3ZDXB

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
464
structure length
464
Chain Sequence
NICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 464
sequence length 464
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3zdxB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3zdxB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3zdxB03
3OKWA 3PPXA 1SHYB 4Z7OB 2VDNB 4WK2B 1OLZA 2UZYB 4CN8A 4O02A 1U8CB 4WFQA 5E6UA 4IHKA 3BQNB 4G1MB 4IXDA 2X5NA 3AL9A 2NUTB 1PD0A 3ZE1B 3EFOB 2P26A 1ZOOA 4HQOA 3IBSA 4NENA 1ZONA 1QC5B 2VC2B 1SSLA 2XWBF 3M6FA 2M32A 3HXQA 1JEYB 2VDMB 1MJNA 3F78A 1IJBA 4G1EA 4BJ3A 3NVQA 3K72A 5E6SA 2VDRB 4HQLA 2VDKB 4PN7A 4MMZB 2WW8A 4M76B 3HXOA 5E6RA 2ODPA 5HDBB 3BQMB 1MQAA 4Z7QB 1XDDA 3EGXA 5KYXB 4CNBA 4F1KA 2XGGA 3T3PB 1U8CA 1UEXC 1SQ0A 1M1XB 4UM9D 1T6BY 3EH2A 2VDOB 4G1MA 4DMUB 2NUTA 1FE8A 3TXAA 3EFOA 1RD4A 1QCYA 4FX5A 3EGDB 1YVRA 4JX0A 1JV2B 1AO3A 1JEYA 1NA5A 3RAGA 1SHTX 3EH1A 1DGQA 4UM9B 3AFCA 1JEQB 5KYUB 5ES4B 3ZDYB 3TVYA 3QA3E 3FCSB 1ATZA 1M2VB 2XWJI 4A0QA 5BV8A 4UM8B 3EG9B 5HJ2A 4CN9A 5KYWB 4MMZA 3V4PB 4HQNA 3AL8B 4MMYB 3ZE2B 5KYXA 1YVPA 1PD1A 1U0OC 3ZE0B 1BHQ1 4MMXB 4NEHB 1M1XA 3V4VB 4GZ8A 2QTVA 1MQ9A 3K71B 4O3TB 1OAKA 1M10A 1CQPA 4C2BA 3Q3GE 2I6QA 4C2AA 3EGXB 4C29A 2ICAA 3EGDA 3NIDB 1V7PC 2B2XA 1JV2A 2VDLB 3PPWA 2I91A 2P28A 3K6SB 1QC5A 1XDGA 3BN3A 3OL2B 1JEQA 3ZDXB 1IDOA 5KYUA 4F1JA 3NIFB 4HQFA 3FCSA 1DZIA 1M2VA 1T0PA 4FWWA 2NUPB 3EG9A 4JDUA 5KYYB 1MF7A 5KYWA 1U0NA 3AL8A 1XUOA 3PPYA 4MMYA 5E6RB 1RTKA 1PT6A 1L5GB 3EOBI 1JLMA 1Q0PA 1PCXA 2NVOA 4WK4B 1SHUX 2I6SA 3VI4B 1CK4A 1FNSA 3IJEB 2WINI 3N2NA 5HGJA 1ZOPA 4MMXA 3TCXB 1MHPA 1AUQA 4O02B 3GXBA 5E6UB 3TW0A 3K71A 1IJKA 4HQKA 5KYNA 1N3YA 4Z7NB 1M2OA 1AOXA 2ADFA 2VDPB 4NENB 4WJKB 3K6SA 3ZQKA 4K3JB 3OL2A 3PPVA 3E2MA 3NIGB 3FCUB 4WK0B 3T3MB 1YUKA 1BHO1 1IDN1 4O3UB 4G1EB 5LN1A 3VI3B 2NUPA 2O7NA 1TYEB 3K72B 5E6SB 1LFAA 3EOAI 5KYYA 3F74A 3HI6A 2VDQB 1RS0A 4XW2A 1L5GA 1M1UA 1MQ8B 3ZDZB 3OKYB 2ODQA 1RRKA 4IGIA 3IJEA 1N9ZA 2IUEA
chains in the Genus database with same CATH superfamily
