3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
4YN3B 5JXGA 1ITPA 3A3NB 1PEKE 5FFNA 2W2QA 1KDZA 1BE8A 3I37X 3P5BA 3DDZX 2W2NP 1BE6A 3CNQP 5CW1A 1P7VA 2V8BA 5FBZA 1TMGE 1WMEA 1ST3A 1MPTA 2Z58A 3ZXYA 1GNSA 1SN7A 1SUEA 3VV3A 5B1EA 1T1IA 4DJ5X 3DVQX 1Y9ZA 1KE1A 4CG0A 3SQOA 3D43A 1AK9A 1NDQA 1SBNE 1R64A 1NDUA 2W2PP 1ZVKA 2IY9A 1Y4AE 1VSBA 3A3NA 2SBTA 2WWTA 1GA6A 3LPAA 3DE4X 1SUPA 2Z57B 1SUCA 1LW6E 5K7SA 1JEAA 4WOBA 4CFYA 1NLUA 1TM7E 1OYVA 1SUAA 3I2YX 1YJBA 1C9NA 4HX2A 2WUWE 3AJ9A 3L1KA 3GCXA 1BFKA 1SIBE 2ID8A 1PFGA 1SCDA 4J94A 2ST1A 4H6WA 4Z2AA 3DWEX 3VSBA 1GCIA 1AF4A 5AQEA 3EE6A 1OT5A 1SH7A 5FAXA 1MEEA 3QMPA 4M1ZA 5AMXA 2QTWB 1Y3BE 3GCWP 3A3PB 5AVKA 3LPDA 1Y3FE 1WVMA 1V6CA 4K8RB 1YJCA 4RYDA 1Y1KE 4NE9A 4C3VA 3CNQS 3I34X 1SBCA 1SBHA 1IC6A 5I9SA 4DWWA 2W2QP 1EGQA 4MZDA 3DVRX 1GTL1 1TK2A 3P5BP 4NMXA 2X8JA 1IAVA 3OSZA 2QTWA 2PMWA 2XTJA 5JMOA 3AJ8A 4ZOQI 1GNVA 3BPSA 2W2OA 2WUVA 1C9JA 3SQOP 3I30X 2SECE 1Y3CE 2PKCA 1R6VA 4NE7A 1AVTA 2Z2YB 3DW1X 3DE7X 1ZVJA 4JP8A 4ZARA 2Z30B 2B6NA 4YN3A 3LXUX 1GA4A 2Z2XA 3GT4A 3QFHA 3WIUA 3UNXA 1T1EA 4BWGA 1TO1E 5JXHA 4DZTA 4OMDA 2P4EA 3CO0P 3GCXP 1GT91 1AQNA 2DQKA 3DE5X 2PWBA 5SICE 2W2MP 3TI9A 1S2NA 2Z2YA 1Y33E 3VHQA 2W2MA 2ZWPA 1TM4E 1S02A 2SICE 4CFZA 2PQ2A 2G4VA 1KDYA 1SELA 1Y4DE 2IXTA 3DE0X 4LVNA 1SCJB 1BJRE 3EIFA 2Z57A 3Q5GA 3DVSX 2ZWOA 1SCBA 1Y34E 2SNIE 5ARBA 1DBIA 3DE6X 1Q5PA 4KG7A 4C3UA 3EDYA 1GTG1 3F49S 3DE1X 3WIVA 4B5LA 3PRKE 1P8JA 1ST2A 1SBIA 3F7MA 3GT3A 3H42B 3A3OB 3TECE 1PJ8A 1WMFA 5JXIA 4KB5A 2Z2ZA 3HJRA 1SPBP 1TM1E 2Z56B 3TI7A 4FONA 2XTJP 1SCJA 1V5IB 1CSEE 2E1PA 3A3PA 3BPSP 2W2OP 3VV2B 1PTKA 4K8RA 1GTJ1 3F7OA 3Q40A 3BGOP 1TO2E 1XF1A 1SBTA 3SICE 3CO0S 4LVOA 1EA7A 1S01A 2W2NA 3H42A 3AFGA 1GA1A 2TECE 3A3OA 3DYBA 1SCAA 3BX1A 1CNMA 1OYOA 1HT3A 2Z56A 1YJAA 1V5IA 1AV7A 4AKTA 1WMDA 2HD4A 1TM3E 3T41A 2ZRQA 3VV2A 1TM5E 5ARDA 2W2PA 1BH6A 1SCNE 4OMCA 1Y48E 4OV6B 3LPCA 4WOCA 3DE2X 4H6VA 2PRKA 1KDVA 2Z30A 1R0RE 1WSDA 1SUBA 5ARCA 2WV7A 1KE2A 1P7WA 4GI3A 1SIUA 1Y3DE 3WHIA 1TECE 4AKSA 2ID4A 1SIOA 2DUJA 2PWAA 2HPZA 1AH2A 3ZXXA 1A2QA 3QTLA 1AU9A 1THMA 4KPGA 5JXJA 1SPBS 1C3LA 1DUIA 4H6XA 1C9MA 4NMXB 5AVJA 1SUDA 4HVLA 2X8JB 4OV6A 5B1DA 3DW3X 2PMWB 3VYVA 2DP4E 1YU6A 3BGOS 2Z58B 2GKOA 4I0WB 3GCWA 3WQBA 1BFUA 1SVNA 3D9QX 2PYZA 3PTLA 2XRMA 1UBNA 3DE3X 3VTAA 1T1GA 4NE9C
chains in the Genus database with same CATH superfamily
1EM8B 4UDYX 3S2ZA 2QSWA 1X1DA 4EHLA 1O94D 1Q16B 3MT0A 3FPJA 2BMEA 2KXHA 3GTYX 2OM6A 5ED0A 3F46A 3P5BA 1EU1A 2QJ3A 3UJAA 5HN0A 4K3VA 4OIFA 2F3QA 4E5NA 3CA8A 1C2PA 1S10A 3CXCR 2AN3A 4P82A 3JASA 4BNLA 3ZCUA 2O2DA 1F9EA 5CM9C 1NMYA 1AK9A 4UZSA 3AF5A 2IZ0A 2B5JA 2R00A 2IZ6A 5DYNA 1MV5A 3EVWA 2XS7A 1ZRHA 3IC1A 2PD3A 1U7ZA 4RW6B 1REVA 3M3HA 4ZPBA 3VA7A 2WPDA 4JJIA 1UA1A 2VODA 1NN3A 4L5AA 4YEAA 4DDHA 3RADC 4LXQA 2OPRB 2N9UA 3B1ZA 4NCGB 1TVKB 4J1SA 2F1FA 4KJXA 4AFFA 4K9MA 3G2QA 1BXRA 4B3DA 1SZDA 1TM2A 4URQU 5CBKA 2ZSIA 1RA7A 2AF3C 3AM1A 3SV4A 2NU8A 1EI9A 4UVHA 4TLRA 2EX4A 1Z39A 2D1QA 4DSTA 3ET5A 2ZJ7A 3IDSA 4EWLA 3VU9B 1IJEA 3NOXA 2UUTA 1L3UA 4OQYA 3F6CA 4WN3A 3LQRA 2LTAA 3CUEF 3KOWA 2XIJA 2HS3A 4P0TA 4FVMA 4LMZA 1IWGA 5JJLA 1E2GA 2EZ9A 5AVXA 2MZTA 5CJ2A 3L09A 1ZK2A 5KDLA 1HWUA 2XEDA 4Z9XA 5JU6A 2A9QA 4MPTA 4FJ2A 3ZTTA 3D1QA 2JDIA 4Y6RA 4X6YA 5AK0A 4IINA 2ZXEA 4LIWA 2VHYA 3GRVA 3DOJA 5H3CA 1PV2A 1IEXA 1SXPA 1VS3A 3ZZZA 1YULA 4UAUA 3HULA 2UZ0A 1D7OA 2X22A 3HU3A 3KK3B 3CLVA 4BX2A 1TIKA 1LWOA 1Q15A 3HCAA 1OLUA 2QL7B 5C5IA 1L3BA 2P6SA 1SZCA 3HJGA 2AKWB 1DDOA 2Y4NA 2HNZB 3PLNA 4I4IA 4FZ5A 4QQBA 3JVIA 1DJLA 4Y1FA 4DYDA 4UTXA 1JR3A 3HKDB 3V6JA 2LU1A 3E7WA 3X2SA 4AJ4A 3EIFA 2XO7A 1C8BA 4KI0A 4GICA 2WZDA 4HY3A 4BFUA 3QF4B 5AKIA 4C3MA 3JQFA 2SNIE 1UC9A 1NI4B 3S28A 2GQQA 5KNDA 3KU4A 1Y1RA 2HY7A 3HN2A 1KKUA 4J6FA 3WGMA 4LREA 1YZHA 1C9DB 3FD8A 2A58A 2XYQA 3A10A 4PW0A 3S7TA 4F96A 5JH7B 4C4YA 4Q1CA 3EMKA 3QSYB 5EMMA 2F4VF 1HQDA 3B6KA 2C8KA 1WUYA 2QZZA 3ZJTA 4PV7A 5CDFA 3M32A 1US8A 1RA6A 3EEFA 2VNHA 2Q8QA 3EPGA 3EWNA 3RVLA 4KC5A 1FFGA 1X42A 4G5RA 3EOBI 3NDBB 5CCXA 2VJVA 3LQVA 3WGHA 1E3WB 3PC7A 4EW3A 2XTNA 1PZFA 4HZIA 1JIUA 2HH9A 2HYIC 1E6MA 5F4ZA 3DOKA 2OBYA 2EW1A 3UOWA 1Q0RA 4MVJG 1G2EA 3E1SA 4UCXA 1YJ8A 1UVIA 1Z0KA 3ZBPA 2QRZA 4O25A 2OUIA 3E0QA 1ZM7A 2PAAA 2WBMA 1UMDA 1DELA 3HJTA 4G5YA 4WNCA 3DMDA 3K2QA 5EUHA 2BDEA 1MG0A 3R3VA 1QHEA 4WE1B 4S2UA 4BO7A 4OYOA 4BNXA 1KIFA 1BQ3A 3PXDA 4CCWA 3L6OO 4G4JA 3SR0A 4CT5A 3CCVS 2R1TA 1XDZA 3BKTA 2P77A 2TRSB 5F76A 2FP3A 3N6VA 3VQTA 3NLCA 1CUEA 1Z75A 4BGVA 1LDBA 2A30A 1QFJA 1PZHA 3NWPA 1QZTA 3WISA 3O8WA 4EBCA 3ZV7A 4Q4CA 3S81A 3V2HA 1BFUA 2MJNA 4JYAB 1YH3A 3CZ4A 3SM9A 4C0HA 1I1NA 2P68A 3Q8VA 4Y6QA 2BSQA 2ZJ3A 3DOFA 1E64A 3FTFA 1K8XB 4YJFB 3VZBA 4DLUA 2JFHA 2YYZA 5ENDA 5C8XA 2G5PA 3JTPA 4QICA 1SOUA 1QM9A 4P1ZA 3UR0A 1GL6A 4RKWA 4PXYA 4YRIA 3BYPA 1IQTA 3MBIA 4DQXA 1GIAA 3ZWBA 1UDRA 2EERA 3LRTA 4H4MA 1XXHA 3IPLA 4ECXA 1XZBA 3AM5A 1I13A 2PO7A 4N5SA 2MGZA 1F2DA 5LWHA 2RH8A 1KVIA 1T8PA 3A4TA 4IY1A 3PNOA 3MM8A 1KQFB 4E2ZA 