7RA 3AU8A 1GA4A 4OQQA 2JGEA 1OAOC 3W9YA 4TWRA 4NPNA 4K6GA 1JQDA 3ESRA 3FYCA 4TLLB 4EBFA 2N7EA 3DAPA 3JQFC 3VUEA 4GAEA 1E0JA 1T2NA 4K6CA 1SKYB 1FSGA 3PHHA 4LC0A 1CZLA 3KE9A 1Q2XA 4NHOA 1M7BA 1MH9A 4P6VF 5AM5A 1C3XA 2QPOA 3D1VA 3JQRA 4QXMA 2OKCA 2WVGA 4UUNA 4W7HA 4HATA 4IX9A 3L43A 2ZWRA 2X0JA 2EDAA 3ITNA 2BRUC 4ZZ2A 2I1JA 5F3WB 4K9LA 3EEOA 1RU3A 1GRCA 4GMDA 3T5DA 2MW5A 1HRKA 4LY6A 2IV3A 5CB0A 4F5YA 2R1UA 4TL6A 1TM7E 2J46A 5K51A 2O8DB 1R6DA 2IC5A 2HMYB 1DOXA 1Y6QA 2KMCA 1O94C 2KLCA 3AKEA 3FPGA 4RMGA 4IUBS 2VJYA 2XRZA 4E5VA 3FPEA 4ZI2A 2V3PA 3HYSA 2VT6A 4TKNA 1VB5A 1WGKA 1WXGA 4IMIB 1ZDMA 4QYIB 1NBHA 4KDRA 1XQWA 3G79A 2ZYTX 5SYAA 1BIFA 3NTVA 4ME6A 3P9KA 4KAXA 4H77A 3NCHA 5GXGB 4FFBB 1Z6PA 3G0OA 3U4AA 1VSUA 4UPVA 3R9XB 3NGXA 3T0FA 3Q7PA 3K8ZA 5J47A 4IJQA 3U44A 2Z3ZA 2JRIB 5H7XA 4YCJA 3G9XA 1O4WA 4TWAA 3RLFA 2EZUA 1A8HA 3ZNID 3W9UA 4G07A 2JX5A 2PS0A 1KQGA 3R44A 1T3QA 4CQNA 2PLAA 1ZRHA 3K70C 1CK1A 4OJYA 2C07A 2Q8NA 1KTVA 4I8IA 5REQB 4IH1A 2L00B 3KFVA 4JI8B 3A9SA 3QJYA 3F0TA 3PUIA 1SXJE 1W4LA 3ZV7A 3EEFA 3N70A 4XUKA 4X85A 1E5QA 4FYWA 3W6ZA 2MBBB 2XK5B 2WICA 3UHFA 3S1AA 2B4RO 3DLIA 2J3MA 3G2JA 1R27A 1UDRA 1SZCA 1ONOA 4QAQA 4A4DA 1OC4A 5CA1F 1T4DA 4ECAA 1ZW6A 4B6OA 5JAZA 1W47A 3ONDA 5TF0A 3A4TA 4E5SA 4I6NB 4CMJA 1XZMA 2KWVB 1BUIC 1RBYA 2BFKA 1M6HA 1QOBA 2ZRPA 1OB5A 5DFAA 1BS2A 2YJ6A 2C7OA 3OF3A 1W5BA 1JTVA 4AV7A 2IH5A 3QYJA 3K72B 3TJZA 4RJ2A 4QQNA 5KU7A 1M66A 2I3AA 4IS3A 1DIHA 4QO8A 1BG6A 2PD6A 4WWPA 2BQQA 1W44A 4XX0A 2Y2UA 4JZKA 4YXWA 3N2GA 5B7QA 2JB9A 3D6HA 2A67A 1Y8CA 4DF3A 16PKA 3BORA 1WMBA 4AS1A 4L02A 1AM4D 2F4VB 2A3NA 4JL5A 3SKYA 3DDOA 4NV1A 3V4LA 1PI3A 3MWDA 4E03A 2J3IA 4AO7A 5EJAA 1RRPA 3BD6A 4M0WB 3K2IA 3QVVA 2J0EA 2NYUA 5JY1A 3ITEA 3I12A 3FIUA 4IM2A 1RQXA 1VJDA 3DMNA 5C18A 1D3AA 3F5QA 4NAWB 5HI1A 2FSSA 3H83A 3DEHA 2AX4A 1NVTA 1TLTA 4K7UA 2FPUA 1Y3HA 3PFWO 3WLOA 1LUAA 4BQFA 3QE4A 3TIVA 3RYIB 4OREX 3D5EA 3CX4A 4B80A 2G9ZA 3KKEA 4NQKE 4KLRA 1P7CA 4NZZA 5C31A 2GXUA 1Y3DE 4P7IA 2L18A 3TNLA 2DHDA 2H07A 4QFDA 5TGTA 3KW5B 1PEKE 1ZFNA 3ZXSA 4BZPA 3ACCA 3UG7A 1JLSA 2C2OA 1KJTA 1UMBB 4RK4A 2RC6A 2DR0A 3SMVA 1YB7A 5J2RA 5AXDA 3UK1A 1NDHA 4D2KA 1A4RA 4CUZA 2R66A 1NX9A 1DOYA 4PHFA 4FDLA 2WS3B 5GZ1A 1UQTA 4REOA 3A10A 3UHAA 4FYYA 5JADA 3QEMB 2C3PA 3ERCA 2GRIA 4UCFA 4JGHB 4JI4B 4KWEA 3IR6A 1DBQA 2X3UA 2AB0A 1B00A 3BH6A 2QTZA 4K2AA 3VNBA 5AVXA 4YJGA 3ABOB 1GM5A 1CQPA 3VTKA 1PSZA 3O8RA 2QRPA 2NO7A 1IWBB 3JAKB 2FUG6 3BWYA 4RORA 1T8TA 4Z0NA 2PSEA 1YB5A 3WNQA 3ZHUA 3LBNA 3K9HA 3NTRA 5D5QA 2YQ4A 1B1ZA 1QANA 2JJ1D 4E2WA 1PR6A 4WUTA 1E7UA 5C32A 2H4HA 1CUZA 3BTOA 4NURA 3PBKA 3DPUA 2ARKA 4FCTA 1JF8A 