4M6WB 2GD2A 1U8IB 4FN5A 2WZCA 3D3WB 2J12B 2HDWA 2NO0A 2CCLA 4PSDA 3ECCA 2JG3A 3S34L 4LL9A 3QELB 4F4JA 1U8OB 2WD9A 4Z7UB 4MV4A 1P3JA 5I48A 2H6PB 4LHVA 3EJCA 2ZJ6A 2NQTA 3JQBC 4RXUA 2EEBA 4X1YB 2Z8ZA 3RPIA 1JLLB 4TQHA 3KKEA 1T9DA 4JI5B 3OTIA 3BT0A 4I55F 2I9PA 3FJYA 3RWJB 2H8PB 4JT2A 1J2EA 2WD0A 4PO1A 2ZJSL 4IV0A 4M56A 4BXVA 1NZRA 4AYXA 3T7RA 3WNIA 3VU0A 4N0QA 3Q1KA 2Z64C 5FBQB 2H1PH 4M98A 2IIJA 3GLEA 1CJBA 4G0WA 1YVUA 1XDBA 1VHPA 4TLMB 4GG6A 3ESPA 1YJBA 4R7ZA 1QGED 2I60L 4ELKA 1TVCA 3SZ3A 3BAWA 1AUOA 4J27A 3EZXA 4YAQB 1XHLA 3BC1A 2WHYA 3BH8A 5ALPA 1F6DA 5DOVA 1FE8H 2ITCB 5TQVA 1IIKA 1PF7E 3RVVD 2AWNA 5INCA 1C41A 4WPGA 2VXQA 1G6RB 4FHBD 5I7FA 3A6CL 1HXMA 4WAUA 3OKOA 4QRSA 3FPKA 4DSZA 1RIHL 3TNNB 3UPRA 5DDHA 3E1KA 2OP4H 3HBNA 3IRCA 1IEBB 3BCUA 4URUR 2R6FA 3N0AA 2H1XA 3FB5B 4HWUA 1LPPA 4WWHA 4YIQA 4MW6A 1V4NA 3N2YA 2YQZA 4UTOA 4LK3A 4Y2DB 3PXGA 4PJXF 2FOLA 2CQVA 4YK7A 4H5SA 3K5IA 2NPOA 2RJ3A 2RGCA 4IRJA 1XP8A 4JHBA 1GL6A 1TMQA 2BH0A 2G9QA 4A26A 1WAAE 4BS9A 5HHVH 4YWHA 3P3SA 4B35A 1W36D 5DJAB 4Z5RB 3V4OA 4P4RA 3GEFA 3ICWA 3U3MA 1NBYA 1F1GA 4RMVA 4AMUA 1M42A 5DX8A 5HI5C 2O2ZA 4HFWA 3UK1A 3AW8A 1QASA 2UVFA 5HTOA 1CS4C 1WFMA 3PEYA 3C09C 5HHQA 3TSYA 3CK0H 3KDPA 3PWLB 2Y6SD 4LYAA 1PEDA 4LMPA 1BHQ1 1O1YA 4R7XA 3ND9A 4QDGA 4UDUB 1MRZA 5IF9A 1F8UA 1F0LA 3H18A 4C29A 3GQBB 3RUAA 4BX0A 1Q9LA 4CODB 4OX9B 4HUXB 4MCYA 2QRQA 1XQVA 4ZXBB 3GJSA 1FU8A 3QWHA 2WLSA 4XPGH 4L8CA 4I8IA 5BN3A 5F88B 1WVGA 1E5TA 3P69A 5K51A 2Z56A 2APXA 2B8TA 4R0LA 3QG7L 2BM1A 7MHTA 1U04A 5FK9A 4YPJA 3ND5A 1YQDA 4DC1A 1J8SA 1CWUA 4RKFA 4UHDA 2NV0A 4ZHQA 4LSSL 3T3OA 3GI8H 1YYCA 2EXYD 3LNFA 4JW3A 2DQKA 4EZIA 1XFAA 1KYFA 2X10A 1IAMA 2JK5A 3G2LA 1HORA 1D1TA 2YHBA 5CP8A 1ND5A 1WD5A 3RB8A 5HHOD 5FLUA 1XJCA 3LCYA 4X1OA 2BEVB 4NP4L 4A2PA 1DBWA 1QAOA 4KNVA 5K6RA 4C01A 2PGXA 4RPHA 3OT1A 5DC0A 3MRKA 1HJBC 4K6OA 2IG2L 3LN9A 5BV7C 3L1KA 1X6LA 1W0WA 3UTDA 1QK5A 1LLDA 1KGWA 3MJ8A 1NUUA 2D1TA 3KUCA 3T0AA 4N3UA 5G0UA 1UWVA 4NXKA 3QIWD 4X4MA 1HTWA 3UC0H 3GMQB 1T6VN 4XASA 5BUGA 3A1CA 1NANH 2A5UA 2F0CA 3VB8A 1EP3B 3THYB 3LQAL 1BBJB 3Q7TA 2OCGA 4URWR 1ZJJA 4CVXB 1BEUB 5FLVA 3IT1A 2JBAB 1DB3A 4TTDD 2PAAA 3UMBA 2XOKD 3VSAA 4IHJA 3R4RA 4MXQD 1OTTC 4RLSA 3DTUB 4O2BA 