4TV8F 3AEKB 4ER5A 3O1LA 2JH9A 3L1KA 5KTMA 2R8JA 4RX6A 4TVBA 4M99A 2P9EA 1KNQA 4ZPJA 4W9NA 2COEA 3T7IA 2WKWA 2YZMA 1E7MA 4YALA 3HZGA 4RKUC 1MGPA 2PLRA 1DBDA 4NS1A 4O2BF 5ETRA 5LVAA 2KU7A 4JI6F 1ZN7A 4R2IA 1UJ2A 5E2QA 2ADFA 3AHHA 1E4YA 1JQGA 1FPQA 2V7VA 3PQFA 1A9OA 1Z5NA 5CP8A 4BHTA 1FXWA 4GR4A 2B4AA 5A6VA 4OX7A 4GECA 4KIJA 3IEXA 3Q23A 2HKIA 5A1JA 3DD5A 4LR9A 4EA9A 1FMCA 3KK0A 1WI6A 2IM3A 3OSZA 1NYRA 4ZT4A 2PEBA 5IM0A 3AK4A 4A8SA 3O1IC 1H6BA 1PT6A 4MUXA 5F0WA 1GOTA 3KR9A 1DTQB 3DL2A 1PJ5A 2VT3A 2WVFA 1SB6A 2VJCA 4R25A 3U49A 3UAGA 1B3BA 2RHRA 3FCXA 1MR3F 1V8OA 2G67A 1C2TA 4JSYA 3KJIA 1S1UA 4FVCA 2BE9A 2XMDA 5H82A 4YMIA 2R8ZA 4TM7A 5HL7Q 1NIPA 2N7YA 2HWXA 2PYIA 4AIRA 4DL7A 3QLVC 4X61A 1JAXA 3WMEA 4ACAA 3A9WA 4DXAA 4MKYA 3AILA 1TK9A 3RIEA 3QLTA 3JQPA 4LQLA 1AUSL 1RAEA 1IXZA 2H48B 3R6DA 3CFYA 5BT9A 4FOSA 5EE3A 1HWLA 3MXTA 1GXSB 3QEBZ 1F8YA 2XMKA 3ETLA 1QIMA 4QEZA 3WBZA 1FP2A 4DV4F 3TIXB 1L3TA 2AC7A 3DBOB 3HG7A 1V35A 4ZVSB 2EZ8A 4IZHA 4X3PA 4EP1A 3I72A 2FPIA 4KYIB 3ZCVA 1JAHA 5LMZA 4ZVOB 1YRQA 1USGA 2BBOA 4FCCA 5JRZA 3HBLA 2QVBA 1C30B 5FTWA 4ZVNA 4C0OC 1QKIA 3D4LA 1YHQS 3HDGA 3EOZA 3M6IA 3RASA 1EEHA 1AZSB 3BQ1A 5FPTA 4CEIB 3T3DA 2Q6KA 4X64J 3HJRA 3TI7A 4ZVVA 2IUSA 4OHOA 1Z2NX 3AV0B 3JSAA 2GRAA 2LCWA 2O8VA 3N79A 2FLPA 3FIUA 3FFTA 1HPZA 1O89A 1FX4A 4K8RA 1YS2X 3MCTA 721PA 2MTLA 1BWPA 1QM5A 2HHLA 1E92A 4NEGA 3GFZA 2VTDA 2TMKA 1QG4A 3QU7A 2ZZKA 1XALA 2HFKA 4IIXA 3NEPX 2F4FA 2FMHA 2Q0SA 4JL6A 1TMOA 2PY6A 1V9CA 4BC1A 1EVKA 5LWQA 3GNLA 3JWIA 2VASA 4H7HA 3OTEA 4IZOA 3F4KA 4ENPA 5BSFA 2ZRQA 3T1NA 5HTOA 1CEEA 1IM2A 5DM0A 4E08A 9RUBA 4HYEA 1B26A 2M2IA 4DJTA 3DO6A 2VNIA 3T5GA 4DCJB 1FS6A 3G8AA 4QDZA 1T8TA 5BNZA 2KYZA 1Y3KA 1ECGA 3MMSA 2REOA 1JJAA 3V4ZA 3JB9k 1OBCA 4IXNA 3PITA 2Q3FA 3UVEA 4W63A 3CSKA 1V6AA 1PTJC 4KHRA 3WYFA 2VDOB 2X2EA 4ZT2A 2HHSA 2PIDA 1N5MA 2AXEA 4U7TB 4AK9A 2YZ7A 5CDFE 1S3FA 1B23P 2LMIA 2ROPA 4FU0A 4KWTA 4P33A 4X45A 4W1QA 4W5TA 1VQSA 2GKOA 3O2NA 1XL0A 3LCVB 2GGPA 5EZYA 5JS1A 1MMDA 2HSGA 4F2GA 1NLFA 5G4KA 2IRUA 5J5VA 1TB4A 5FEUA 4KGZB 4K4ZA 1QIGA 2ETXA 4WV3A 1LJ8A 2KI5A 5JBQA 3DMYA 1XDGA 2JF0A 3PLAE 3O4JA 2CSXA 1TYZA 1MB3A 1LK7A 2VQEF 5CW1A 1TYDE 4R0VA 4RW4B 1T9YA 2GZDA 5FP0A 5IM5A 2DETA 4S3MA 2AKAB 4QECA 4JOQA 1MNQA 1XEFA 3R3SA 1LV5A 3VZHA 1JSRA 3WMFA 4TQ9A 4GDMA 4PN3A 1GKLA 3LX5A 5FI5A 3T1HJ 3CM0A 1C1BB 3SMVA 4QQNA 2GZHA 3KUEA 1JEAA 1ULZA 1YB4A 2CLCX 4HNUA 4C3ZA 1E5XA 4TYPA 5IAGA 3SJZA 4DSUA 5KSYA 4Q12A 3K8OE 1PJQA 3G13A 5T7BA 1MQ8B 4XVHA 4NFSA 1CDOA 1E1CA 4IGKA 4Y9RA 4KUEA 1LQ2A 3D1LA 4ILMA 2FI1A 3O5AA 1M90T 5B6JA 3GEMA 3QFTA 5T8KA 1RP5A 5TS2A 1KR4A 3GNQA 3EF0A 5I9TA 4ZCQA 4CI9A 5D7BA 4CL0A 1LQTA 1NASA 3ONWA 3M2VA 2LD4A 4AMGA 1A8UA 3JX9A 1N88A 3H5VA 3PGJA 3VTFA 4P75A 3S8MA 1XXHE 4NY1A 1YZ7A 3ELUA 2OB1A 5JPIA 3CLSD 1Q7EA 2P6UA 3CKLA 4NXNJ 5J5AA 2VBCA 3PPVA 2H4YA 3DOCA 1ZS9A 4OK6A 1X9IA 2BKAA 2ZRDA 1H38A 2Y3IA 3BXZA 3B7WA 1FP4B 3WIUA 1PJ2A 3UWPA 1SC4A 2XVXA 1YRWA 2WKQA 1J6UA 2VQFB 5JXHA 3EPKA 3MQFA 3CZRA 2ZRBA 2WTUA 1RE1A 2P5TB 1QQAA 1OSCA 3A1EA 5G0SA 4BB6A 4F8JA 2YH2A 4F38A 4FIDA 4RPCA 3UMSA 3UUGA 3JWGA 4G5HA 2FA9A 4MHOA 2VUSA 2R7XA 2UXBF 2XMTA 4V19J 2HDOA 2IWRA 1U48A 1Z7BA 5LA6F 5KYYA 4I3FA 2VTBA 5DS7A 3V4OA 5L8VA 3TDKA 4LVNA 1RP7A 2HRZA 2VQ3A 2YY7A 3F2IA 3PNMA 4OY3A 4JV1A 1O6XA 2X9NA 3DBIA 1C1DA 3G5AA 4I6AA 1CRWG 4UMDA 3LRPA 3I96A 3COWA 5NLLA 1NQXA 4A2WA 4KLCA 1GXUA 2HHCA 4NAVA 5DYGA 2B6AA 3S1TA 3LPNA 1KH3A 4KMMA 3SOPA 1ZONA 1TA9A 2DGOA 1BX0A 1WY7A 1LLUA 3QIAA 2ZVJA 4MWEA 5HK9A 3EXFB 5ISMA 3U7EB 4LQ4A 1W4ZA 5K09A 2YXLA 2W9CB 4ZT6A 3BG5A 4DMCA 4LKRA 1CJTB 3RB6A 5AT1A 1NN5A 4WXEA 5JDIA 2HWHA 3SSSA 1W1WA 1F20A 4ZI7A 4XTRA 5KFVA 3NHFA 1MTZA 3VYRB 1ZJJA 2ZIAA 4X2BA 1YGPA 1JQ5A 4QGHA 2RGUA 3LDHA 1ZGAA 4HDSA 4DKXA 2IMOA 1RTKA 2ZB3A 3SP1A 4DN0A 1HEYA 4B6PA 2OBBA 4BDTA 4BX8A 2WSMA 4I4BA 4K3UA 3RW9A 3TQQA 2DF8A 4I55F 3T5CA 1Z82A 2YFYA 3IAS1 1GJRA 4LSNA 4JGIA 2HLTA 1U3VA 1I3OB 4ICLB 4XM2A 1FFEA 4YAGA 4OHPA 4Q4JB 4W1RA 1U7HA 4AURA 2DHRA 5B0BA 3A4NA 1E2JA 2N82B 5ERGB 4A4DA 3TEJA 4IQ4A 3GX1A 4NCKA 3G0IA 1UPMB 3QUCA 3W5SA 4IW3B 4AW9A 5DQIA 1UA0A 3A2NA 5DGAA 2VKQA 4KH1B 2FEAA 1OA1A 1L8XA 4ZMBA 1IXYA 1JKJA 3FBEA 2YYSA 5K20B 2X1FA 4Z4GA 2BJ9A 3H2LA 3DOLA 2R1UA 2X1AA 3D66A 4RLFA 4L16A 1XZPA 1ZR4A 1TVMA 2GZAA 3FEXB 3MJEA 3VPCA 3ZHRA 4RABA 4DPOA 5ETJA 2DLNA 3FOWA 3ZGLA 3K5IA 1RI1A 2K5UA 4BQQA 2YQZA 2M3DA 3UAYA 5CBPB 4YR7A 4GG1A 3FYHA 1FEHA 2VG5B 3WGTA 3PX3A 4XFDA 1MPTA 3DU5A 4B3XA 2Z58A 5LMUF 2HDWA 3HK2A 4KN9S 4GE3A 3KVOA 5L3VA 1KWMA 3BMQA 3NALA 1QLNA 1RB0A 5AW0A 4S12A 4Y0FA 1AO3A 4AAYA 3H65A 3C3AA 2XC9A 3ONEA 1RLMA 1A7UA 3BGRA 3LU1A 4DF4A 4MUNA 3TS1A 3H8WA 5K8MA 5C7IO 2NOAA 1VHIA 5IK2A 2WSIA 3B20A 5K7SA 5D6GA 3Q0TA 3BL6A 2HQIA 1L4LA 3OXLA 2CWKA 2AFRA 3IVGA 1RBAA 3I45A 1XEXA 3RJTA 4HX2A 3QE3A 1P2SA 4ZVHA 1BFKA 3PNVA 1AN0A 4YAEA 4BU0A 4WBSA 5I3UB 3H2HA 3MJSA 4MV3A 3NU1A 1XFDA 1W4AA 4ALIA 2PZAA 1KJNA 1UWKA 4FYVB 3KYLA 3NASA 1Z9BA 3EGIA 4X62J 1JLEA 4MVXA 2VPTA 1FI4A 2ZUSA 5IMBA 3S68A 