1UGJA 1U0FA 1SULA 2AJLI 5K4MA 5AVQA 2AG8A 1CIVA 4QT4A 1PJ8A 1PNTA 2X3FA 1FXIA 4W1PA 1UF9A 3R5FA 2CT8A 3QTTA 4J2OA 2XE6A 4YJ2A 1ZUHA 2WKQA 3H8SA 4PBTA 5I47A 1KJ9A 5TXGA 2KWUB 2BS2B 1SK9A 1N2BA 1TUBA 2D2XA 4XIFA 1G7RA 3U62A 2FEOA 2ZS8A 3PUKA 5K0WA 1ZVMA 4HMQA 5M2QA 3ZDZB 3SI7A 4DIMA 2WUDA 2QE6A 3BF8A 3A6HA 3K5HA 2DTDA 3KZVA 4W8OA 1EM8B 3GRFA 4JEUA 3CZ5A 3L6CA 1W96A 1Z5SB 2NO6A 5E2AA 3FJOA 4JLBA 3WC4A 1KO8A 3RTBA 4BQOA 3I4FA 2Q0QA 5FD8A 3I3OA 3RT9A 3A3PA 3LU1A 2KDMA 3O3CA 1F0YA 2W2LD 3DO8A 2P5SA 3EBPA 3QEOA 3MMXA 1E62A 2DPXA 2NSLA 3RIEA 2W2XA 4HGYA 3IFWB 2FA9A 5CBKA 3ISJA 5JNVA 5K3EA 1I14A 1RWXA 3O38A 4UUMA 3ROTA 3B82A 4HKTA 2ZSFA 5IZCA 3K4QA 4XWKA 4JLVA 1YI1A 1OR8A 3DKIA 1E5LA 3F3YA 3HBAA 1I4LD 1TKGA 3DMYA 2P69A 2FU5C 4RM5A 4KFRA 4PSKA 1V3VA 4O29A 3CPEA 2V3CC 3OQNA 4F7ZA 5KAMA 1H5QA 3AE6B 4X45A 3U3DA 1NYQA 1YJQA 1X2BA 1RJEA 3QUSA 3FI9A 1OE0A 4JLNA 4BPBA 1RRCA 2GMWA 1KAOA 1F1BA 2OLJA 1AQYA 2CL6X 4J3OD 4B33A 1UBIA 2PT7A 1C1XA 3EISA 2VQDA 3GRRA 4LHYA 4QPCA 3WYDA 1E7PB 1H5NA 2HD5B 2R9VA 3TMAA 4FOSA 3KSMA 1ZINA 3L8HA 3PLAE 4GOKA 2ACEA 5FR2A 1T9ZA 4HAVA 3IAEA 2HWWA 2NZJA 5C35A 4B34A 1BDBA 4B6WA 2KLBA 2IF0A 3OEHA 1PHRA 5L53A 4OUDA 5CXXA 1VKOA 1P9OA 4UW9A 3SC3A 3OQHA 3GO4A 5IF9A 3RSSA 3DUFB 4Y1GA 4ESVA 3M6VA 4R5MA 4Q4JB 3HCNA 4PS3A 4YDRA 3QFFA 1X8HA 4YAKA 2BT6A 3BFKA 2QILA 1CUYA 2RBKA 2W90A 3LD9A 1V5EA 3EB9A 3AH7A 1YTLA 2C4UA 3SFDB 2CVQA 2EKLA 1D04A 2BGAA 1PUXA 1RLMA 4EYFA 2DFTA 1C8BA 1LQUA 1DUSA 4M8IA 4O1NA 4RQBA 3EY4A 4HPLB 4BBAA 3E6AA 5CXQA 2YUTA 3UB4A 2WDPA 4DDUA 1YQTA 3H6KA 3PA6A 2HWYA 5F4ZA 4WACA 2MSWA 4HDQA 2AOUA 1CIJA 3WGTA 4R71A 5FUXA 2IUUA 1FDSA 3BJMA 3H3FA 5BQPA 4OHYA 4OMUA 5IJ0B 1L7PA 2WVAA 4PBRA 3OQIA 3U81A 4EG7A 3NT2A 4ARVA 1VG0B 3QLJA 1TA9A 4KNWA 2OXCA 4ZRNA 1HNNA 3AV3A 5D01A 3X2EA 3BXPA 1W30A 4KG7A 1MENA 4RPJA 3INNA 1AF4A 3Q5DA 2VUTA 1U8YA 2XCLA 1P18A 1BDJA 2RHOA 4N5HX 4V0HA 3TGPA 2P9BA 2YZMA 2VZKD 1XVUA 1ZGCA 2O4CA 4BNDA 2BT4A 5A9RA 1IZYA 5BMVF 4O2AB 4CDMA 1BXTA 4LTMA 2C0QA 1C76A 3ZTTA 4C2BA 1I13A 2HXSA 4E11A 2C2BA 4CF6A 4ZVTA 4TV9A 1DINA 4D4GA 2OSBA 5T67A 2M6LA 1D2CA 1BW9A 1Q19A 3KR2A 3ZRFA 2QTFA 4EDHA 5U1PA 5LP6F 4PSAA 3BIWA 1OC2A 4ITRC 5FA8A 4MA4A 3EPHA 5I4BA 4E2FA 2NACA 2WX1A 2ONYA 3D8TA 3VH3B 1TO6A 2G36A 2PSSA 2GEDA 4KQHA 3X1JA 2W9XA 4YRQA 1KZ1A 4HNQA 4FR7A 3UQYS 3A3KA 1E6MA 3C70A 1SHKA 4WLEA 1KDTA 2JJ1A 1CF9A 2WJ3A 2G88A 3CLVA 1EZZA 3GFSA 2C9ZA 4C0KA 4YQFA 3A6LA 4CKBB 4CF4A 3K6RA 4LW8A 3VTZA 1KAQA 1GLGA 3UINB 4X7BA 2OCDA 5H4GA 1MB0A 4GP7A 3E5HA 4EI2A 2ZTVA 1R4NB 1A9XA 3KCQA 2WSMA 4KIKA 4EY7A 1EVIA 3QAQA 3OZWA 4YFYA 1AOXA 2YHBA 5D2CA 3BX1A 4AD8A 3O65B 8ADHA 1OROA 