4DRXA 2E4AA 3B83A 2JKWA 1DDGA 1I4TD 2Q2EB 2B78A 4D57A 2YWHA 1XSKA 1R7RA 4JRXA 4AXBA 1E60A 3WSQH 4CILA 4Z1OA 1J8MF 1RRVA 2GPSA 3L6EA 2BN4A 4HDNB 2QFRA 2J43A 5CAEB 3ECSA 5HHMB 4NIMA 4CHGA 2V9TA 3JV6B 1FSSA 2PUAA 4HMDA 3TQCA 4OXXA 4N20A 1HT6A 3LH5A 1AKEA 2EZ8A 4GEKA 1OF2B 4JY4B 4GQQA 4KKCC 1BVUA 1MQSA 2Q3DA 4WLNA 3VX4A 2MSEB 4KE8A 1V41E 3WRXC 4E5PA 4PWEA 2FX2A 4UTZA 2FP4B 2R00C 3TT1L 2WWKO 4HQQH 4UILL 5ADUS 4M4PA 1G21B 4YS4A 3A4EA 2PFKA 5EOTA 4OZ4B 4JX0A 4DV6B 3TXXA 1IZZA 1RZ8B 4NNXB 2QDXA 3N39C 4GECA 1E3WB 4EZBA 4R4FL 1V3UA 3ENWA 1I7QB 1XF5A 3S3DB 5JD4A 1V8PA 1FSFA 2G4VA 4RSVA 3TW8B 4IQFA 1I7DA 1QFWM 1Q0XH 3VXSA 3P45A 4AIEA 4WUUD 1O96B 4FI7A 5FYKU 5KOMC 3S3SA 3ML9A 4HIQA 5BQDA 1JR3A 4G0YA 5K8UA 3AF0A 4LV6A 2EH7H 4XE5B 2JKRM 1RNLA 4JL1A 1A6WH 2ZS8A 1U3DA 4DV1B 2Q87A 2NY7H 4PPFA 2QUKA 4MXVE 2KW5A 2BSSB 2PF6A 3IXAB 3QX9A 3B2DC 2JAUA 1IBMB 3ASZA 3T3ME 3JD4A 4LG1A 5J1AA 2WKSA 3EXIB 4BGDA 5DJ2A 2IHZA 4EKJA 4JM2F 1C12B 3EWSA 1LFAA 4Y5YB 4DB2A 3EXHC 4F5ZA 2MSNA 2EGHA 2NU7A 3WHE1 2JGRA 3UO8B 3BWVA 4BZQA 4EKNB 4D0DA 2UV3A 2GQHA 3N76A 3RJQB 1PGOA 2AYYA 4KGLA 1VJSA 1DBKH 5EOCJ 2WD7B 4CDGA 2BM0A 5IXSA 2Q6WB 4G24A 5D1XC 1ND0B 1K6JA 5E0OA 4PRPD 2J8UA 3PKJA 5HVWA 2EFGA 2Z08A 5LCVH 1FFRA 4WHCA 2O8FB 4RIFA 4JG9A 3QJGA 1RP7A 3CXRA 5D7HA 1I3NA 2GBUA 4MZIA 4BAUA 4F0JA 4R2MA 2OL3H 3NJXA 1NQWA 3CFBB 2ZRLA 3GYGA 5CIYA 4JNXA 4PZ0A 4EBBA 2ZETA 1F4VA 3UTZA 1CGWA 2PTTA 3BUYB 3QXGA 4RSHA 1ZIDA 4BQRA 4MEJA 1FTYA 4PG2C 3CX8A 4LASL 3VHQA 3AVYA 2AJUH 1M7IA 1MI5B 4Z9BA 5EV7A 3LYHA 4G1VA 4IUCS 3FX2A 2ZZUT 3LKSA 3I2KA 2AXQA 3NGMA 4TNWK 2OMKA 4JSRA 2BZ1A 1HK7A 4WDQA 3IIMA 3O4OB 2EEFA 2F6AA 3LYAA 1M1YB 3AUXA 3FQ1A 1M2OA 1HYHA 3TCTA 3IBEA 3L8MA 4HDMB 5L0QC 4R97B 1ZIBA 2MH4A 2WSPA 5AI5A 2ECFA 3W5SA 2VZ3A 3QNWA 2VDUE 1JK8B 4MWDA 1LQBC 2FA9A 2CCVA 2QM8A 3UH0A 5EXDA 5KTNA 1G21E 4CN8A 2H32A 2XF2A 4XFDA 2GPJA 4JFPB 4PGCB 2AFVA 4Y4HD 2FW8A 1VA9A 1KZ9A 1KKLA 1LDYA 4QRRE 5ETJA 4Y2LA 2X22A 4ZU3A 4UTNA 3E8VA 4QRDA 3GZKA 3N2KA 5EJ8A 3RFZB 3D6UA 3G59A 5DTMA 2RHRA 3SQOL 3VDNB 1EMTH 5EWIL 3N7TA 1JPSL 5U4XA 2F1HA 1N4DA 3CR7A 5K9OB 4DR4B 3WL6A 3OTWA 5AUQA 3JQ8B 3KU4A 3VC7A 3U7QA 2C3PA 