4KNYA 3RGGA 2FUCA 5A6SB 2WONB 4F4HA 2HWYA 2WUFA 3CPHA 2FF7A 4OAOA 2W2LA 5ICSA 4I4TB 5T57A 4FDMA 2O0KA 1PYGA 3T3IA 1MMLA 1Y5IA 4ND1A 5GOTA 1RAHB 1HDOA 1X80A 3DHYA 4DRZA 4L08A 2XE6A 4MR8A 3DLEB 1G8FA 4NXNB 5KG7A 2O6LA 4PRZA 2WIAA 3DPUA 4EBBA 2YJ6A 3R9LA 1TX4B 1JDBB 1Y3CE 1YSCA 1G41A 2D7CA 1Y8RA 3AXKA 4E14A 4BZXA 5CB6A 1GRQA 2MSDB 2BKUA 2NP6A 2QA5A 2YV4A 4TU8A 4B81A 1RBOB 1ZNQO 1JH8A 4MTPA 4RIGA 4XPCA 5FDFA 2VJNA 1FJCA 2ZYTX 2XGPA 3DQPA 2Y93A 2XBPA 1QE3A 2IYYA 4UVIA 1D5WA 2V4JA 5F73A 2RIRA 3JSMA 1H9AA 3HJBA 4BB5A 3A6JA 2IITA 2IJGX 4C87A 4B3RJ 2DCUA 3UH1A 2BAGA 2IELA 4I6EA 2VH7A 3ZGZA 4PZLA 2DJIA 2CBGA 4AUKA 5BT8A 3SHOA 2XZOA 2EAUA 1OIWA 2VP5A 3N2EA 3SE0A 2WRMA 3F5SA 3MEEB 4KQCA 4RW0A 1J0XO 1FTGA 3LWNA 4PSDA 2YIDA 2CWDA 4H7EA 2E29A 4N48A 3K70D 4EQ6B 3K8VA 4BEWA 4OJHA 2XNKA 4KV8A 1H5NA 4JI3J 3N59A 2EPIA 3HVJA 2R44A 1CZHA 1PDVA 2BRUA 3LC7O 1I5EA 2KBFA 2ZVQX 1IBRA 4A6PA 4IDGA 2V59A 5JEDA 2D6FA 1JMKC 3SIPA 3KOMA 1I94F 3H86A 1JXAA 3M4JA 4B4WA 5JJIA 3H17A 3O3LA 1FP1D 2DRIA 3KOYA 1PJ7A 5KSPA 3WLIA 2Z56A 2ZJRQ 5K8TA 3CTRA 2IBOA 4C4PA 3K7RA 4JS0A 1HSOA 2YKQA 1CS4C 3BZUA 3MXOA 2REQA 1CYEA 2N3LA 4HNHA 1KRXA 5F9FA 3HDYA 4IXMA 3CRW1 1P6UA 4DV6F 1DX4A 3CC8A 3KSBC 2HT6A 1ZRMA 3PJGA 1RKXA 1UJCA 3NOOA 5L3RA 3GAFA 2ZAYA 4ENTA 5LN1A 3NGDA 4OI2A 4KFBB 4MQEB 2ZWMA 2WHQA 3AY0A 4GI1A 1PT9A 4DG1A 5IFKA 2R6AA 4HVLA 3I9LA 3DW3X 1IY9A 3A0RB 5FIUA 1XMSA 3BGOS 1H8HD 4DA7A 4II3A 3GUVA 4ZZ3A 4KUGA 1FJGJ 3OIVA 3RFUA 1V8BA 2J8ZA 4DWJA 5JRDS 4N41A 3GGPA 2YZ2A 2Q3BA 1WHYA 3M82A 4MKRA 4RFSA 3Q72A 3GRUA 2VOJA 3S0JA 4IDEA 4DLAA 5ALUA 3SS9X 4Y2VA 3U5TA 1WVIA 5CT5A 2DBZA 4NLRA 3QMQA 1TMYA 4USJC 2FJPA 2QV0A 5C52B 2PRYA 4QJ4A 1RWQA 4I9GA 4IWXA 4U00A 1P7VA 1SH0A 1U0HB 3FMVA 1RJEA 4LFBF 2N1BA 1ADCA 3W2HA 3AQPA 1XTSA 3KJXA 2CKDA 3PF8A 4ZCMA 2HL6A 5AI9A 4J1TC 2KL8A 1E1MA 3OZEA 5AXCA 5DLFA 4NYZA 1U65A 4YMHA 3GG1A 2FTKE 2XUKA 1F1BB 1IHOA 3FYCA 5DT2A 5A0TA 3GH1A 3UGQA 2OV6A 3T7DA 3Q0IA 2VOOA 1KYVA 2DNYA 1GM5A 2VP2A 4IM7A 5TMPA 1VIDA 1TFWA 4I1YA 1PU2A 4UHHA 2XSZD 3PQ6A 3LHIA 3BIFA 2B1GA 1L7RA 5H9FJ 3PE3A 5A06A 2MOKA 4H6WA 4LDNA 3VISA 1YR7A 3GDOA 1V7PC 2R4QA 3C16C 1L5QA 5LQAA 1Z33A 4UEJA 1YBFA 1W0JD 1HC7A 1R4NA 4M55A 3HCFA 5FAXA 2VFVA 3C8HA 3KD2A 2DXEA 1PILA 2PGNA 1DXQA 3D0GE 1XZIA 2AW5A 3PM9A 5BWOA 2QYSA 1IDOA 1XO1A 4ZA2A 4CLPA 1JEQA 2Q8PA 4X62B 2PLAA 3NBMA 3OPKA 1XZQA 3EG9A 4D4IA 1FP7A 4HYKA 3SS7X 1V16A 1ZCBA 1N5TA 3K6RA 4PZAA 4OXKA 1U0BB 1FCJA 4F4FA 5CD4A 3ED1A 1EKRA 2FYTA 2AX0A 2FW6A 5B3AA 1RQXA 2GLTA 2ZSDA 2O59A 4J1NA 3HCBA 3NP5A 2A0FB 1M1UA 2OUGA 3I82A 5AHRA 2BX6A 4GPD1 4V39A 1VB3A 1VJGA 2F64A 1XTBA 1K27A 2QRUA 3B13B 3M9XA 2XCUA 2YC4C 4DEYA 1E0KA 4U7GA 3GZ4A 3WXBA 2AJ0A 1VQ8S 4YCBA 3ZKAA 5JFTA 3OT9A 1JP7A 1WCV1 4ZV9A 4OHRA 4YJDA 4HZGA 3CLSC 4K86A 4YIHA 1IQZA 2M88A 5HQ3A 1VGYA 1W4CA 2J07A 1BXZA 4LQDA 5KOHB 4B3RB 4XGRA 1ZCAA 4ZO9A 4R3UC 1LRJA 3CIMA 2QAGB 2PT7A 5LYYA 2PEHA 4ZCIA 2JX2A 3PW0A 3UPTA 4MUHA 1A88A 2PKQP 4KB7A 5CW2A 4L8VA 2XMSA 4C7OB 5GVQA 3QKUA 4KIUA 2I33A 4OYZA 4IQXA 3ESDA 1AQYA 3U44A 2BW2A 4DVGA 3DMGA 1O54A 4KR3A 1IKVA 5G4DA 4RF4A 4NZ6A 2HVHA 2REXB 1YL7A 1Q7BA 3KG4A 1P5RA 4GMDA 2H29A 4JI3B 5EEGA 4KOAA 3VV2B 2Y68A 1L4YA 3TA0A 2ZHBA 3PDIB 5D2CA 2DPHA 3WIDA 1H4TA 3CRNA 2V34A 4XD7D 4JLDA 5D4OA 1HQUB 3AWDA 5IYZF 3LCCA 3T7TA 1DRZA 2FZWA 3BOSA 1WHVA 4X6XA 3VAZA 4Z37A 1T36A 2CB0A 4R3NA 4TMTA 5G0RA 4UBMA 1O51A 1TVRA 5JTTA 4HH3C 3T41A 4EHAA 3T7RA 1RYZA 4I50A 3HDSA 3ISTA 3UT5A 3AVWA 1HKHA 3OSUA 3IALA 1X0VA 2CMFA 4BZQA 2IRXA 3E18A 2Q3JA 1Z12A 1VXOA 1M2VB 3LQYA 3TSOA 5TDHA 1R66A 1P44A 5LL6d 2IUTA 3O6QA 2R8BA 3TQIA 3BJMA 4QBFA 4Y00A 3DL4A 1UUFA 4PQRA 1QR6A 1P27B 4KKOB 2H9YA 1RD4A 5ICGA 4IO1A 1PHPA 3PW7A 1ID1A 5EFZA 1X7GA 1IBMF 3OT4A 4TQUS 2GVDC 3BORA 4NP6A 3G2NA 3TUZC 5CEEA 2VPPA 1NH7A 3MS7A 2ASVA 4K88A 4DY4A 3ZNJ1 1LLQA 2AJ8A 4NOHA 3T34A 1WXFA 1L8QA 3EXIB 2QU8A 4CLFA 2B0JA 3GGGA 3BMCB 1Y4ZA 5C8ZA 3WLFA 2ZUUA 3KZNA 1LBHA 5D77A 1Q91A 2BHRA 1MORA 3Q6NA 4AKHA 1NNI1 1RXEA 4RU2A 2WW8A 2DQYA 1TZBA 1G1AA 2LWIA 1GCGA 3NHBA 1RHMA 3PXXA 1JLQA 4Y2MA 3C3BA 1APBA 3ZD7A 2Z1DA 3T5KA 3MAJA 3HM2A 4UFPA 5A3QA 3NH9A 3JV7A 1EX9A 3GLIA 4F4YA 2QSJA 4HGNA 4XKJA 4FJ0A 1X4AA 3UUFA 3SJUA 2JZ5A 1JJCB 2FFQA 2Y1GA 2DXDA 3HSGA 3AOBA 4HACA 3CY6A 3BA6A 2ZE2A 1Y8AA 4QSHA 4O4GA 3M2UB 2FW1A 3D6HA 4K03A 4YNBA 1I2CA 2OPSA 4QWAA 1D8YA 1NVKA 3V7YA 5KMGA 1X1RA 3ZD9A 1TUVA 3DWEX 3FJYA 1VI2A 3IQIX 3AUUA 5F8IA 3MM9A 1N56A 3CMCO 2B20A 4U8VA 3VR4H 2PS9A 2JLCA 1GTZA 1R27B 4WNIA 4I6GA 1WABA 5D85A 4MJKA 5H1SV 2VDLB 2AT1A 4ZVTB 4HDMB 5J2QB 4V0KA 5LJLA 2C29D 1XBWA 3HHLB 1U5BB 4AYXA 1Q4RA 1I1QB 2IYQA 1LPMA 1SC6A 5IKMA 3ZTYA 3D4NA 1RT3A 1SOAA 4D44A 3USCS 3VPHA 4AN4A 4G1QA 2H9IA 5BSUA 2B25A 2J0WA 4K9OA 4K7QA 3NIWA 1KONA 2O57A 3C7KA 1MB4A 4UPVA 4EG0A 3HZZA 1HMYA 1U6KA 4B2LA 1Z7YA 1QRDA 3I9V6 1VRVA 3E5RA 4B3MJ 3POTA 1KZ7B 3ADPA 3SJ7A 2AQHA 4QJIA 5IXSA 2XE7A 3HUEA 1L5KA 2BSAA 2BGIA 3BFJA 1YHNA 4ARIA 2OFHX 1YL6A 3BSOA 5A3JA 1VHJA 3MEGA 3SJCA 4U9IS 2J7WA 4REQA 3QVVA 3T3FA 