3C43A 2VK2A 1JIJA 4US1R 2LRWA 5E4TA 4PM4A 2FSFA 5CXSA 3QPUA 3X2YA 4FJ0A 1U8TA 2I71A 4IDEA 4KO8A 3EPLA 1BS1A 3LFUA 3ILVA 3FTCA 2INDC 1C1YB 5IJXA 3SHFA 4ZYWA 2VUHB 3X2XA 3PUWA 2J5KA 3Q5GA 3HZRA 4F5WA 3TGWA 3KZOA 1XZPA 1GDHA 3VOSA 5EXEA 2WY2D 4AY4A 2O6LA 3DL4A 2AIRA 3EY9A 4G1MB 2K39A 5JTTA 4AJKA 2SKEA 1JQ3A 3AR3A 4G2NA 4OGWA 1WW2A 1LD3A 1EYZA 1LBQA 3LCRA 3HCAA 3H11B 4Q47A 4KQWA 1SGHA 3D0KA 1S5PA 3WLEA 3QX3A 4WFKA 1L4NA 3EZGA 1I7SB 4FYHA 4Q66C 1ADYA 2A7XA 3OM8A 2QR5A 1GR1A 4Q7KA 1X39A 1Y44A 5IAJA 2AOVA 1RQRA 4G50A 1MGPA 3TFQA 3E8XA 1E8DA 5AW2A 1YS4A 2GH1A 3U13A 2C5FA 4DJJA 5LA6F 2F6RA 2AX5A 2CJXA 3DW3X 5TR5A 3OO0A 1Y3BE 3A6ZA 3ZD6A 1EM6A 4P7KA 1C9FA 1U1FA 2NZUG 3O3OB 2CXXA 3LX4A 2BI8A 4MYCA 4E15A 3HZHA 4BDTA 1JDBC 5CG2A 4KO2S 3EZ9A 2EKZA 2MQJA 1O9HA 2IHVA 3PUJA 4AWAA 2D06A 3OU6A 2XTJA 3L7NA 1UDBA 2EAUA 3DJYA 1FLDA 2ZWMA 4C09A 2PGIA 4BNJA 1Y1LA 2HWUA 4RNDB 2C4MA 4I4LA 4Q3KA 3X23A 2FKNA 4C0SA 3M95A 1QMGA 3KB6A 3S3TA 4BCCA 4BEJA 4WK0B 1N2IA 5EH9A 2GFJA 4RK0A 1WMSA 1WDTA 5D1HA 3T4XA 3DV2A 2H18A 5HS4A 2FG5A 4CMBA 3DQVA 1IJEA 3TEZA 1ITZA 1MUUA 5DHFA 3PZRA 2IYEA 2WKSA 1C30B 1ZCJA 1NN3A 3BJIC 3JYUA 5ALWA 2WPDA 1AE1A 2IYOA 1DCMA 4CGZA 1P0QA 1CP2A 2BFPA 2Q6LA 4P93A 2K7FA 1FDVA 1XXHE 3K4HA 5FNZA 1MBZA 4ENTA 3W5BA 3EZ7A 1U7DA 3RFUA 1QFXA 2P9CA 4HGZA 2ZB2A 5A3SA 1XRSB 1IE3A 1H4TA 2GJSA 2O7RA 3RSZA 3TUOA 2D3WA 4LVOA 1ZQ1A 1VI6A 2YTZA 4IWYA 4FGZA 3VR8B 2IWRA 3QU9A 3AGQA 1GRQA 3ZE7A 4CI0B 2NV0A 1O5TA 3W05A 1Y6RA 1UXOA 3OJCA 4QBTA 3RSCA 4CM5A 3N58A 3E03A 2GF2A 4UASA 3MUOA 4KZKA 4OXYA 2QRMA 1PFDA 3RS3A 3U7GA 2ZIUB 3EVDA 3R9XA 1DS6A 4EJSB 5IZCC 4M9CA 2LKCA 1IM5A 1AB6A 4IH4A 4YUVA 3TNYA 1RHKA 3CO0S 1NVAA 1ZDVA 2MR5A 1W49A 3P96A 4LZZA 5JD5A 4B46A 3U19A 4UFNA 5AVWA 3TM4A 3OG9A 4JQOA 2C61A 2OBYA 2OCKA 4XDGA 1GZ7A 5ALOA 2QRVB 1EEXB 3IB6A 3GMDA 3W34A 4D9EA 2Z56A 5GM1A 3IBSA 1YZTA 3GLHE 4IUDS 5B4TA 4HZIA 5IASA 1I80A 1DMRA 1A9YA 4LECA 1UJBA 4DJTA 1I3KA 5JXHA 3ORRA 4Z67A 3LP5A 5FYDA 4RAOA 1A5RA 3K9OB 5G0TA 5B6PA 3ZR4B 1DWUA 4I50B 2QAJA 1PLKA 1L5LA 2DR3A 5JJBA 2J85A 4KTTE 2J9XB 5I9MA 4NNPA 4TKUB 3CH4B 2VUUA 3T1NA 3MT9A 3D8RA 4EF5A 1VIVA 4QNNA 4LZJA 4Z9FA 3U1BA 1WULS 1Q1AA 3E4CA 3GB1A 2FMUA 1GZ4A 4LXIA 2QGNA 2RKOA 3SFTA 3IAS1 1OBVA 3IESA 1E1YA 3VTVA 3DLAA 3RUEA 4L4RA 2HLDA 1IB0A 3BE5A 1RD4A 1CRWG 3VJRA 3T99A 1X94A 5FCDA 5JRDS 1Z35A 4BIIA 2YZNA 3OOSA 3ZHZA 4CKEB 1WKBA 4US8A 3D2CA 3NUZA 4Q3LA 1EDDA 2EVWX 2H89B 2VQEB 3KYCD 2B35A 1XEAA 4HTAA 4M49A 2AF4C 4UZFA 2IY9A 2ODTX 4HDSB 1DJPA 3CG4A 3KQQA 4HL2A 2Y1GA 1CUUA 4GI7A 2JFQA 5LDHA 1UDXA 1OVMA 2YWDA 1ZXIA 1UUFA 1KHTA 4AXHA 3AJ8A 1EUZA 3ZWWA 2Q3CA 1V2HE 1QX3A 4AZ0B 