4G86A 5LMZA 3UYPB 4XSGA 1RZGA 2ESVB 2UZXA 2XNAB 5F6IB 1TQ6A 4OCMC 2Z2IA 3VFMA 3GV0A 3O1JC 3L3OC 4KQ0A 3E7WA 3D06A 3RIGA 1F3RB 4XRGA 3RVXC 5DC2A 3IP5A 2JV6A 1CY6A 3KJHA 2R1WA 2WBLC 1UWXH 1MFNA 1M72A 5MHSD 1ODTC 2GCOA 5I9SA 2H2SD 2RH9B 3TBKA 1YN7B 5A4JA 5B38G 1FUKA 1U5AA 4V03A 2X2OA 3RAFC 3RBVA 4GE0A 3WLQA 2V7QD 4PZEA 2QMKA 1FFTB 2O5XH 1XJ0A 2CJUL 3WXWL 3PIDA 2JBWA 1UWGH 1Y9DA 3ATAA 3GHHA 3FSWA 5KOYA 2V7PA 2OMZB 4H4DA 2XXGA 5TQ2H 1NAIA 2QZ5A 1CBVL 3GJ3A 3KBPA 4J4PD 4RADA 3TPUB 3GFBA 5DNDA 2RCSH 2HSJA 1IAOA 1DQJB 2ZOOA 5FO8B 4JLUA 5I73C 4L0MA 2H1VA 5FP0A 4C3VA 4XAWL 2EKZA 2HHHB 4NHUA 1VCNA 2Y9RT 4B3TB 4HUXA 3TJZA 2A9NH 2VDWB 3PI6A 3QSYA 4QJ4B 1KYUA 4L3CB 4Q0MA 2FSVA 1JPST 4K2AA 2HEIA 2LAAA 5DK0B 5EEZA 4L5AA 1OE0A 3I2FA 1PGJA 5DSCB 3ZSTA 4OCWH 1MUJA 4OGYH 4FKHA 3BKML 5TDNA 2QMEA 4J3FA 4QGYA 1H66A 1SBIA 4KUZL 3DUFB 2CE2X 2W6NA 2WPDD 1OQAA 5ICEA 1FU4A 4YE0A 3BJRA 4IQ8A 2BERA 1U9IA 5K3EA 3AVVA 3MCKB 4TYWA 2ZPAA 3HB3C 2PT9A 1UOPA 4HYYA 1IB6A 2ZXCA 1KBKA 1RMTA 3LY8A 2NTSP 1AV6A 4JGIA 5JOPE 2UYGA 2X8JB 3KQUA 4XVUC 1IPFA 2AMVA 1YQ2A 4G26A 1ZESA 2D7TH 4Z0TA 3MXWH 1AD0B 1EFVB 2H3NB 4Q6BA 5LO7A 5JE8A 1XHHA 4EB8A 2UZIL 4WJKB 4IBQA 4EMBA 1EHIA 2IEZA 2AQPA 3RU3A 5J6SA 4OCRL 4WY8A 5AHWA 3DUSA 1XWVA 3GMQA 1GZ6A 4RVFA 2XBMA 5CIPA 1WNFA 2C97A 2YY5A 2X1HA 1NYTA 3CZLA 4F9LC 1DINA 1XL4A 4CMGA 2IP4A 1CJCA 1LI4A 1BBJA 3VR5A 3I37X 5B3JA 2OJZL 4UMGA 4FNOA 3CVVA 1CS0B 4LNVA 2C82A 3LXUX 4V0QA 4NIKB 1VLVA 3S5UA 1EAYA 4PV1C 3A11A 3MJTA 1USWA 4GSDL 4JO3L 5DRZA 2NU8A 4YACA 4EI6A 5KNDD 3SDYL 3BLKA 2OI9C 3IJHB 1JQJC 3W5NA 1ZANH 2CBXA 5EO9A 3QEQE 1YT5A 3U79A 4R98A 1HDYA 4Y2HA 3H1ZA 3F05A 3RWHA 1Z5GA 3KPOA 5DHFA 2JTYA 2JLYA 2BCMA 4NVRA 3EW7A 3ILPB 3KJ4B 3ZHTA 3VO2A 2K8QA 5LG6A 1M2VB 4OLZH 4BNWA 3WUWA 1IC5L 4YRBA 3PQ2A 1FJHA 4L8SA 2JIBA 4G4JA 2QVMA 4ALAH 1Q0YL 3E3NA 2VL7A 4RFVA 4OZGA 2JGMA 4TVKA 3N1MC 2H54A 2YWFA 3AJDA 1T36A 1MVFA 4PPTA 1GG5A 5J2UA 5CXXA 4ZIRA 4OY3A 2XWRA 3LEVL 3RC8A 4H2DA 5EF1A 1SUPA 2NVOA 4G1FA 3SPVA 4PZUA 5TPWB 3SX2A 5GS2H 2AOWA 1W15A 5CT9A 4ZW7A 1N9KA 3VGEA 1UA6H 3KSZO 1RRCA 3ML8A 1IAQA 3AM1A 4FNRA 3FTPA 4BVGA 3IPAA 1TQBB 3BH9B 1AKUA 2GEKA 3MWDA 