1DJOA 1NR7A 4W5RA 4OYYA 3PHCA 2QL9B 3QOYA 3JQBA 2CUNA 4EEYA 1E18A 5AW7A 3ETCA 2XUFA 4J03A 4HKTA 3JU3A 3KLFB 2QLFB 2W48A 2QVGA 3PFEA 4ZQBA 1N7HA 4AICA 3O8QB 3PO5A 3OQPA 3WLOA 4P3PA 4UTPA 5GIOE 4EIWA 5TSDA 4YFVA 4NBUA 4RELA 1GN8A 1M73E 1MENA 2WILA 1IOWA 1VPTA 1S3SA 2GEDA 5ALGA 3GP9A 5JSQA 2ANCA 1R3UA 2G08A 2W6ZA 5JE8A 1ZHFA 2QG9A 3GT0A 4Y18A 1BRTA 4KO3S 1KC1A 3RRJA 1TCVA 3I2HA 1RI7A 3RW6A 2E9ZA 3PNQA 3K71B 4PN7A 4H3KB 1KD1T 2XNSA 5DZ7A 4PYIA 1AQLA 3HFJA 2AX1A 5G41A 1ZXLA 3I55S 3UM9A 2IYOA 1XRNA 4Y67A 1F2UA 3GLKA 4P5PA 3W1EA 2OD7A 1X77A 2JHAA 1RTHA 1T9CA 2K7KA 2R7NA 4GIBA 1WZIA 2QX4A 1DWUA 5I4CA 1QUVA 3IAS9 5I3CA 1FTNA 2YRXA 7FD1A 2J33A 3BRWD 5DYIA 1SKRA 2HTFA 2WP8J 3ADBA 5F3ZA 1XAHA 2WFMA 2ECPA 3T5PA 3TE7A 1U1KA 4MGYR 1ZAKA 3OBIA 2PS1A 3ZE1B 4PZZA 4I99A 3KVNA 3K70C 2ZFUA 4AKTA 4ASUA 3E7PA 2HI0A 1OBVA 2HPVA 1H42A 3DHXA 1N75A 5E6RB 3OD1A 2CLSA 2OO7A 5JCXA 3J80Y 5A1TA 1H0HB 5ENZA 3PBKA 1EE2A 1F2HA 1XZCA 2QGFA 4LNUA 4FYWA 3V7WA 2YKOA 1SJQA 2YICA 3WHIA 1JT2A 4WD3A 1K47A 4TX1A 2QMEA 3KLNA 1ILWA 4RBUA 1SHZA 4LRWA 1AH2A 2JI9A 2MLYA 1LF5A 4EW6A 3ESQA 2HNBA 3SXUA 2YWRA 2JCYA 4CNZA 2CXSA 2MIIA 4WINA 2VYQA 3UANA 3K8YA 1XA4A 1VQOS 2I7VA 2CQ4A 2OIHA 3AONB 2XSJB 4K6FA 3NTRA 4RLHA 1QANA 4WP3A 1D1QA 2HFVA 4YPFA 3TVDA 1RAAA 1KA9H 4U2CA 1P5ZB 1GZUA 4EJ0A 4HQOA 2GK6A 1W6UA 4EBFA 4LVOP 1OY6A 2OD9A 5EXEA 3HY3A 2BEVB 5J59A 2O1EA 1RYSA 1NK5A 4FE4A 4ZWNA 2SHKA 2IAJA 2AZ4A 3BBLA 1QTMA 1IAQA 4QNNA 4WCVA 3FW1A 2I4NA 3K57A 2NXJA 1ZH6A 1OPXA 4ZIRB 5T7LB 3QKIA 3UV6A 2HBYA 1PCXA 2D74B 1KIMA 2CQHA 3L40A 1DJNA 2NTYC 5A8WA 3A8EA 2RC6A 4RL1A 4FXPA 3O21A 3ZZYA 1ZTTA 3TJZA 2C4VA 4P4NA 1IIBA 4LX0A 4M4SA 3D0OA 1KJJA 3KLPX 1QHFA 1GAQA 1ZK1A 1SIBE 3AFNA 1FLNA 1ZU5A 2F43A 2VD3A 3JQRA 2ZJFA 3HWWA 2QUAA 2A59A 3VTZA 4OP3A 2QTGA 4XDCA 5BVHA 3GE9A 4A73A 4RO0A 1SH7A 1U0EA 5E3CA 3GRRA 4NENB 5EXXA 3S99A 2PH1A 1YFKA 2HLUA 3F5FA 3HFRA 4DLSA 3KJNA 4NE9A 4A8PA 3AESA 1SC9A 2QM8A 4D81A 1H93A 3SMZA 1AB8A 1WA5A 5AW9A 1R8BA 3DM9B 4G3XA 3L7KA 5DT9A 5D5HA 4Z0TA 1NW9B 4MRRA 4Q1AA 2HZCA 3DM2B 2VHQA 2IGBA 3AR3A 4YROA 1RIFA 5IH3A 3D7MA 2B7BB 3GLIE 1JFTA 4Y65A 4BBZA 1JXOA 1JPNA 3C0KA 1NHGA 1VOTA 4MUYA 2CDRA 3HA7A 3ZZRA 1PO7A 4B3MB 1D4AA 2CFSA 1CQIB 4QDTA 4G6ZA 2C2KA 1DB3A 3DVAA 4WFKA 3BFKA 4E33A 4K2HA 4UM9B 4QWWA 2EFCB 1AS2A 1O96B 4ETMA 1OJ7A 3WNQA 1FTQA 5E6UB 5LBIA 5AVZA 2O1XA 1AGYA 2X13A 1YZVA 2PGCA 3ZZTA 2ZBIA 1Z8NA 5AKYA 1PNVA 1MLAA 3MJDA 5SICE 4TTVA 1UP6A 2ZJOA 3QOXA 4XARA 3AVOA 4ZV4A 1MV8A 2W58A 5LYJB 3V55A 4HHUA 1NN1A 1PJBA 4HEA6 3BN4A 1BROA 2E4VA 4B5KA 3LDUA 4EEXA 3O8BA 2EQBA 5KYVA 1WBJB 3DDOA 1IM8A 1ULRA 3A0UA 4UHCA 5TPZA 4JV0A 1V7CA 5EXDA 5I7AA 5K1ZA 4B3IA 3VDQA 2ZZMA 1F3VA 1B16A 1PE0A 4U2FA 1C7IA 4RVHA 3GBSA 3W9IA 2FG5A 3K31A 4D5GA 3H42B 4L85A 4GVBB 2OSQA 2X4LA 4JKIA 4WLUA 5CR9A 2JGAA 2HQ3A 4C14A 4MMOA 5I3ZA 4J0GA 3IP1A 2CFCA 3VZSA 5HMLA 2TMGA 4JP3A 1RU2A 3G79A 5L8RC 1C0EA 4F67A 3SR4A 1GRRA 3EPPA 2IEIA 5J2NA 2OCGA 3H16A 3MVEA 5HSGA 3ELWA 2IF0A 3T3NA 4RKFA 3TW6A 2AG5A 3UK2A 5D6NA 2ZBVA 3K2BA 2P6MA 3BRQA 2JFKA 3CRMA 1T9UA 4J2TA 3PCOB 3K6SA 1GYQA 3R2CJ 4Y2JA 4U9HS 1FKAF 1AKWA 4EGCB 1UBCA 4MPRA 4NEHB 1U0SY 1P74A 5ALJA 1D1SA 2WHEA 2P2NA 3X1LB 5SZJA 3R0VA 3EX7C 3T35A 2ZI9A 4PCVA 1XNRF 5BN5A 4O63O 2HO5A 3MTIA 3CMMA 2XECA 2ZYRA 4CDIA 4WOCA 1NI5A 3KRTA 3ROZA 1YKFA 2EXXA 4JP2A 2O3SA 1ISIA 3U09A 4X1IA 1FQOA 5LOQA 1XZEA 5K0FA 2BDUA 4HNAB 4XGNA 5EKSA 2VC1A 4U8YA 4RMIA 3QTLA 1E6LA 4R68A 3JAWA 1U2TA 1I2AA 1OZ0A 3G9TA 4N6NA 2V7BA 2XDQA 1LKZA 5K6RA 1MU0A 3N2GB 1XPOA 2ZVSA 2XLIA 2WD9A 1JJVA 4Q18A 5F35A 3IH5A 5KEIA 3IIIA 4W5WA 1FSSA 1NRKA 4KT0C 1VHTA 3EDQA 3Q8XB 1JR6A 3IAXA 4LSMA 2GFHA 1H2XA 1XRMA 1VBNA 3TRIA 4QJVA 1H85A 1D9FA 3OFSA 4KR0B 1OCEA 3MRVA 4ND5A 3LANA 1HURA 3BSYA 3ZXUB 1G4HA 4UC0A 4O3SA 1QHNA 1X8JA 4TL7A 3B53X 5I6DA 3ONQA 3P3DA 2J9RA 2J6UA 3S2FA 4EZ6A 1ZH4A 4M1OA 2RH5A 3KSRA 1T9AA 2IC5A 2OWEA 2O8FB 4KAXA 2DHAA 4KJIA 1I7LA 1FDIA 5HLFA 4MVJM 4BQRA 3MWJA 3FR7A 1VCTA 2EVWX 1FL9A 1TI7A 2I66A 2W43A 1NKCA 1Z8FA 4ZO6A 1ZW6A 2JC1A 1L4KA 3OFVA 5DGHA 4TTAA 4BNWA 1LCIA 3RGIA 3W2TA 2AH5A 3WTCA 3RAQA 4RCVA 2VBIA 4DGQA 5IU6A 2NU9B 1JA9A 4QXMA 4E5SA 1FVSA 1QYXA 1U5CA 3PKZA 2ID8A 5CURA 4GX5A 1TTHA 5CVDA 3OXGA 4QG3A 1A5BB 2NXWA 1T10A 4FUQA 3EIOA 4IIJF 1P9WA 1OLSB 3GMIA 2QX9A 2VRWA 4HB2A 3O0DA 2CDAA 4D1YA 1N1EA 2BANB 4FTWA 4J3JA 1L4HA 2HU2A 4QDJA 3L41A 1W88B 2PO4A 4R2WA 3R4CA 3Q12A 2ZIXA 3BVPA 3Q9NA 5LQDA 3NRJA 1A69A 1CDEA 1QG2A 1ML3A 2PD1A 2Z8ZA 3DC2A 3D8SA 1N2CB 4O5OA 3IAUA 3SCZA 4KQMA 4N0QA 3VPFA 3BE6A 1K7EB 4JUZA 5EZQA 5HF5A 3GAMA 3VXKA 3GL9A 4B84A 2GK4A 1TR0A 2FRVA 5F8LA 4TYMA 2IYIA 3VC1A 3QIPA 2C4HA 3N2LA 1G8AA 1T05B 4H08A 3V46A 3KKOA 3TAMA 3PU6A 3R4VA 4IJWA 3BRCA 2IHZA 2GMJA 4EKIA 1KDTA 4Z1MD 3NWOA 3IEPA 1Z4UA 2VPXB 2Y1RI 4EKDA 1TVEA 5TT1A 1IBKJ 4ZO7A 1UTAA 5JAPA 2NSCA 1LQUA 4Z1OA 4CEHA 2JFQA 2QP9X 2ZWPA 3CCJS 3U19A 1P9QC 4Z7QB 3NGTA 1WORA 1R00A 4YRQA 3HGQA 1N5YA 3ZCRA 4I56A 2PMBA 1JS1X 3X1ZA 5HP1A 3ICLA 3ZZNA 4IRDA 4HH4A 2ZH1A 1ZUWA 1OI3A 3MSXA 