1CRPA 2HRCA 3HZZA 3ZK8A 1VMIA 2NYRA 3PVZA 1MO2A 3FPJA 1NI4A 2D07B 2D13A 2ODAA 2F8TA 4WXPA 4W99A 1DKLA 2FN8A 3NKVA 1NU6A 1VPLA 1LNZA 3OFNA 5CX3A 1BYIA 2L0XA 2MP2B 1ZK0A 3BPSA 4YHBA 1GPUA 4KR2A 1WM1A 1GL6A 3HP4A 2F43B 2VFAA 4QDJA 1M1XB 2CB9A 3PPWA 4ZWNA 1FUUA 3LBIA 5T6BA 5CDFA 2FXIA 4XQEA 2G06A 4ZVVA 3V1LA 1OFTA 2GBMA 3W2FA 2O2ZA 2HA2A 4DTCA 1HX7A 2BGGA 1FTYA 4V2UA 3DXZA 5TMDA 2V8BA 2HB6A 1NR1A 1L3IA 1ZC3A 1XO3A 2HPHA 1ZWKA 4TV8F 2PXAA 1BMDA 3ZTYA 4YMSA 3VR6H 3W3AD 3VMFA 4CLRB 1KEZA 2K9XA 1NP6A 5DEOA 4MUIA 1O03A 1XTRA 3MLBA 1QGOA 4BVBA 1USKA 3S2EA 2C96A 2K25A 1E1CA 1EPUA 1HE3A 4FC7A 4D0LB 2LGDA 3N1XC 5LQRA 7MDHA 3AIOA 4DV3B 1ZVJA 1VC2A 1FQWA 1FPYA 3RUCA 2F00A 2GF9A 4BMPB 2AQ3B 4NBNA 4C0XA 3K73O 5F5XA 4KGXA 4FE3A 5JO9A 3N7AA 2I2BA 4CQLA 2XB2A 5LC1A 5GWXA 2ZIXA 1WV0A 1EFPA 2PIDA 3G13A 2ZTHA 3SF8A 2BP7B 5HXAA 2QX6A 3CIOA 2R6ZA 3A1QB 2YWFA 3X1KA 4JJKA 5FA5A 4GGQA 3OLYA 5HRCA 1ZSYA 5FPPA 4KDCA 2MSED 1Z2NX 1DAFA 3TNDA 1NUPA 4OB8A 5DI9A 3EW9A 5LBIA 3RCBA 4DZRA 4TXMA 2OCAA 2YYSA 4F0JA 5JQGB 3BT7A 3FPSA 4ROTA 5AW3A 4FZVA 2C2WA 3OESA 4KMRA 1P2UA 1V97A 2DOKA 1A9QA 4UVDA 3KVFB 1N2HA 3PHBE 5B55A 2WHXA 2CLOB 4XJSA 4KKVA 2KDFB 1MTOA 1CR0A 1OXMA 4GM1A 5LD2C 4LRTB 5D3DA 5FI1B 4GGMX 1X3LA 4DDTA 4URHA 1NOIA 2RPVA 2AW3A 2VDJA 4GZ3A 2IRWA 5K4GA 3KUCA 3PZ7A 3Q1KA 4RSGA 2XZOA 2A1TR 4K8OA 4O4JB 3EA6A 3FGOA 4M86A 4J4HA 4Z4CA 1PVOA 1YX6B 1NEKB 4AUEA 2FUNB 1PJCA 5JSQA 1Y98A 4OHXA 3PCRB 2ASEA 4PVOA 1OSNA 1R6UA 2ERXA 2GQ0A 3KWMA 1WTAA 2PM8A 3FPAA 3I83A 4X8MA 4XEUA 1KO5A 3OJOA 1VIMA 3P52A 4D46A 1I8TA 5D7GA 1F38A 4L4XA 1UOEA 1MRZA 5J2TB 1WR1A 4UZEA 1FQKA 2PGOA 3GRYA 2X5NA 3TQSA 3VU0A 4G8CA 1EBFA 1Q7CA 2C4KA 4MAMA 4UU8A 5C7LO 2NUAB 1KO2A 1OQQA 4LNFA 2HHLA 2ZYRA 3DZFA 4B76A 3QY0A 1XNHA 3H04A 4B40A 2IQ5A 2PMDA 3HH8A 3D7MA 3LZDA 3DOWA 2YNVA 3C1TA 5HTOA 3QMWA 1XKLA 2XMCA 1KI9A 1DRUA 3IQZA 1JW9D 2QX9A 3A9UA 3MMPA 4NBUA 1ISGA 3DUFA 3TLBA 3KS9A 3MUNA 1G2QA 3K5IA 4EZBA 4KX3A 4HFJA 3VR0A 3PGJA 4TTVA 4X8LA 4MJSA 4HVTA 2ZRBA 3SBDA 3PGMA 3TRHA 1OAAA 1I0IA 4PG5A 2B92A 1YR9A 1VRCA 2VYVD 4PU0A 2ZJDA 1FUKA 4G5RA 1EIZA 3MINB 5U4QA 2Q3JA 5KVVA 3BXEA 2DR2A 2XMSA 1M5TA 5J59A 1XEFA 3GOQA 4A6XA 2NO0A 5DNYB 3JQAB 3G2QA 3GJTA 2XYHA 2H1SA 1M8JA 1O6GA 2JFNA 1T3GA 2PS1A 2HJGA 1OWNA 4AY5A 3AX6A 4Q00A 1I1OA 2ENUA 1P7YA 3C3EA 4FGWA 4JBXA 2QDKA 1DAGA 2V5VA 2PVSA 3KYCA 3FROA 4EYSA 1L7BA 5KILA 4H3SA 4WOCA 2D1SA 3G8AA 1H8HA 1WE7A 2WF7A 4MR9A 4WCDA 3QZUA 4LV6A 1OILA 4D4HA 2MWMA 4S1NA 1OBOA 1SOMA 1SCDA 3I53A 1K89A 4E71A 4B17A 2NVUI 1TYBE 1NNUA 3TI9A 4CCWA 3OZAA 2FBWB 4RFVA 4GMFA 3TGLA 2FFQA 3KCNA 3HO8A 5KTTA 2ZUSA 5AZFA 2RDMA 1NW9B 3AR7A 1NLZA 