1VGEL 4L1TA 3EOAI 4RHXA 1CUIA 1R0BA 3U4IA 2W4QA 2OJEB 2B1JA 3SGDH 2A59A 2GT1A 2LP4Y 2CE6A 3B7UX 4WWPA 3RANA 2OCCB 3QNXA 3F6JA 3RWIB 2JEZA 1Q1GA 1L2TA 3U3XA 4FG0A 3TBWB 4IOIB 4IEFA 2V7GA 3NC0C 1CUJA 1GGYA 2JCXA 4P9HL 1MW1A 2VDRB 4N0YH 3PDHA 3WK5A 3I01A 4F5CE 3JYOA 3F84A 2Y1CA 1XVTA 4NQXA 1JA0A 3HG7A 1P7ZA 3AOGA 3V5KA 3HKBB 3DV4A 3O0RH 1W36B 5CA1A 3P9MB 4KH2A 5FW6A 5KYWB 4BUJA 3H8VA 1JZ4A 3FQNA 3NBXX 1YUHB 3VXUE 3ICOA 4WDIB 4IY1A 3OMIB 3OZ9H 3PWKA 5IVHA 4IRJC 2B0JA 1LDEA 5E2BA 4HH8A 1J20A 1G7LB 1RJLB 1Y3FE 2NU9B 2E55A 1P5RA 3SXJA 4B9EA 5E6RB 3MELA 4B7IA 1GNTA 5B58T 1A8PA 2LIVA 2RGUA 5DT1H 3ENKA 4Y0NA 5B7FA 1VIMA 3VJ6B 3V5DB 2O8FA 1QTSA 5E1HB 3H7BA 1O6GA 4PSUA 4ZMWA 4JBYA 2W65A 1UM8A 4DLLA 1MFEH 2CBZA 1MG2C 3O8CA 3W1ZA 3WCYA 3ZOZA 4U7GA 1H0DA 1UXHA 4G36A 4L18A 3QA3A 5DHDA 1NLFA 1S2OA 1YVLA 1FS5A 5JS6A 4ONFH 3GRWH 1Z0IA 1ZJZA 2BHRA 5IWLA 1FC2D 4ZOCA 1PFOA 5JSYA 3GLIA 4GS7C 4S1TA 3NCFB 3SHWA 4GAJL 3ULUC 1KY2A 4MUIA 4BNDB 1NANI 1I9RH 2JE8A 2YN2A 3K94A 5HHOB 2DFPA 1ULBA 1YS2X 4X6EA 1YBMA 3GGDA 4BB6A 4M4SA 2OVBA 1L5LA 1T2JA 3GBSA 3NHJA 2Y2WA 2WABA 1HEIA 2ZAMA 4EF4A 4OT1L 4NBZB 4ZZ1A 3VMOA 2LNDA 3FSZA 3NAAH 2ZZKA 1SAYA 3N04A 2WLTA 3GSVB 5EH1A 2OV0A 5C1PA 4H25A 4NK5A 1NGXA 4QJBA 1B0IA 3RJ9A 4HT1H 5DHYB 1V3TA 2DWOA 4ANKA 3QIWB 4P98A 4RJ2A 5C5EA 1LILA 4HJ0D 5GXBB 4PU0A 2Q3AA 2IPUG 2Q4EA 1ZPUA 1TYAE 1YS7A 4IDCA 2Q4TA 3MROA 5IJDC 4OQ1A 3PCYA 2ZCHH 2VJAA 5F7MC 4HETA 3VZRA 2QJFA 4N5MA 5ILGA 1XTSA 3D2LA 1XZFA 2IF0A 1SM3H 4IIJF 4BPBA 4GP5B 1RJ9A 3H3PL 1BJ1J 2P5WE 1KF0A 2RE8A 3KEMA 3KWMA 3QI7A 4BWVA 3VNSA 4NLLA 4MVJG 3ZCSA 2UZ0A 4W6WB 3VD4A 3ZWOA 4BO6A 1CUUA 1ZM7A 1UCTA 5KTPA 2P2SA 2EEDA 3EPRA 3NEAA 4AVYA 5BMVF 1NFDA 4M9ZA 3RUDA 4XH9B 3WTWA 3E3MA 4UBLA 4CTNA 3BPLC 3PYCA 2PMEA 4PQRA 4ZXPA 4HDKB 2QZ4A 2G2NA 3LB6D 3DBXA 4TKVB 2IHBA 1E7RA 3S3JA 1JXJA 3CCHA 4DP1X 3N50A 3RJDA 2Y05A 1CICA 4OLUH 4OZHB 2CC2A 4M8NE 4A2DA 3FB4A 4I1PA 5IQ9B 9PCYA 1C9DB 3B56A 3O45A 2PPFA 5DVNA 4CLOA 3RJMA 3H2KA 2F43A 4HMEA 1EFCA 3WLPA 2Y1XA 5FO9B 4IK7A 3EH1A 3D7LA 2FB9A 3MUGB 3OAZK 4NQVB 3QFDA 3V80A 2O5YL 4DXDA 2E74C 3DSNA 5EO1A 3ZHDA 1TYRA 4KJQC 2SEBA 4OMUA 1KMHB 3K71B 