3EFOB 5EQJB 4YK7A 2G9NA 4A1OA 1CJKA 4MQ5A 2OJ3A 3RVKA 1TKCA 1LRKA 3LF0A 1S8AA 4NK5A 5T6BA 3NGMA 2B5OA 1HMVA 2Z4PA 2JEJA 1IN6A 1PJ6A 4LHVA 2W6MA 4PLFA 5HKOA 1CJUB 2C2BA 1HX7A 3X3HA 4EJMA 5JZMA 2VDKB 2WAAA 3LUDA 1UANA 2I2FA 1I3MA 2XB6A 3C6KA 2ZTUA 5KG1A 5KT2A 3WNCA 3B1VA 2PJZA 1E32A 1LWCB 3W5JA 1B14A 2G6BA 1T8YA 4TYBA 4KDFA 4GOJA 3LM8A 4K2AA 2F8EX 1N2SA 1G59A 1NHWA 4Q19A 1BY9A 2AQ4A 1XZJA 5F51A 4UDXX 1SHLA 4TV8A 2FDXA 4JJAA 4C97A 2HQSA 2C3OA 1JXVA 3I8XA 4D3YA 4IF6A 1K97A 3R1LA 4YPVA 3PYLA 3EA0A 4LDRA 1Q0HA 4HATA 4FZ3A 2WF7A 3VU3A 2IJFA 5I3PA 1PG2A 2G1UA 3IVAA 1V1RA 1GPMA 4OCZA 1S9EB 4O2BA 1X9SA 4GRAA 3TZEA 3FAKA 1RC8A 1EUZA 5HPYB 2NMVA 2FJAB 3T4XA 4Z9BA 1SIWA 3K0AB 4BNGA 1EVYA 3CJ4A 3EUEA 1UBFA 3U16A 3F5DA 4QXPA 3TMKA 2IEYA 2X8JB 1FFXA 3M6UA 2WC1A 4R98A 3FLEA 3ZGNA 2PMWB 3PPYA 5EQTA 3VYVA 1V2HE 4PZEA 3D28A 1VKRA 4DUGA 1MEJA 3NCHA 5EIBD 4ETNA 4WDQA 3UATA 5JDCA 4P71A 1WNEA 4WXOA 3JQDA 1X1AA 1KZHA 1RADB 2H65A 3IE2A 1QTQA 1QWOA 3AEYA 1NVDA 3A4MA 4C4SA 4F7WA 2B98A 3JALB 3AF0A 3X1MA 4ACBA 2JFZA 2EL7A 4G8CA 3N58A 2Q1WA 3I6ZA 4UPEA 4YJ3B 3TVKA 2HA6A 1DQ8A 1Z29A 2C1EA 5IKOA 4PZCA 2X0KA 1JBEA 1CLEA 3A4VA 3SQOA 3O5TB 2G2YA 4HDAA 1XLTA 4BGUA 4POOA 1UCFA 5KS2A 1KC3A 2BFBB 3QVGB 2WWXA 1YK1A 4GRIA 3GJQB 3MWDA 3P45A 2OHFA 3GLGB 1DCFA 3GJTA 4TY8B 4UM7A 4EHNA 1MW7A 2AW0A 1Q6YA 3HN6A 5M2QA 3GPLA 3LVQE 1MW8X 5C8YB 1ZYQA 1F0NA 3CDAA 4TKZA 2WAOA 3KLIA 5IDQA 1WEYA 1E8DA 3T38A 5HDBB 1GQ2A 1NJ2A 2WQ7A 1E5QA 3TQRA 1QB7A 4AY5A 3OWHA 4O3OA 4HG2A 1DTTA 4FS3A 3LPEA 3ZY5A 4ZAGA 4C0XA 3F74A 2VTEA 3BDIA 5JI3E 4OI4A 4IVNA 4KYUA 2WUDA 4IJQA 4YYEA 5K0TA 3O92A 4REMA 1PS8A 1G60A 5KT4A 1OXSC 3EVZA 3M2RA 3BYRA 4LDZA 4FHCA 1QUPA 1KK3A 2J0VA 1PFQA 3CYFA 2YQ0A 3Q8PB 4QXAA 1Y9DA 3VH2A 3ZK8A 5GJCA 1W26A 2V5HG 4FKXA 4D0RA 4IS3A 2ZJ4A 4LRCA 5FFFA 1N34F 3WGNA 4XK8C 1MIOB 3SNHA 1R0SA 3RG6A 1THTA 3AHPA 3IXQA 2YWKA 2V7PA 4MK9A 4H7FA 5KFEA 3PX0A 2CG8A 2JJ1A 3S1LA 5BYQA 3W7BA 5C42A 4PPYA 5C25A 1W29A 1QKKA 3KEGA 4LEIA 4Q3KA 4DPTA 3L02A 4MWBA 1JHOA 1OAOC 5ICEA 3RREA 1MB9A 1ZGBA 3L9WA 1F1JA 1E2PA 4LYFA 1T6BY 4Y2IA 4FD2A 3JYQA 2DMRA 4FFBA 1WQ1R 4BZZA 1XP5A 4TTRA 1QP0A 5EP2A 4TTIA 2DQKA 3NJ8A 4I1RA 1PR2A 5GGYA 3CCCA 1IBKB 4QOJA 3E9YA 3M8PB 1Y1PA 2RAFA 4OK5A 4YY3F 1Y4DE 5ELXA 1SCJB 1R2QA 5DI3B 3H3JA 4U5XA 3QVJA 1JKHA 1HIYA 1TKDA 4PGAA 3SXJA 5EWLA 5K99A 4Q2LA 2BR5A 1C1YA 3Q7EA 1VQ5S 4CLLA 2QL6A 4YVFA 5A8KB 1XMIA 1WETA 1E6CA 1IN8A 5LSRA 3P5SA 1Q3TA 2CB9A 2DTXA 2Y1JA 2JAXA 1LVUA 3F6EX 4V1CA 4BLVA 4IKEA 1IKYB 3PFHA 4TRMA 1WMFA 2VJYA 3TQTA 4EZEA 3DBHB 5JXIA 2D59A 2ZRCA 3IEUA 1BO6A 1COWA 2FU5C 2ZRPA 1ODJA 5K45A 2MKYA 5LMNF 3FTPA 1LWXA 3RAMA 4KYVA 3ZKWB 4ZKDA 1KY3A 1YRLA 2BGJA 3KD3A 4X7PA 3UXYA 3V6MA 4CLWA 5C2GA 5DI9A 1S5PA 4ENUA 1X5OA 1JB9A 5F2EA 5F98A 4RQUA 4MAAA 2G5GX 2FZVA 2H1WA 2BOVA 9GPBA 3HHKA 1AK1A 4IIUA 1WXXA 3CC4S 4D3DA 5BWMA 4HSGA 1Q20A 3I4CA 1AZSC 2HHAA 2YJ3A 2BJVA 4E5VA 4B7UA 1KS2A 2A86A 3OL8A 4BFYA 3OIGA 2NPOA 2XE8A 4Y6IA 4OQ4A 3E4DA 3T5MA 1OTXA 3FOBA 4RVFA 3ZCXA 2AIRB 2DAPA 1KHHA 2J6HA 1O94C 1Z62A 1SUBA 1AX9A 5E2BA 1RP1A 2HIHA 1JU9A 2XHCA 4UVDA 3QUBA 4QIVA 1P1LA 1GPAA 4IIHA 4RK7A 4KTTE 3TD2A 2KM1A 2EIXA 1YKWA 2DHSA 1V7QA 1VSUA 1C3LA 3WXMA 2HZ7A 1DWQA 1J8YF 4YRKA 4XUDA 5PGMA 4HUTA 5BYSA 1JHAA 3BTSA 4AXXA 3BHNA 4ZOLF 1KPIA 4WFZA 3LHKA 4KH0A 4MW9A 2PDAA 3CNNA 2GHPA 4B44A 1N3YA 4KP7A 1IB0A 4CQLA 1RW4A 4RLSA 4ID9A 1KI6B 5SV2A 3G59A 1MRZA 1R8YA 2C4TA 2NP7A 5HKAA 2GAJA 5J9FA 1N5VA 1XC7A 7ABPA 2V8BA 3MMCA 3WQRA 2W70A 3UKDA 4PYDA 1EFVB 3HACA 1YRAA 5IWAJ 3DDHA 2PI4A 1XIVA 2ZQYA 1KEEB 5K8NA 2GEUA 3NTXA 4CDRA 2VAXA 2ATCB 4PG8A 4DDFA 1L5ZA 3WJ2A 2YX7A 2FMFA 4ZTZB 2AWZA 4PO1A 5A4FS 4BRWA 4YEDA 4FX5A 2CZQA 3UUEA 1GNTA 3Q7PA 1BHNA 1DAIA 4DMRA 3CT9A 4QPTA 4B02A 3T9EA 5EI5A 5IBQA 3AA8A 1PFGA 4UEWA 1S0VA 1CG6A 1DO2A 3PC3A 2V7QA 3VHXA 5ALHA 4Q7QA 3NWJA 3PC2A 1SFRA 3SK0A 3ZVLA 1LNZA 1KO1A 1UDAA 3IIJA 1E1YA 2CZ4A 3NI2A 3WRWA 4PO8A 3AVXA 2GJAA 2UUCJ 2YNIB 2IXFA 3DG9A 1RKJA 2HWUA 1C1XB 3AHFA 3SX4A 2WOOA 3OZGA 4LBWA 1JT9A 1SBRA 4D0LB 2JEYA 3QH4A 5KWIA 1VE1A 2FN8A 3FSEA 3KXIA 3CJ5A 2PGAA 2Q2QA 4BQOA 1G8GA 5HQ8A 2R85A 4X64B 3MM7A 3W5DA 3THWB 2GAOA 4S1PA 1T13A 4BQIA 2D1RA 3RB3A 1QHYA 2GCFA 1G55A 4IG0B 1X9WA 2W2OA 2ZS8A 1BD3A 3DH0A 1II0A 4BLRA 5DNVA 4RS4A 1HYEA 4I55A 5AP9A 3I0SB 4WTOA 1LC3A 3P9KA 1Z6AA 3K1AB 1W8DA 5DGDA 1G4CA 2I87A 3H2KA 3U7FB 1KQOA 3H8JA 1CUFA 6REQA 3GA0A 1HHTP 3MGBA 4X5OA 1Z16A 5EYPB 3X3UA 5I45A 4YTEA 3NB0A 4YP9A 3I0NA 1OFTA 3OIDA 5H9WA 3ZUPA 4PZUA 4BVLA 5BSEA 4WE3A 3DZDA 4ND7A 2L08A 1G20B 3PRYA 1FTSA 1UVMA 2PXCA 2BUBA 3B89A 2WK4A 1PL6A 4FILA 2GILA 4YCAA 1DQ9A 3H20A 2J48A 2X76A 3H5TA 1A2BA 3PXGA 2P2DA 4B0PA 4KHMA 2HSEA 4N8NA 1U3TA 2VPIA 3GMSA 3AKZA 3ICWA 4ER0A 3AL3A 4XWTA 3OTOJ 4GBMA 4YI5A 3LUHA 4DX7A 2NAPA 1UMBA 3DE6X 1SMKA 3LVBA 5FTNA 3M8QB 1ENPA 4NAHA 1GPNA 3UB4A 4C6SA 4B83A 3UJDA 1I4OA 2FETA 5ES3A 3A6PC 3GLSA 3AR5A 2B8TA 1R7RA 4TN5A 2NXNA 1XDWA 4DW8A 2YJ5A 5GAEI 1XTRA 4EI7A 1CNEA 1PK9A 1WZNA 3VFDA 4MH8A 2APJA 4R4JA 3A3PA 