3V6CB 2CYBA 4B09A 3N32A 3C8DA 1X6VA 4JR0A 3KH0A 4TMXA 2QUIA 4PDXA 1F6DA 4YMUA 1KFCB 1H8ED 3A1CA 2PS3A 3EWSA 3KEGA 1LJLA 1ZO8A 2EL9A 3IOEA 3TCXB 4O2AA 5DBOA 2DWUA 5HISA 3ULKA 5EQTA 3X2SA 4C22A 3T9EA 1IH8A 3RAGA 3L7JA 4DQOC 3ZNPA 4ZI5A 3SC2B 3WQHA 3GF4A 1GGHA 3PGEA 2BC9A 4YJ3B 3VUFA 3DFIA 2D59A 4CDRA 5LU9A 3DMRA 2HQOA 4DDVA 2JCYA 3GZ4A 2H3EA 2HRRA 1C9DB 1NULA 4FHCA 3SXPA 3H7AA 5L3VA 3EIEA 2XF8A 2B76B 3HDGA 4GKVA 1JT1A 3DOUA 3DWEX 4BEWA 3D7KA 3BB1A 4PLTA 3GRAA 1VL5A 1J0BA 4KRGA 3VAAA 4LYFA 2VHXA 1UPBA 4FW8A 2BFMA 2BL4A 3A1TA 1AT1A 1O1YA 5BRAA 4RD6A 3U52E 4PTZA 2GM5A 3WMXA 4KX5A 3DCJA 5G55A 3P20A 4EFLA 5A5GA 2H7XA 3ZZ1A 4M55A 2RBEA 4CKBA 4Q7QA 2EOAA 1SC4A 1LI4A 1BO6A 2JD2A 1E9MA 1EWRA 2MTBA 1OXSC 2KTRA 1AVTA 4NPCA 3H7PB 3MG9A 3PUYA 4YRIA 2Q4TA 2RKBA 3ZUPA 4RIHA 1T6YA 5TVGA 3S5JA 2BDEA 1A04A 4AMYA 2R97A 2RSLA 2H4YA 4HLDA 1FS5A 4ZT2A 2C7MB 3Q0TA 2QM7A 4QG3A 2W3RA 5KDLA 1Z7GA 1TZ2A 4IHJF 4KPUB 1QGDA 2HBQA 3SJAA 3ZJ5A 4DXGA 2GAJA 1WI0A 1VSTA 2QD2A 5DCYA 3PE6A 2C94A 2C3UA 3DZHA 4EG0A 3JRXA 4DA7A 5JXJA 3JARA 1J5PA 1XOIA 3ZC3A 4ASWC 3LOUA 1TC1A 5DF1A 1YMHE 4KSKC 1EKXA 2TYSB 2ON8A 5L7YA 2DT5A 4FYKA 4IVRA 2J07A 4NWIA 2GJKA 5G1PA 1XZBA 2UZ1B 3L6NA 5CB4A 2BKVA 3H5AA 4EH1A 5JNWA 3G88A 4I14A 4ZT3A 2GLUA 3LBYA 2VQ6A 2MSDB 5CFOA 3F1LA 1DG9A 1XF1A 3O91A 1E6KA 5DW3A 4BV2A 3BZWA 5IARA 2HSGA 3SMQA 1UJ2A 3ZGYA 5DMXA 4HXEB 4OOFA 2E4AA 3LQQA 1E64A 1DTEA 2VUIB 4MVXA 4XX1A 4UOEA 3NHLA 5EJ4A 5IA7A 3TW6A 2WHYA 1T0PA 2AFHB 2K8HA 4IWXA 1AA9A 4ENQA 1W94A 3KAKA 3DLPX 1YASA 1VPTA 4BNKA 3F73A 1RTKA 5HRAA 4GIVA 2CXHA 3WWYA 2LZ6A 3R4VA 3JATB 4TUYB 4IFIA 3EIWA 1H9BA 1CLUA 2XNHA 2WWWA 5EOVA 5KJEA 2VW8A 3KDSE 3AUXA 3ILYA 4CMIB 3EPKA 4BJHB 2NX2A 4HQNA 4WJOA 1TFRA 4FT2A 5CPBA 1Y1KE 2H1WA 1ZD9A 4NEGA 2PW9A 3UATA 1DARA 2B78A 3LWNA 3P4XA 4BBNC 3SKXA 2IZVB 2YXDA 5NULA 3BRCA 3UTDA 3ZWDA 4TUUA 2IU6A 2ZBDA 5KTYA 1DZIA 1I6KA 2DB3A 1SQGA 2NYPA 1A50B 1T4MA 2JGAA 3H9GA 5IH3A 1O6BA 2KD0A 4MYSA 4CHTA 1GXSB 3D32A 2AT1A 4F91B 1SHJA 4BUCA 4PLVA 4K9KA 3DLHA 4RM9A 5K45A 5FPHA 1JEYB 2UUAB 2E5FA 2JI9A 3FSGA 5TC4A 1MX5A 1ML3A 3APDA 3LUDA 3MAAC 1PR1A 4EAQA 4BX3A 2WXIA 3KUDB 2ZKIA 2EZ8A 4P8RA 5F64A 1DO0A 1LPNA 2VP2A 1ODSA 1N63A 3OCVA 1YB2A 1F5NA 3W78A 4OH1A 2J0JA 2E4WA 3ZQ6A 4UARA 3WVNA 4B9AA 1MJDA 3T4EA 3FTDA 1GOTA 1NWHA 3GCDA 4MV0A 4W9RA 2BF4A 5IJZA 4LX0A 3WBBA 2AMFA 4AWYB 1DCFA 1U02A 3WRVA 3TRJA 2LWPA 5DPWA 2V3SA 5I9LA 3QKRB 1YA6A 4XAQA 2JAOA 5KJFA 5KMGB 3IRVA 4PZEA 1KJWA 4FDUA 4M9SA 4XEHA 4D45A 1CQJA 5K8VA 1L7QA 4HX9A 4DCUA 4X92A 3KYDD 3L1IA 2RG7A 2QRZA 1IOZA 1D6JA 4UVHA 1R8SA 4KLAA 4BBZA 1BA3A 2AGVA 1NVXQ 4R2IA 3F71A 2C97A 3UCFA 