4UATA 2CGYA 2DCUA 4EY8A 1ZPLA 5T4EA 2NNXA 3FCSA 4K23H 2W2QA 4OJNA 2Q07A 4XTRD 2IOYA 3PUHA 4WUUB 1YDEA 4ECAA 1KLGB 2ZSWA 4PC7A 3U1SH 4M54A 4X6DF 3ILDA 3ZWAA 5IU6A 5JZMA 4KR2A 3TQHA 2ARJB 3OWHA 5FUWA 2J7KA 1MCOL 1LO0L 4NENB 3QBVA 2DPKA 5I45A 4KLZA 3K0YA 3TO4D 4LE0A 3TLGA 1NL0H 1KJ9A 1OF0A 1XMEB 1T2QH 3TWOA 4L3AA 1JLKA 2ZCVA 4ENZA 5AW4A 1OB0A 2RHGB 1YR1A 4Y2SA 4PWJA 5FR2A 1OLUB 3WLNA 1E1RD 1ZNZA 1TYCA 3U9SA 3IJ8A 4GQZA 3NDZE 4LCIL 4BZ1L 2GS9A 4HFJA 2V5RA 2VP0A 2PO6C 4QTIL 4KNTA 1FFCA 1HC7A 2G36A 1Z1WA 2FH6A 4P48A 1L8LA 1ZH6A 1LU9A 3U5TA 2PSJA 4PRPB 4WLVA 4PGGA 3V3TA 2XDQB 3AUTA 4RH4A 1JUFB 1Y5NA 3UV7A 1MOZA 3MV11 1CRZA 1MFDH 3NW9A 4YDKL 5DVOA 3HH8A 2Q76B 1OXBB 4L02A 2GPYA 1W88A 3W6UA 1GTJ1 1W72B 5CB4B 4ZW8A 5JSHA 2E7CA 3AKDA 5LXTA 5DJXB 2B7CA 2DHRA 1VDZA 3K8QA 5CXQA 3VR2D 2Q5JA 2QV4A 3W7BA 3QBTB 5E5MA 5I8OH 1ZLXA 2HJ9A 4CIWA 1QG6A 2CUTA 4FCCA 3MPUA 3WBKA 4D4KA 2HMID 3HUTA 5EHNA 5F77A 2R2EB 1RQ2A 3G2HA 1W1IA 1MA0A 2OMEA 2WWKT 1G8YA 5FO7A 4JFXA 1KPVB 1SC4A 4LW8A 5G55A 2A9OA 3TQQA 4JI0B 1MEJA 1YEJH 5H37H 3VQTA 3VFTB 3WTYA 1N3BA 4JVNA 2GCPA 2X2FA 2OK7A 3KLMX 3OWEA 1RZFL 4ZT1A 4EW3A 2Q1UA 3AWEA 3CVHA 2PPLA 2H1SA 1EFPB 2QYTA 1QH1B 3DOCA 4Y4HB 1DPFA 1G1AA 4GLJA 3H1FA 2EYSB 5IEHA 1PW7A 4Q7LA 1NKVA 5TF4A 5DCCA 1A1NB 2FQQA 4ACBA 1TAGA 4PZYA 3HFMH 4KR7A 2C5DC 1QHPA 1R5IB 2G3MA 2P6RA 2WE8A 3TB4A 1HHKB 5JW4Q 3WL9B 1OARL 3ZPXA 2ZE7A 4TKMA 2N59A 3M6DA 3ANMA 2AJ3A 1UFRA 1B76A 1HX0A 1LZLA 2A6PA 3L1EA 3I6SA 4D3SA 3PDOB 1JMZA 3DE4X 3CN7A 3Q41A 4GI9A 2B9VA 2GEUA 4D26A 2H3HA 4LJRA 2QP9X 5DXAA 3FB8B 4ZYWA 4MKGA 5JW4M 2ZT5A 3SJVA 4ZMXA 2Z93A 3HZVA 3ZR6A 1F60A 4ZYTA 1EGVB 1JXQA 1L8XA 2WK2A 4Z51A 5DN9A 4BQIA 2A9MH 4GQRA 2FWSA 1RY7B 4IFBA 3Q3GA 5B7GA 3H6JA 1WHSA 3BZFB 1NGYA 1ELOA 1JBEA 3U0WH 1COWD 4HDAA 5DJ6B 3I2HA 5SV3A 3RM3A 3Q2OA 4FBGA 1AJ7H 2KHAA 4D9QD 4UTAH 2V5VA 2Z0MA 1SBCA 4Y2DC 4YREA 5DTFA 4X6CA 1L5MA 3SKXA 1T25A 1BS9A 3HCNA 3ENZA 3RLFA 4EARA 4ICIA 1RK7A 3HXQA 1G38A 4WSGA 2Y71A 1EXGA 2XUGA 3U7IA 4MA3B 4D3FA 5E6RA 1QMGA 1VB9A 4GRWH 2QPTA 2QQNH 5AJZA 3B3IA 1UACH 3H3FA 3U3DA 4K94C 2H47C 1LWHA 2XGSA 3T99A 4EKYA 1A1VA 4RDHA 3DQPA 3ISVA 4QXRA 3FLAA 4RD3A 