4LF4J 1Q1EA 4QFDA 1XVAA 1G21B 2MEWA 3MELA 5HBGA 2WZQA 3VYUB 2CJWA 4BB0A 1CDZA 2PNFA 3I09A 3G8SA 2FG7C 3Q2OA 3IRVA 1JR2A 4PNPA 4D3XA 1ZBTA 1NA5A 1IY2A 4QCLA 3FK4A 4AXBA 3TPZA 4PG4A 1NVGA 1VCMA 1OPIA 3D5EA 2R47A 1W85A 2FSHA 2X6RA 1HNWF 1T1SA 2PZJA 3P71T 3T1HB 2W4MA 1H4QA 1SUQA 1CJTC 3QBEA 4KPFC 2C1XA 5HVGA 3JWJA 3REFA 4IIGA 3HUFA 4EATA 4PM4A 3SIXA 3JTMA 3VDRA 1W5BA 2ZC4A 2G88A 1DWPA 4DUTA 2XKJE 3AU8A 2UXDF 1E0AA 3HQ4O 4G67A 1X7WB 2JGKA 2GZ1A 3P20A 3RIGA 3JQGB 1U2QA 3MLBA 1F8FA 4INOA 2FUG6 3A3YA 4AYTA 2QD5A 5J40A 4ILRA 1ZX1A 5FAKA 3AR6A 2MMYA 3SNKA 1MNAA 4BASA 3WGJA 2YJNA 4B4VA 4OA8A 4RZRA 3D9QX 1G5HA 1WG5A 1N33F 1KU6A 2VSQA 4AKEA 1SVSA 4D57A 1XXLA 3KK1A 1UM9B 2QN3A 4F7DA 2YKPA 1BGVA 2QRVB 2X8BA 3Q2IA 3BGFA 1QU2A 2YHBA 1CS0B 2KJWA 5B0EA 5JZVA 1RDFA 5BPHA 5MFZA 1HBMB 1M6NA 4G07A 2A9PA 2PFFB 1PQPA 2VJMA 4RESA 3OQHA 1FYWA 1KR5A 3K20A 1U2ZA 3SQGB 4QREA 4KE5A 3AJ1A 2HBRA 3F7NA 1N6QB 2M8HA 2W0MA 1KSJA 4RA6B 4V0OA 1XCJA 2CUKA 4QLBA 1V1MA 1RABB 2ZYDA 4CM3A 1YONA 3V4RA 5CDTA 4RSGA 2QTCA 2LCIA 1GGKA 3GJXC 4I81A 3G88A 4PIPA 1BCRA 3TBHA 3OLQA 2BW0A 4I9NA 3M33A 5EPUA 1VZ2A 5G1PA 3TOQA 2R7SA 3SMQA 3GD7A 3KZXA 3V00A 3ONNA 3UQZA 2VYCA 5JPDA 5FNZA 2QRGA 4PYKA 3E81A 4GZ5A 5CCEA 1P2DA 3QSGA 2UUCB 2QN1A 1XN1A 4HDCA 3HHLD 4NKRA 3WX8A 4IR1A 2YXDA 3Q7RA 3CCFA 4G5XA 1FRXA 3RC8A 1Y7PA 4C9BA 5JXSA 2BGRA 1QGAA 3CD0A 4PQUA 3RS0A 1TRHA 2G4CA 3CPJB 1Y0HA 1QC5A 5EJ4A 3VR4D 4LIPD 1UC8A 3FR8A 4OTZA 4NK4A 4OQDA 1TT5B 2UVPA 2VJBA 4GRDA 2XTAA 3HA3A 2BE7D 1D2HA 4DQIA 3A3KA 1GA4A 3A2MA 1RMYA 1NU4A 3I42A 2L19A 3B9RA 5HR5A 3IB6A 1NK8A 5KYUA 4DDWA 5JANA 4DIOA 5DX8A 4WCDA 5D3KA 1FYEA 1D7AA 4EY5A 2VDRB 4CO3A 1E2BA 3EZXA 1LGYA 3UN5A 2FZ5A 2WB2A 3W61A 2MSLA 4LFCJ 4DLRA 4ZKEA 4DV3F 3P8BB 3MUOA 2R2UA 4WT7A 4AT1A 5F8HA 2J7KA 2P8JA 1JDBC 3FUCA 4FDUA 1A50B 3KL4A 4K4YA 3VI3B 2JDJA 3NBFA 2C8JA 1UINA 5EWFA 3N6MA 3UWOA 5K8OA 4U2DA 2B2CA 1CJVA 1M1GA 3HJCA 4WK3A 3OTOB 4QG7A 2G28A 2UU9F 1U02A 4FJ1A 4KODA 4BUZA 4OLFA 2A1TR 3VR5H 4FHZA 3TECE 2CJ9A 2YZGA 4D0SA 4FXOA 4M60A 4PZVA 4DQKA 1LEHA 3LT4A 3GG9A 3D54D 1KK0A 5CD9A 3HYSA 4JJZA 3OZCA 1C81A 4O4HF 3AQIA 3AEUA 4IQGA 3DVLA 4FMBB 1S3GA 4HMOA 3E23A 1KJWA 2C5BA 1MBZA 4F4IA 2XKKA 3VNSA 4PKDB 3CLRD 3OTGA 2FX5A 2X8AA 2XUHA 2UYQA 4OQQA 2H51A 1EK2A 4KSBA 4TQSA 4H4EA 2VPZA 2EC5A 5AJXA 1QORA 3ZWOA 3CZCA 4CM2A 1LVHA 3IVXA 3FBBA 2EI5A 2QRJA 2VF3A 1JTVA 4CMCA 1HL6A 4MYSA 4UNQA 1EB9A 3VX3A 4LF9F 5L4LA 2ZD1B 2IZZA 3EICA 3KXDA 4DX8H 2VJOA 4AIIA 2QTRA 3NVKI 3V1LA 1FMTA 5A5EA 4U6QA 1XTKA 2O2GA 2XS2A 2F65A 4JCCA 4DUZJ 5D1HA 4XEHA 5HVNA 4A8MP 2QRLA 1L5WA 1R0XA 4FIZA 3B9QA 2EKYA 4MAKA 2ODNA 1JDSA 4CH0S 5A2QU 3FDSA 3BILA 3BDEA 3AVPA 3AOAA 3HDQA 1WM1A 3N8GA 4X4OA 2QDXA 2OAUA 3AT1A 3KQUA 5BQFA 2A5GA 3EGZA 5ECYA 4B6QA 4O1IA 2IHBA 1JDNA 2D1YA 4QRIA 4A5OA 1S5ZA 1WQ3A 1A95A 3T1YF 4F45A 4P7VA 2X15A 1YB6A 3NDJA 2GAAA 3C6ZA 3R7WB 4F11A 4NOLA 1XUOA 2H1IA 4CV0A 3E5MA 1YR8A 1SA0B 4L5BA 3TKLA 1XR6A 3OZWA 3C6XA 4F71A 1T03B 2Q9CA 4W4TA 4FVTA 4Q9IA 3O8RA 1AD2A 4CT0A 2N7CA 3LL7A 1HARA 4HWTA 3KETA 3T5DA 4B3OA 1GRNA 4OHXA 4OKIA 1DL5A 4FYIA 1KEKA 1U2DA 2A57A 1SXHA 2Z6UA 4CM5A 4WLVA 2AG6A 4K4VA 3PVSA 2BRKA 3E5NA 1GTVA 1NF2A 4MI3A 3G2KA 1FVQA 1WTAA 3DLCA 4PLHA 2C98A 1D2CA 5K0ZA 1JLFB 4E1BA 4R9VA 2L0XA 4R8KA 2AI3A 1U0HC 3D6MA 1XGKA 2GEFA 2ORYA 3HWSA 2NYIA 3WLEA 2MZJA 2HG4A 4OQEA 1N6RA 3VH3A 1I6WA 3RTBA 3PQ8A 3PKJA 2BFDA 1SU8A 3VVTA 1OZHA 2ZE6A 3MM6A 3M7IA 1K0VA 1VC2A 2YXBA 3PK0A 1R4MA 1Y8QB 2Q6TA 2EBHX 1RHQA 4GWKA 5L7TA 4RY9A 1Y1KE 1P31A 2O0MA 4DQLA 4IHJB 3A6ZA 1Y9AA 3Q15C 4FHDA 3BDPA 4YGYA 3OR1A 2BEFA 3P0FA 1RQGA 4RC9A 2QTLA 4AO8A 4MR7A 2GN9A 5IYZA 3RUBL 3L7LA 1VMIA 3HCWA 3NETA 5CDSA 1NNEA 3AF3A 4DWOA 2FF5A 1PLLA 2YXEA 3KE9A 4H15A 4XPIA 3H98A 4YO8A 3R7SB 5TMBA 3AVVA 5ANRB 2NO5A 1N3BA 4MLZA 3WX0A 5DO2A 5JXWA 1J5OA 5JAUA 4Y2QA 2NTNA 4M22A 3WAKA 4UM9D 3GT4A 2HYDA 4QEKA 2O4CA 1NW3A 3BO4A 1NBHA 2XMJA 1OYEA 3O3MB 3RUHA 6FDRA 3DRPA 2VPWA 3V80A 3KAKA 4ON9A 3ORHA 1ZNZA 3HB0A 4CNQA 1VJTA 2XCLA 4ZAWA 4GSYA 3MPDA 3RQSA 1YV9A 2VP3A 1NDHA 1KSGA 1SK9A 1ZVQA 3S8YA 4Q9JA 1EVLA 3V2UA 3QW2A 1F0XA 3NAZA 4FN4A 1JJ7A 2BDPA 5K6TA 2DSTA 2WYWA 3F7TA 2RCYA 2CUTA 1L9KA 4QELA 3C46A 2ZSJA 3FRIA 2CXPA 4W92B 1P2GA 3QYPA 1LDNA 1OYYA 1CY8A 3M8RA 2JKVA 1Z1ZA 3A1VA 2PKYX 4I5IA 4QAJA 1HPLA 1C9YA 4GL2A 1RWVB 1K5DA 2ZI6A 1N8NA 3F5MA 4O6VA 3VVUA 3NUZA 4PTZA 2BH2A 1PQ4A 8GPBA 4DR3J 4RTOA 1FJGB 4JYCA 4YBRA 4DDTA 4OMUA 4BE4A 3ILXA 5M5BA 2NPIA 4XGKA 2P40A 3MAQA 3PZRA 2HWWA 3FDFA 2F55A 1U3DA 1PWHA 4B6SA 1XRPA 3E9QA 3JVVA 5FLXA 2W7PA 2V98A 3EE3A 4G5GA 3D7NA 3KALA 1IK4A 5CDGA 4URHA 4BYMA 2WJVA 2HQFA 1OYOA 3STVA 4C7JA 3AP2A 4YUZA 3LKVA 1IFXA 4RNCA 5T14A 5D7NA 4WJLA 3D3WB 1PAUA 1SPXA 4B87A 4XTCS 1RWOA 1G3UA 1K6JA 2CKMA 2HAEA 5AR1A 3IWLA 3DE2X 5DPMA 3H1AA 4PXEA 2BMFA 4TRNA 2BI4A 3S27A 4BMXA 1SI9A 3OVSA 3OQIB 2DPLA 3DXXA 3GJ4A 5I48A 5EVJA 4NH4A 5SY6A 1YKGA 3EPJA 1RAFA 4HNTA 4JOCA 4D9NA 2HIAA 1AQJA 2BBSA 3C39A 3R0XA 3V7NA 1L7MA 5BXQC 1D0SA 2OFWA 1KTIA 5AW8A 5DTRA 4Q4HA 