4KUGA 1SCJA 4R40A 5EIXA 4YXWD 5B30A 3CRVA 3EDCA 4K2HA 2BMVA 2QRVA 5C3JB 3HI4A 4KE8A 3RROA 2QD4A 1SUFA 3KEMA 2WIGA 3WIOA 1A4IA 2FPWA 1G59A 5GONF 1PWZA 3O7MA 1FCLA 2R8XA 2M1MA 4YPFA 2PUEA 3WLAA 2XADA 1PU2A 4AB1A 4MS1A 4Q15A 1WMDA 4Z1MD 3HWX1 4Y3UA 3VYWA 3WADA 1AKNA 1EWQA 3MTJA 5JZSA 2JIDA 4AD9A 1UF0A 1N5OX 1QVRA 2W42A 4TKUA 1EFKA 1G21B 4MULA 4EHBA 4MW7A 3WLNA 4JU9A 4G3XA 1LX6A 1QBGA 2QWXA 3ZDMC 5KOJB 1O0CA 1LC3A 3HLTA 4BUZA 3W6NA 5CLLA 4KSYA 2KQ4X 2NTJA 1QJCA 3N0XA 1BH2A 3M5PA 1GD1O 2BBSA 1ZA2A 3U2SC 2ONQA 1AUVA 1SCBA 1X80A 2IGBA 3P19A 1FYXA 5B1HA 2Z8ZA 2WJ4A 4UOQA 3NHAA 5EP2A 1VM6A 3T5GA 4H27A 1EXVA 3ELUA 4F4CA 1ZXXA 4W8GA 1FL9A 4F7WA 1RJ9A 4DC0A 1H93A 1BCSA 1OLXB 2RFLA 3ZWYA 2ES4A 3A9KA 5LL6P 1P7EA 4MUFA 3MJHA 1R7RA 1M6EX 2AKEA 4E2YA 4Q1DA 1S2DA 2OBLA 4DABA 2OORA 4JDUA 4M6WB 1GV1A 1L5FA 4PIVA 1AQUA 1UQUA 3PR1A 4J43A 3GLFA 4BNVA 5KKCA 3BAFA 2NM0A 2OBFA 4KOAA 4TRRA 5CT9A 2HK9A 1OH6A 1Z2AA 4IDDA 4LDQA 4YSKA 4TZKA 4JQCA 3LQ2A 4HROA 3NC1C 4AG5A 3A28A 4GP9A 5G0WA 1EBUA 4HQ0A 3S44A 3U7HB 3ADBA 1RABA 4F46A 2F43A 1E2BA 1P1FA 4XD7A 1Z5PA 1RKVA 3R7WB 5EQFA 3FDJA 5F4BA 4RE6A 2PUDA 2P7HA 1SUEA 3A25A 4DKXA 1V11B 2CV0A 4NJOA 1SHUX 1JPJA 1U7PA 1VHTA 3EQ6A 4UM9D 1CVIA 1Q3HA 4OFZA 2KDIA 3AKYA 3FIJA 3D9QX 1IY0A 5DGTA 2BVNA 3T7DA 4P33A 4XCQA 2HO4A 1P72A 3BL5A 3UV7A 4Z7NB 4D1UA 1AUOA 1YVRA 4INAA 2PUCA 4MV9A 5HH5A 5AP9A 5B6JA 2XWJI 2YJ3A 2JARA 5CJJA 2LDBA 1DJOA 1E5TA 3UOGA 4DY4A 1BWRA 4C6SA 2X8JA 3ENZA 4E31A 2GPAA 2JJ2D 1UAGA 3T7SA 1PK8A 1G8YA 3TFWA 2P11A 4UQLA 3QQ8B 4MDEA 3O8QB 4YIHA 4HDMA 1MABB 3IDZA 3JAMA 1VCOA 5DASA 1SOWA 1Z22A 4LE6A 2JZPA 2Z5FA 3L41A 4F5EA 4KUHA 4PQYA 5AXCA 2FW9A 1SWWA 5AK6A 3X1MA 3RS4A 4REQB 5AFSA 1ZMBA 3T9LA 3V8MA 4K3BA 4BAUA 4RZ2A 2G4VA 1TBEA 1E2IA 4E2XA 2QPTA 2WTEA 1NBME 4HX2A 2R8RA 2JPDA 1I5RA 3CIFA 2BMFA 1XUOA 2GXSA 5CD9A 4JC8A 3NAGA 4NJMB 3VOBA 1QLWA 4QL3A 5IC6A 2HZ7A 4URXR 4K05A 2WTXA 2QMOA 3EZ2A 4MPTA 2O8EB 1UR5A 3CJTA 4I9GA 4HDCA 3TTXA 3RCZA 1VMDA 4JJFA 1T0HB 2VHYA 2RE8A 1PN3A 3MHTA 3K0SA 4BTEA 2JGDB 1GZVA 3MBOA 4QD3A 1BE1A 1ODTC 2UYGA 2FPIB 2DU8A 1XTZA 2IO0B 3AR6A 4N6EB 1N8NA 2NZXA 2ZZIA 5JYBA 2BFBA 3GY0A 1ZUNA 2I9PA 2ZSKA 3AI7A 3ZJUA 3OEHD 2WBLC 4O4JA 2J3KA 2LJIA 1U3DA 1N2GA 4OYRA 4LXHA 3GFQA 3KR0A 2NIPA 3GRKA 3PQ6A 4JVOA 4BC0A 2XI4A 4ICUA 3STXA 5BW5A 2ZPNA 1CY1A 4YJFA 4LVUA 1V3QE 4BGIA 5INTA 1N2EA 1F2DA 3KYDA 3ANXA 5BSEA 3PQ7A 2ZB4A 1F6BA 5ICGA 2IEDA 4FR5A 4B5KA 1QGYA 1O89A 1TYGB 3L79A 3AL0C 2XVYA 5AW7A 4CVNA 2YICA 3AI5A 1Q84A 1GLVA 5AK5A 1KR5A 1RHRA 1AKMA 2MHCA 1ESZA 4F3KA 1I9GA 3U56A 2J6BA 2BBTA 1OYWA 3T35A 1OBHA 1B6RA 4GFDA 4NZYA 3LZCA 4BV9A 4Z1MA 3EVEA 3IV9A 