3ETLA 1F4PA 1ZUD1 3MJGX 4ZAWA 2EXWC 2HG5B 1TLLA 1HF3A 3FVWA 3G8DA 4N0UB 1N2EA 1RJYA 3WNVA 2DMKA 1NDGA 1XB2A 5IVXF 3SBWA 4IRMA 2G17A 2QL7A 1G7RA 4N86A 3EJUA 4XHJD 4MVBD 4NKRA 3LQMA 4OQMA 2WF5A 5GONB 2FSVC 4HC1A 1MU0A 1T1GA 3ZRCC 3EGEA 4K6FA 1F06A 2MIZA 4Z7VB 5FJJA 2JFVA 3MGBA 2IH5A 3I72A 3DA0A 4FVTA 2C9UA 2RJMA 4YHKL 1GYAA 4X4XA 4YEFA 3S4SG 4HWTA 3OAUH 4NM8H 4U1KA 2CBGA 5IYZF 4EBFA 4PRNA 4LSTH 1A8IA 3BZ5A 2NY2C 3B3JA 2FQWA 1CU1A 1W6RA 1PX3A 3K5PA 1KBGL 1TUPA 4Z7WB 3HU1A 3O75A 1U9IC 1J4AA 4I48B 4OQZA 1U02A 3FOAA 3HJEA 4W4NA 4XBEH 3EYVA 5KNBH 1ISJA 5ICZB 4KQ4H 1HY3A 1TAQA 1T03H 4FW8A 1WZMA 2FN7A 2EXTA 4GW1B 4X4KA 1EZSA 5LWQA 1XEXA 3LHPL 5C1OA 3X43A 1RU9H 3RUPA 1BMFA 3D9QX 2FIRT 1YCFA 4BGIA 3R23A 3S8WA 3HE7D 1JHTB 3DOJA 1R3LB 2J4WH 2VMJA 2IODA 1ZNWA 4UC0A 2W9DL 2ZD0A 4LFHD 5G4KA 4J39A 4XC1L 1WHTA 1WZKA 4LBZA 3FN4A 4BK5C 1B6TA 4QPPA 4A6DA 4ZMRA 2FO1A 2GTWA 3L43A 1RE0A 3CVWA 4P57B 5B3JC 2GYWA 1G4MA 4D9EA 1PWYE 4OAQA 4XZUB 1TF5A 3QUMA 5CJPA 2Z6UA 4AQ8A 4F4DA 1BW9A 1JZGA 1DBSA 2PUJA 3SGDI 1IQUA 1R6VA 3WGHA 2I26N 5FF6A 4C5CA 1NU6A 2J3KA 3AS3A 3U9TA 4NJ9H 3QDMD 3AM5A 2KLSA 1A4BA 4RH3A 2NVWA 4Y7OC 2ZJ2A 2WFLA 1D1SA 2QZQA 3RUGE 1XQ4A 2F53A 3CBJB 1GY8A 2FUTA 1R10A 4PYJA 2B2XL 1WEHA 2DKMA 1OIXA 4OB8A 2RKOA 1KTRL 1F4WH 1JKXA 2D5CA 4M8KA 3O4LA 3FNRA 1A0OA 3W9YA 4W6QA 3AV3A 2Z9BA 3SFTA 1Y98A 1CUXA 2WJGA 4LCCA 3NJIA 1GL7A 1KJQA 4O2LA 3JQDA 1JXOA 4U4IA 2GEDA 4TULL 2CVPA 1D5XB 1VKZA 4A4DA 1RLWA 2H59A 1ZSDB 1ZAGA 1Y1PA 3FNEA 1WZAA 3MTIA 4K6CA 4HG2A 4I3SH 4TNVF 1P0MA 4NCC2 2QB5A 1RAIA 1XRMA 2MIIA 1U3UA 3LMKA 4GR5A 3KB2A 4JITA 1EERB 5DM1A 5LYYA 2EWVA 3QUAA 2O20A 4Y89A 2CK0H 2PFGA 2CIIB 3WV4A 4Z4IA 3JD1A 1TDQA 2BLFA 1B6RA 2ICWI 4RGMB 3BMNB 2ZUFA 4NT6A 2A77L 1BM3H 3MQFA 5HRAA 2CO4A 2JI7A 4Z7WE 3G02A 1TMOA 3FKSD 2J59A 5HPMB 2QRLA 3OAAA 4M99A 5M34A 3TBVB 5KC9A 1JLMA 4TQEL 4B0OA 2G5BB 2O6HA 3IFPB 3SZ6A 1OP5K 3QP9A 2DV6A 5JSZA 3VGJA 3TN7A 1F8TH 4Q48A 4K3EH 5JNYB 2O3RA 4ONEA 2NUPA 3FCTA 4L1SA 3ZHBA 5F9DC 4LGVA 2W07A 4E09A 1T9BA 5EA0H 4FHFA 4K8RL 5CNHA 3MXVH 1PFKA 3TOVA 5G1OA 3ZL4H 5D4JA 4UARA 4IDJH 1JEYB 1DQDH 2GXQA 2WYVA 2XU9A 2HL6A 3BEVA 1WSBA 4S04A 5FYJH 