1QG0A 1DJ0A 2DKNA 2XMWA 1CZKA 1YE3A 1PSZA 4QRDA 3OJFA 3LCRA 3MUNA 2ZW9A 1DT5A 1FDVA 2XGSA 3L1HA 1R6DA 1ULSA 3RC2A 1I0LA 3COSA 2VEOA 1X5SA 3AJ2A 2CLHB 2G0NA 1EDDA 2ZJBA 2VOEA 3M6VA 2W4PA 1SH2A 1WSAA 1T9TA 3N86A 4H7JA 3UUWA 1PJ4A 3KLEB 1YMQA 2X3UA 4IQFA 3JVDA 1Q2UA 4CYMA 1A96A 1ST3A 3C70A 2I2CA 3BM5A 3TPCA 3L04A 2DYAA 4PE5B 3DB2A 1EBUA 3BWDD 3VV3A 2HBQB 2PLFA 4J37A 4MMZB 3TZZA 1NJ6A 3TL3A 4ZQHA 4P5DA 1C4KA 2C28A 2PSDA 2CDQA 1LA2A 5AJVB 3D8BA 3GUUA 1Q1AA 2MKKA 3EGWA 2BKOA 3IQFA 2KW5A 4BJ3A 2X1HA 5CA1B 5KC8A 3OH8A 1XKLA 1DJMA 3K0CA 4L74A 1NVTA 2P0EA 3F4BA 1PVVA 1I32A 1JIXA 2XQFA 1B7YB 1YI2S 1QPZA 2A92A 4KZPA 1MJGA 4OREX 2A67A 3NHAA 1QTNB 4Z2AA 1OU0A 2G9ZA 2NSBA 4F4ZA 1IWPB 1E5VA 5TPWB 2RAQA 4UUPA 2Z3ZA 4EUHA 1Z74A 1XCLA 5E95A 2HCRA 2MTBA 2QA2A 3KSZO 3CCMS 1HWJA 3MURP 1YOBA 3LC0A 3SZMA 1RACA 1WVMA 2R8PA 3MK31 1H0KA 1P81A 1UQTA 3OLZA 3V6LA 3ITHB 2J9XB 3IR5B 3DEZA 3S3TA 4RKRA 1YMVA 2D2EA 3RB0A 3SVTA 2CG4A 2EDAA 2B34A 4Q3AA 1UFQA 3MRSA 2ZXUA 4NJOA 2DBQA 2R68A 4L4SA 4PVCA 4MIBA 4NJEA 1XEWY 1QOQB 2C4UA 5JVDB 1GGJA 3FDIA 4YJ2F 4V0QA 2WB4A 2O0HA 1AT1B 3AAWB 3M8YA 1DAKA 4HYTA 2C2NA 3N2ZB 5REQB 5DYYA 3BJYA 1G42A 4B4KA 1BVRA 1RWKA 1HYGA 1U28A 2OPPB 1F3FA 4QBTA 4WGFA 4MWGA 3C15A 3AIOA 4OHKA 5EAIA 3IRXA 1VG8A 3QKWA 3DRSA 1QQ6A 3TXYA 1QZXA 4XJSA 4N0DA 4AZ3B 3HN7A 4CDMA 4IRKA 4L0MA 1XROA 3KTAA 3IULA 4C04A 1CFZA 4NNOA 1ECJA 1WS6A 3CN7A 4OD0A 2HZVA 1J2VA 3QWPA 4MQFA 4AVYA 1QRRA 4A8KA 4E6EA 1XNJA 4E3WA 4CG1A 4YV2A 1VRUA 1T9GS 3MHYA 4IMRA 4JXKA 1H6KX 1BKYA 3EVCA 4FXWA 3QJPA 3U1NA 2IH2A 1GLVA 2GF0A 3BTUA 4LWQA 4OLAA 3FZ2A 2LVWA 3SR3A 2XSFA 3MGAA 1OFGA 5IW8A 3VOBA 4XSVA 1UCNA 3NVDA 4FR2A 3CH5A 3QWHA 2LA4A 4F8RA 3R8YA 8LDHA 4FONA 4AX8A 2I6GA 1WOYA 1HBUB 4OI6A 1WBBA 1USIA 2PA0A 4LF8J 4I9FA 2J3KA 4H1WA 1DQAA 3ZD8A 1DQNA 4LNHA 1I6KA 2BZ1A 1NHKL 2IOFK 4DAEA 2I9KA 4BTLA 3ANNA 3OM9A 2O9JA 4NQZA 3BMNB 2TECE 1UMCA 2AHRA 3HB1A 2XGOA 5A9SA 5C9ZA 3I9V1 5G40A 4M21A 4YT2A 4TSKA 3HA2A 3ESAA 1XMOJ 1U81A 2GH1A 3HP1A 4XO0A 3AFOA 3AEXA 2J4FA 2A7QA 1U9YA 4WVFA 3N2KA 3BHMA 2OG2A 4M0FA 5CLQA 3JXEA 1N6HA 2IVYA 2WJ6A 3SC2B 3H2ZA 1UKYA 3DYAA 4ABYA 3CLRC 1E6YA 2AZ1A 2JFFA 3U4GA 2B1JA 4PEVA 1MX3A 5GAEU 4HRAA 2HPZA 1N8KA 2AYXA 1LWEB 2JAWA 3TRKA 2B0GA 621PA 1TNDA 1R6YA 2B7CB 4BRSA 4DLBA 2HHHF 2YNFB 2RAUA 4BS2A 4LSZB 3AJEA 1RTJA 1SKWA 4J75A 5CB4B 4FKYA 4CO5A 2FZGA 4WFJA 3CT6A 2KJVA 4JI4J 1H6DA 2VC0A 1ZEJA 2M9KA 3FIJA 4TV9F 4H1VA 1M7GA 2ZRGA 2FV8A 3E22A 3CB4A 4WSOA 2WE7A 1ULHA 2IE8A 2KZMA 4F86A 1GX6A 2B9VA 1AQ6A 1NRIA 3LLCA 2QA1A 2A14A 3HL0A 3PNKA 1JHUA 5KFAA 2XZWA 4LXGA 1KDZA 3IODA 3WWPA 4P7TA 4DSOA 2R62A 5GMOA 2ROEA 4NZPA 2IE0A 2QN6A 1C5KA 5EMNA 3GEBA 4YUXA 2CDCA 4NXMF 3E48A 2LUOA 4GI2A 2MZ1A 1GPJA 4HAYA 4PFQA 3KDNA 5K3FB 3UMGA 3NBPA 3OZTA 1KKMA 1XDBA 5CT4A 2XI3A 3LVFO 1E5DA 3R5AA 3Q89A 3ZW8A 2RS2A 1ZDMA 1KQGB 2VYVD 2DFDA 1DTWB 1QH8A 4TXMA 2PUAA 1SUCA 3NM5A 2P9CA 2J7PD 1JEDA 2NU6A 5GMEA 1SUAA 4QXRA 5CEFA 3M3DA 5LIRA 4TT3A 4ID5B 4Z0NA 3HI4A 4I19A 4P58A 1RWNB 4CQMB 1XMQF 3HXLA 4L50A 3LZ6A 1J2EA 1B8NA 1U1NA 2FUEA 2A1BA 2WK1A 3M83A 1YB7A 3OJOA 3T6JA 3LHFA 5JNRA 1A97A 1J06A 4BY9E 4CM7A 5BN3B 1GQOA 2QWXA 1Z28A 5L9AA 1U8WA 4Q24A 3EGDB 1I5OA 5J2PA 2I3DA 2YFHA 2OK7A 3DLBA 5K4HA 5JV5A 2GF2A 2HSDA 3MMXA 4ZRMA 1X14A 3LKDA 3TCNA 3I34X 4US2R 4L73A 4Q03A 3KTFA 4DN9A 3PVXA 2QZJA 2XJ4A 4QUIA 3HJNA 1KO7A 4G3IA 3SC3A 3FPAA 3HD1A 3I0ZA 1JL3A 5L4SA 3EMDA 3I9ZA 5K14B 2NIPA 5LL6P 1ZGJA 3N8IA 4QQFA 2HVEA 1IL0A 1HYQA 2DSNA 4HWOA 1T6NA 4M1TA 4OYWA 4A3SA 3SZ2A 4L9WA 3NDIA 3RSGA 1K92A 4UBIA 2GXSA 2CLOB 4R8UB 1B2LA 3BL5A 1PJ3A 5FDLB 3M1AA 3FZNA 3RYIA 4FLEA 2ZT8A 3FRZA 1K9SA 1DSSG 3BEDA 4LJ7A 4C05A 4YMTA 1K2WA 4DL0C 2ZANA 5BSVA 1XN4A 1YSJA 1FY2A 4YV0A 4OX9J 3GV7B 2BUCA 1Q0LA 1Z5WA 2OK8A 3GN2A 3RH0A 1L7EA 2W98A 5BYBA 3EGOA 4ZPVR 1J2JA 2FJUA 3VR2A 2C2OA 2RHOA 1BA3A 1IATA 1Z06A 4B9UA 5T6MA 1W4LA 4UUMA 5B36A 4J7CA 4RZXA 2F8SA 3C6UA 2F3JA 1HXHA 3AO0B 4CJXA 3HEBA 3O2QB 1CB7A 3DGFC 4PVDA 3UT0A 1PAEX 3PC8A 2XMGA 3W8FA 1SK8A 1GTG1 4QHSA 4AQDA 2OCBA 4P0QB 4YPOA 3QEMA 2JLYA 1M34A 5ADUS 2W8KA 2GETA 1YRYE 4E31A 5KPDA 3EQ2A 2ADBA 4M89A 3W5YA 4CG2A 2MINB 1ZZFA 2ISSD 3FHOA 2ZH5A 4K9PA 1PUXA 3N8HA 5AJWA 4E13A 5DM2A 3Q40A 1SEVA 1UP4A 1XRSB 1W76A 4LF8B 4TLDA 3RR2A 1V8DA 2H59A 3P32A 3ILLA 5JY1A 3C8ZA 2K2PA 5BW8A 1IZ0A 4BTEA 5IHXA 2QGZA 3SF8B 3WLKX 3JQ6A 4F4UA 1FE8A 5GMKa 4RA9B 4EI2A 2IBTA 4R5HA 1SC3A 1UKVY 1QIHA 1MU2A 4BC0A 2FQWA 3DGEC 3AXSA 5KTSA 1TM3E 2VTVA 4CIYA 2WFLB 4OYMA 3RTCA 4X91A 4IDCA 1XMOB 4ECZA 1MVOA 4OV6B 4WQMA 1A2KC 4UUAA 4JI5F 2IM2A 3PTZA 5D5QA 4IIJA 3QBJA 3WC4A 5EHIA 1O03A 1VE3A 3MECB 3W9JA 3ENKA 4GI3A 1B73A 5CH3A 1MOPA 1BEUB 3T7KA 3DA8A 4B4UA 2PZLA 2BQ3A 1TO6A 4AKSA 5SZHB 4IJKA 5DRTA 2BN4A 5I9LA 1UT5A 1FCAA 3Q3CA 2EIHA 1GLGA 2GD6A 2I55A 4HEA1 3ISZA 4MS1B 1X7YB 1UT6A 4EF4A 2Q9BA 2JS7A 4JC8A 4MCJA 3LH2S 2H1YA 1PG5B 4F4CA 2MY8A 3LHSA 6ABPA 2H5EA 2R9LA 1OT3A 4QUBA 3PEEA 2GTIA 4XIYA 3G2IA 3EVNA 4X1YA 3ZQ6A 1X0XA 3I04M 2E7XA 3D6NB 3W7VA 3C7AA 5K8JB 3AR9A 4K9DA 