4FYJA 1IATA 4FZRA 2HF7A 3WYAA 3R4CA 4KQJA 5K8CA 3LGSA 3QW2A 3OPXA 3P7MA 2VQFB 1ZNZA 4UXIA 2Z2XA 2MJDA 1IY1A 1JAYA 2WMDA 4RA6B 4BX2A 2IZ1A 2PA0A 3WRXA 1QH5A 1YRYE 4F8EA 4YLGA 3I13A 1UXHA 4WOBA 1SKAA 2LHEA 1JJVA 3KKMA 1OI2A 5HM8A 4G5XA 4USAA 5EVCA 1ZL0A 1TVMA 2QENA 2NYVA 3EOBI 2WDRB 3OI7A 4DMGA 1BNCA 1JEQA 4Q1VA 3PDIB 1S3IA 2WC1A 2CXOA 3KOUA 5KX5B 3HFGA 4EKEA 4RKQA 1FB5A 4YP5A 3VSCA 4LZOA 4QSMA 3AERB 4KJZA 1QYXA 5DGCA 4BNFA 1FP4A 4IIHA 3V8VA 4WN9A 3TJMA 4ND8A 1P9LA 2VK8A 5DHTA 5LNK1 4JJ8A 1EFLA 2MEKA 3CUWA 4IOIE 3V2HA 1SE9A 2P62A 3NHRA 2ZJFA 1R66A 3ZGZA 1T6BX 4PFQA 3WYFA 2ZSEA 1B8VA 3Q10A 1ZXBA 3NP9A 4M98A 5J2UF 2GTHA 2HIHA 2XPCA 1R6XA 1A9TA 4C3VA 3IE0A 1LVUA 4OXXA 4RLFA 1OJLA 1USGA 2X4IA 3CISA 3NVAA 4O4HF 2MBQA 4P81A 1MEJA 5L6LB 3U4CA 3TZKA 5EJEA 2VRBA 4TKZA 4EUKA 4A1FA 1QRAA 3AONB 4G5OA 4ANUA 2XTZA 5JSHA 1YKFA 4MWGA 2PHZA 3KVVA 1X7HA 3S5UA 4AOFA 3FXAA 3M62B 3DE4X 4LAFA 4LJYA 3JSAA 1TJ4A 4CYEA 1Q0RA 5ACTA 1RM0A 5GIPE 4WZAB 3VNQA 3DH0A 4LYDA 4ZYNA 5K0CA 2BKEA 3DKPA 2ACVA 5HF8A 3EF1A 1K66A 4MWCA 2Z6QA 2R7LA 3PRJA 3IEMA 4OATA 4FE4A 5DYIA 3X0DA 3MILA 3QK0A 4LQ4A 3BB3A 1NFQA 2JJ2A 1QHFA 1NX6A 3SOZA 3NONA 1BTOA 3LYUA 2BWJA 3VHQA 2J59A 3RT7A 1A98A 1N5LA 2A9QA 3HVUA 4QUAA 1QPBA 4YC7A 1HT3A 5GVRA 3PHJA 1NF9A 3Q72A 2WRZA 4HDKA 1PGOA 1MN6A 3H7PA 2WM9B 2D54A 1KAMA 1Q0PA 2CFSA 2BGTA 3DMGA 4BCDA 1GAJA 4D6PA 4PYNA 2GYYA 5JH7B 1NV9A 4UE2A 4S04A 4G65A 2JZZA 1R0ZA 3MW8A 3ESDA 4ARIA 1VLZA 1FTWA 2PE9A 2MCFA 1RI2A 4C1CA 4W5NA 2X6RA 1EHIA 4K26A 5M04A 2Q42A 1W36D 2E18A 3U49A 3AR4A 2ONCA 1Q0QA 5BORA 5BV7A 1GQRA 1NXXA 4KYUA 2J9RA 3STUA 1RYHA 3AKZA 4A6DA 4WIAA 3RRJA 1BE0A 1ZH0A 3QMPA 3T8YA 4BN0A 2OORC 3BDIA 4ZREA 4BBJA 3CR8A 2HUNA 2YMQA 3DO6A 5CDFE 1S6YA 2HLNA 4XVHA 1JXAA 3HYLA 1ZPSA 4DRXB 4WINA 4FSBA 4U3JB 2V55B 3GFOA 5H3CA 2PXCA 4MVJM 2WE8A 3QNWA 4TWIA 2GFHA 2VA8A 1X9HA 1IZ0A 2PRKA 1TMYA 3JASB 3A1NA 1Z6ZA 4AYXA 1L6VA 1WETA 2ECPA 1T5DX 2UUPA 3DMFA 1Y5IA 4XSGA 1R1DA 1KZHA 3SS7X 6REQA 1CWUA 3VDMA 4ZTZB 2IKQA 1JMYA 4RGVA 3UMJA 2C2MA 3D3WB 2WV7A 3IAXA 2OENG 3GFTA 1P1JA 4TRMA 1Z07A 3MTNB 3DKKA 4FR2A 2FCQA 1SBNE 4DRYA 4FP9A 1OMOA 4BMNA 4XVCA 2WPDD 2VRCD 1X86B 3WA6A 4XUEA 4GNKA 2WMYA 4CQMA 3MJSA 2DT8A 1TFUA 2PT9A 4OHPA 1C3JA 2P78A 3T3NA 4TUYA 5JJLA 4A0HA 3AE1B 1DC4A 1MOQA 1WXXA 1N6PA 1ZBQA 4XTCS 1I32A 1KK0A 4WBNF 4PG4A 5ALDA 1CDZA 4BN5A 4YT2A 3GP7A 4ARBA 5E9AA 3DF9A 1SCKA 3UXYA 3QEBZ 1HYGA 3V8RA 1QR6A 2PMFA 3OT5A 3IOFA 3FUUA 3UGTA 3H3JA 3FETA 3GHHA 4IIVA 3DQZA 2QXYA 3SIWA 1EDBA 3QPDA 4L76A 1PG0A 4F21A 3OU7A 2QUZA 4DPLA 3VYSB 3PRHA 3G2NA 3IMKA 3ZGNA 5ARBA 4Z49A 2BR6A 3BHJA 1M6WA 3D02A 3IH5A 5CK5A 3C5VA 3NIGB 