2ZJ6A 4UD2A 5ETPA 4BAGA 4L5IA 1YIJS 1E94E 1TMGE 4D43A 3GNTA 2ZVPX 4F4AA 3UWMA 2AFHB 3GROA 3MTBA 1E98A 5HQJA 3NQ41 3BQMB 2W0SA 3KHKA 3L4SO 1O2DA 5KTRA 1A04A 1WXQA 1SM4A 1RTDA 1NDUA 4D4MA 2F6RA 1XZKA 4MP3A 5FA6A 2YWCA 4V03A 16PKA 2AMLA 3DRYA 4RQAA 4DY6A 2QIOA 2J0SA 1ADJA 2VJUA 1OI4A 4KNVA 5JQWA 3K96A 4DEXA 4L28A 3M9WA 3TZBA 1KSFX 1O95A 1YQQA 1V47A 3PQ5A 2QB5A 4QU8A 2QAIA 3RLIA 4YR9A 2RHBA 2EBWA 2ALJA 2BOAA 4TZ0A 3DKDA 1ZGZA 1KSHA 2H2HA 2DBBA 4BMVA 1VSVA 1MEEA 4ZODA 3AJAA 2GWRA 4GQBA 1NPDA 3ROQA 2C57A 4BZPA 4UAJA 2UYGA 3PIDA 1R31A 3RSOA 4KZKA 1GCUA 1BMTA 1NE2A 2OO4A 4FW9A 4RYDA 3VAJA 2P30A 4HWGA 2OSRA 3TW8A 4LC1A 4JBNA 4D9MA 1K0TA 3MS4A 2JCBA 1ISFA 4TLAA 2F5GA 4ZVMA 5JC8A 2IYVA 2QPAA 2Y0DA 4W6ZA 2AD1A 1Z07A 1UDWA 3IV9A 5SYMA 1H7XA 4F5EA 5DK6A 1RBMA 5L6MB 2MQOA 5DEOA 4B73A 3I4PA 2AYMA 1DGQA 2OILA 3B8HA 2FMUA 2OEMA 4JT2A 5DGXA 2CYBA 1NMQA 2AA3A 1B8OA 1RJGA 2ATLA 4ALJA 1RM4A 2WSBA 1CETA 3OZAA 4YN3A 4GHWA 4C3OB 4Y34A 1RLJA 2I4TA 1GL9B 2VJQA 4GKJF 5SZIA 1SQ6A 2BBEA 5EIOA 5DGBA 4MWSA 2LQ8A 2PSZA 4OX9B 5CYJA 4UD6A 2XXAA 4QM7A 4OI1A 1UWBB 2OOSA 4H0NA 4KO0A 2XQGA 2GJ2A 4KCGA 2JJ2D 1RT6A 4ZEWA 3T4EA 2H17A 4QODA 3OM1A 5CNIA 3WA6A 3GMTA 1BQNA 2J9DA 2NUAB 3RS9A 2WTXA 2Q2NA 1VLHA 5FOQA 4JJ7A 2Y05A 4AG3A 2V50A 1EDEA 1BJRE 3RT7A 5DCYA 4UTOA 3NO4A 3PGVA 1VDHA 5A8RA 4PCAA 1B4DA 3DZBA 4BQPA 4PPGA 3RHSA 2XADA 1EK5A 3KNZA 2XBLA 5DKFA 3DEAA 1ODLA 3KAPA 4LY6A 4DI6A 2JLXA 2ORVA 1WDWB 1UT8A 1TAUA 4D9IA 1K68A 1W4BA 5GIPE 5HZMA 4QBKA 5LQSA 2JAQA 3MT8A 3KG0A 4KO4S 1UZHA 2ZM6F 4AL7A 2DO4A 5JD6A 5KT6A 4TKMA 4H6PA 2J0XA 5IVPA 4RPLA 3P2OA 3TSCA 4JBLA 2Z04A 1C4XA 5B1SA 3N75A 2OP5A 3B51X 1YJVA 2HLDD 1EIYB 3LQ1A 3R7AA 1CFJA 3PD7A 3ICQB 2DNGA 4ZHRB 1DARA 1ZJ4A 4H3VA 2QX8A 2AFIB 1GZVA 1PT5A 1VLZA 1UZDA 3OEHA 3IT3A 5EEHA 1WMBA 1CJUC 1AGXA 1IB6A 3PEFA 3S2IA 2H1VA 4EGJA 3TW4A 2B3TB 4JBCA 1KAEA 3PJEA 2QMQA 2YWHA 3KKEA 1DRJA 2FJDB 4LE1A 3TO8A 3RAXA 4FYYA 4HTIA 3AI3A 5LQCA 2JJ8A 1M34E 1Z35A 3VZCA 2CJFA 4IVRA 4A8JB 6CHYA 5E4FA 3KLVA 1F8UA 2CZ9A 1KMIY 2DUJA 1U4NA 1H05A 2ZOGA 1ZK4A 3IP6A 3MB8A 2AX3A 1MROB 3CGGA 2KG1A 1G1MA 5AWFC 3KVYA 2QR3A 3ACCA 3H04A 5FLEX 4WRRA 2CLDX 3J81U 3QT5A 1JYEA 3RNLA 4KK3A 4BNHA 3OIFA 4AJEA 1BDBA 1BJKA 1CUXA 4H2DA 1YZTA 5DF1A 4Z7OB 1VSTA 3IVRA 4P8RA 2IVZA 4LXHA 2GMLA 3W2VA 4MKHA 4Z7YA 4KDRA 2RQCA 4WY5A 3V6DA 4OFBA 2O8DA 4MKIA 2EFQA 2GO1A 3BE8A 3FSGA 1MW9X 4YUYA 5DG9A 3CJKA 2I80A 3IDAA 3VGTA 2IT1A 4X41A 2UZAA 1UPUA 4ZT5A 5FBZA 5T3UA 3D8RA 3GEPA 4GPAA 4Q43A 3L92A 4YCCA 7REQA 3LLUA 1LS6A 3W04A 3WA7A 4MRNA 2RC5A 5I8ZA 1I3NA 3KYCB 4F25A 3IXMA 3FYDA 3KPJA 2EKZA 1EJ7L 2BUAA 1QX4A 1R1DA 1V3ZA 2W9BA 4OXNA 4U6NA 1QNLA 4DRXA 1WJ9A 4EARA 3C5CA 4JV5J 1OGIA 3DOMA 3KX2A 7YASA 1BQMA 1T3ZA 2ADMA 2G0IA 3EVEA 2GNPA 1JLAA 2P8SA 4X4SA 5HS6A 3G9QA 1QP4A 4WUTA 1QPGA 1E2EA 1YJBA 2OH2A 1Z36A 5A76A 1ZETA 4ZO8A 1E3EA 3T12A 4KGXB 2Y1LA 3KG1A 2H5IB 1O08A 3PX6A 3H5YA 5K6AC 1JQAA 4NULA 3MGGA 1U8EA 2BMJA 3WY9A 1SCUB 2BF4A 5A9TA 1XKXA 1P4RA 1Q11A 2WJAA 4Q66C 1TD1A 4DDMA 2DGWA 4CMIB 4EUNA 3ZDEA 5BWLA 4ZCLA 4L6AA 3BZWA 5EHGA 5JO0A 1OLXB 2AMJA 4FN5A 1P6TA 3CO9A 4GYYA 4DRYA 3CH7A 1VMEA 1RT7A 3P2YA 2PIIA 2BKNA 3N07A 4NL5A 1SG0A 3U4DA 3QT8A 1PFYA 2GAHC 1EVZA 5B7NA 3K0FA 1BSVA 2WFAA 3G82B 4CLTA 3QATA 3JQKA 2FRXA 4NS4A 3EOAI 4AD6A 2IZ1A 1I2DA 3RJMA 5GONB 3P27A 3FOCA 4DR1J 7AT1A 2Z2YB 1KP2A 2XUDA 2KI2A 1SOVA 4MROA 3TARA 4OLJA 4GBGA 4B3JA 3LA8A 4BFVA 1RWXB 1BYUA 2IXBA 4KGMA 1RHJB 1XNGA 3MD0A 5K8UA 4UUXA 3B36A 2XNRA 5IEJA 3SYLA 1I4TD 3F0NA 3D0HE 3AH8A 2PA8D 3L0DA 1ES9A 1T7PA 4GD3Q 5FUBA 3PR5B 5K3EA 2VA8A 5HJYA 4ZOLA 5DDIP 3AG5A 1NC1A 1FKOA 4L7VA 4RW7A 1ZICA 2PFKA 5KOIA 2OPHA 3PR2B 4NHEA 3E9ZA 1HNVB 3RC1A 3OTBA 4CTMA 4GP6A 1M8KA 3B52X 1E7SA 4F3NA 1T6ZA 2N42A 3ET4A 5DNYB 1W30A 2P1ZA 4HVAA 5AXLA 3I9V9 4DPKA 2DHQA 4G63A 2WVHA 3ONVA 1RYNA 3GQBB 1G6BA 3UWSA 4JUDX 1TADA 5HRCA 1ZGCA 1P2BA 3R5CA 1YCHA 3WYEA 4OPMA 4FHFA 2A18A 1VHDA 4IFBA 2Y8EA 3O4HA 2FOIA 4LVOA 5I51A 4UUNA 3MPUB 3QLVA 5FA5A 1PGZA 1GN9A 3VR5D 1TEZA 1Z7GA 1RYBA 2VDMB 2ZXFA 2J9DE 3OR2B 4JYAF 1BXKA 1WVGA 4X95A 5H59A 1I14A 1MD9A 3AEQA 1LEOA 1NMZA 5IABA 1P1JA 2FMTA 5LA6A 8ATCB 1XNHA 2H0AA 5H5JA 3LYUA 3R3YA 4Y9DA 3CE8A 4H7PA 1UIMA 4Y2HA 1U4OA 3W2WB 4JJKA 4EHJA 1U2SA 2C5AA 4I1SA 2Y8WA 1Y3DE 3HSSA 2BCGY 4ER8A 3BXXA 3CWJA 1WDLA 3VVLA 4NSNA 4YCJA 3GP5A 3I39X 4FCTA 5B3KA 1NVXQ 1ND5A 2QMZA 1RRPA 1J9EA 5LUBA 2B2XA 2KKHA 2V3VA 5F8NA 4ABTA 5A9RA 3AKEA 4Q7EA 2P1RA 4PRKA 2PT9A 3V2IA 5JCJD 5P21A 2JKYA 3CG0A 3KELA 4MQ6A 3D0KA 1ZOIA 2XRFA 4HVCA 4RR5A 4MICA 4NJMB 1U63A 2R1VB 3ZI7A 1U1PA 2DWQA 2FPRA 4CM9D 3TK1A 1NF9A 5F3WB 3M2PA 2MSTA 1R9GA 1Y1TA 2QENA 2R8RA 4P92A 1S9GA 1TKXB 1RSCA 4XSGA 5I42A 2W2NP 4NLDA 4Q7AA 3NV7A 2GM3A 4KMRA 3R77A 1HGXA 1NIJA 2WYOA 1B00A 1T4GA 1SURA 4YWHA 5J4LA 3TR5A 2HGNA 4JLWA 3NS6A 4DJ5X 3AXMA 2HK7A 2BMDA 3IPYA 3BH0A 4IRMA 1XQ6A 1PS0A 1ZH0A 2KT5A 4AWXA 4TLLB 3VYWA 1IH8A 2IYNA 4J9SA 1VE9A 5AOVA 3S40A 3KJQA 4LTMA 3NHKA 4CCYA 5B7WA 5L6LB 4JV5B 1OFUX 2H6EA 3RRXA 4HLCA 3MA0A