5G1NA 1DWPA 1ECCA 1G55A 4BZXA 1UM8A 1N2SA 4R1SA 1COWD 3WFIA 3JQGB 3WLMA 1W29A 2VPQA 1IK4A 3KT3A 2GOYA 3IAAA 5HFNA 1F51E 4B84A 2AOWA 1G6HA 3K9LA 1M2FA 1E1KA 3B1LX 2B8NA 2EKBA 5FYQA 3KQHA 2I1KA 2MSLA 3L7YA 4GPBA 1HNXB 4OHJA 1WJUA 1POWA 4Q82A 1JJTA 2BAGA 3IG3A 3EAFA 1GARA 5G40A 4KFUA 4WXRA 2XNKA 4G5HA 1G8GA 4J3FA 3I01M 5EFOA 4P0QB 4LPSA 4IJKA 2ODNA 4NC9A 3ODPA 4G0YA 4YGYA 1XCQL 5DIFA 4JNKA 4MELA 2J5QA 4E1VA 3WOHA 4AAYA 5KMGA 4OXIA 3VKWA 3HB4X 1M1YB 2GBCA 4RFSB 1MPEA 4RTMA 4D3FA 1RWWA 3MFYA 2JU6X 3RD5A 5AKJA 4TYQA 1BKSB 4H7IA 3LBAA 1SZDA 3G23A 3L2OB 2D1TA 1G41A 2RHBA 4W8HA 5DRYA 4O59O 2YVAA 3AO0B 2E6XA 1R0XA 3SOPA 2FZ4A 2OXTA 2CZQA 5JZOA 3EXFA 2B0JA 3BKWA 4NXMB 1OPRA 3HUUA 3ZHVA 2ABWA 2HLDD 3ZOZA 2FLKA 4G24A 4BXOA 2VDPB 1YN4A 2CNOA 2P77A 2C2ZA 1QDUA 3USES 4PYRA 2EJVA 3ZLBA 1FLNA 3OIGA 2P9QA 5BYJA 1Y33E 3D2AA 1AUXA 5HCNA 4JJ6A 2GBLA 2APJA 1DEKA 2RI0A 2NQTA 1LK7A 3IX7A 2XOEA 3IMEA 2IW1A 3NUGA 1NN0A 1KMMA 1W19A 4Y0VA 3SBLA 1G21A 2PVGC 2Q27A 4B4DA 2Y1WA 3SKVA 3WRXC 2B0CA 5KYVA 4U1RA 4M22A 1YZ3A 4LYGA 2ZCBA 1UM9B 2NWQA 4BKMA 4HB4A 3OD5A 1ZH2A 3DE2X 3PSEB 1RPAA 4JJGA 5IWCA 4WI1A 3W9SA 4AWJA 1EMDA 4CF7A 2AJ8A 2ADOA 4M87A 4DXFA 4DIBA 1TUIA 2XZLA 3V1UA 3W4IA 1J5XA 3OFND 3SU8A 3ZZMA 4PN3A 2QTVA 3FKYA 4LJPB 2JZOA 4AG6A 1ZJ4A 4DJAA 3LCVB 1T6NA 1PK7A 1ZNXA 3FVRA 5TEWA 1OLXA 4TS9A 2ZT7A 4PYIA 2GT1A 2ZI7A 1LEHA 3EVGA 1B2RA 3TE7A 3OVMA 4QWWA 3SSOA 4LF4B 1EO6A 5DLQC 3NZSA 3EZNA 3EMKA 2W2PA 1U5BB 3E8SA 3L7OA 4OIMA 5ALEA 4J7UA 1VKJA 3JY6A 4PPFA 2DKFA 4CLHA 1CUDA 2QVLA 3Q7IA 4ILKA 1EP9A 5I3CA 3AM1A 2I22A 2DQZA 1L5VA 4MVJA 5J23A 3C7KA 3CF6E 4PSDA 3AHFA 4EUEA 3QLUA 3O4VA 1NT4A 3EW7A 1GPNA 2QS9A 2QEJC 2KJ6A 1VP3A 2XT6A 3D6UA 3JQPA 1IG0A 4TSSA 1FJ2A 4W1RA 1WUKS 1FZQA 3IMGA 4G09A 1QS0B 4CLOB 4LUCA 2D74A 2VHZA 4M8NE 5EPUA 3NV9A 4Y30A 1A9SA 4MRAA 4P4GA 1V11A 3RIMA 1DBPA 1DDGA 2DZJA 1F0ZA 1G5TA 3B6JA 3HDYA 3DDCB 3HGMA 1E3WB 2VRCA 1E8MA 2C8LA 1R0KA 2VPPA 2XEDA 3NIDB 4CKZA 3SFPA 4WFJA 2SECE 3UUEA 2O8DA 5ITWA 1TYDE 3VYRB 3B6EA 4EX7A 3HCDA 2IHBA 5IH7A 2JFVA 2CFCA 3FSJX 4YDSA 2DSTA 1ISMA 1JKJB 2QF7A 2W98A 4N9QA 2PYZA 2A4KA 4OHFA 3B1JA 2JIQA 3W8RA 4IOKA 1QE3A 4IW3B 1U9JA 2ZR8A 4QYIA 5I8ZA 3U0VA 1EGVB 3HN2A 1BHO1 1IEWA 1A7UA 3B6ZA 1Z63A 4KQEA 4XQCA 3O8QA 4AQ7A 3GJ4A 3H65A 3GOEA 1VYHA 1DIGA 5K0LA 3PGXA 4CIYA 2W2OA 3LX6A 4PXAA 1NWCA 3V46A 2KN4A 4KR9A 1E63A 1JTEA 2Q4RA 2IT1A 3FNBA 3MK31 4FFBA 2JXTA 2WXNA 1U2SA 1NJ2A 4RC9A 4QIHA 2D0PB 3FF1A 2GEBA 1OQRA 1JQKA 3L8EA 2YCLA 1TT5B 4REQA 1KSFX 1OW3B 2V45A 4D9BA 5IQKA 3L18A 4MGHA 1BQEA 1G19A 3MCZA 1VGVA 4OJNA 3EUEA 2WJIA 1YS7A 1FQOA 2QVYX 1QU3A 3D59A 3BYYB 4L8WB 4WECA 3RFCA