3L1IA 2D8AA 3V0VB 4P2OA 4JRYD 3EEQA 2W2NA 5BQFA 2IY9A 5KSBB 1Q11A 3AI3A 4XGZB 5HIMA 4KKRA 3SI7A 2DPYA 1XGRB 3BE4A 4XPBH 1TVBA 3KYJB 2B1HH 5IWLC 4L0QA 3V4PB 4D2IA 1I51A 3KM1A 4QDUA 3KUXA 3RHWF 3D1LA 4E51A 4CLRB 3HI6L 4N26A 1DFBL 2DVMA 2E5EA 2ERJB 2AYZA 1EBPA 3JW8A 1F42A 1S78D 3IP7A 4QEKA 3OPZL 3RK0A 3OLQA 4RSYA 4XWWA 1QP0A 1ADJA 2NY3D 5IMOA 5IVZA 1OZ0A 4FOPA 4Z0PA 3O8DA 2WT8A 4KIGA 1VFNA 4HDRB 3LDAA 4WVLA 1H9BA 4QGFA 1UKCA 3H16A 4WXPA 4JLNA 3TINA 1WFOA 5L6LB 1HH9A 1PG5A 4YEEA 2FV8A 3NSXA 2ZYUX 3P52A 1K75A 4ZTUB 5BVJB 5BMFL 3WL9A 2P67A 5AKKA 4AJ9A 4BWGA 3QWOA 3MSCA 5BYKA 3MA7B 3DP7A 2IPNA 2DKSA 1CFVL 3W82A 3ZZSA 3C14C 4TUOB 1NXWA 3DGDA 4HWBA 2Z2XA 1NMBL 1PD0A 4HU8A 3N5CA 1G7IA 1V9LA 1Z4KA 2W9XA 2RCNA 2CFCA 3M1CA 3RFZC 2VNHA 2V2WA 3MOBH 3G2IA 1RQNA 5DRWB 1BZ9A 4HUVB 2QQEA 1J1XL 1N8NA 2PHZA 3BULA 2GF2A 3IQHX 3VNZA 5CFMA 4OF5A 1PJCA 4WEEA 1O5IA 4IILA 1OXKB 3QEHB 3KOOA 3OPYI 2PR4H 4M7RA 4E15A 4MAZA 2QRGA 2ITDA 3RPEA 1GUDA 4YY3B 1EXUB 1ZD2P 1EU1A 2QQLH 2GSIA 2JWYA 3FAKA 3TFKD 3F73A 3MCLL 5IQMA 3ORHA 3G9UA 2N01B 2QLYA 3G17A 3SIXA 4WIAA 4AROA 3RWEB 1DXHA 2DR3A 2XZTA 1SYSA 4LVHC 1E30A 3WFCH 3VV2A 4P5MB 4B3HA 3H86A 2VAPA 4L50A 4BV3A 1BOGA 3P4MB 3BICA 3K9CA 3RY4A 1A4AA 1Z4MA 3T1HB 3P9ZA 2TSBA 1OW3B 4XVHA 3HCEA 4FYHA 3JAMA 1BEZA 5DF0A 4OD2A 5KX5B 4KO7A 4DA8A 1X1EA 3Q5EA 3FTCA 3ZW3A 2F64A 3UMNA 3HIZA 4GOSA 3UFBA 4FFZH 3ZD7A 4KOAA 3ZD9A 5CHNB 2AJCA 4AZTA 3UB3A 3DX1A 1A0QH 3HZKA 1LJ8A 3TO4B 4HC4A 3QYMA 4LDAA 3T6WA 3KS0H 2R1XA 3OQVA 2F54E 1DX6A 5GONA 1CZ8L 1UKAA 2ZIFA 3EIQA 3INNA 2AN3A 4GSRA 3ROEA 5GS0C 1SXHA 5IASA 1WOMA 1AGBB 1GQYA 4IKKA 1Q0UA 3ROLB 3FGZA 4A7UA 5D70H 4P3CH 3HSKA 4J5VA 3ELBA 3OBIA 1W9MA 4I1IA 1SN2A 2ERXA 2DBJA 4PGMA 1N1GA 4CMJA 1ZKMA 5F7OA 5BSVA 1CGYA 2LU5A 4C0HA 3ECVA 3MNWA 2N47A 5AVQA 2XYQA 1T3HA 2B8OT 5JMOC 1IPEA 1REIA 1C5CL 2R8EA 5FO1A 3SDXA 3S2GA 3L7FA 3ZK9A 2IEDA 4JS7A 4H20L 1TUEA 1XFDA 2CIKB 1XTIA 1OJLA 3BRWD 5LGKA 4HBQA 4IBZA 2HCBA 2B1AH 4FS0A 3OQJA 4PAMA 1UZ8A 2IPKA 4GW1A 3WNZA 2LUOA 3WJ7A 3FQXB 2HMSA 1JBQA 3F5WB 3W8EA 4PTLA 3ARTA 2B94A 2UY6B 4C83B 3BDYH 1MD9A 4JZKA 2JARA 3OSZA 4UT6H 2OG1A 4MGEA 3USES 4NFSA 5EBGA 2JFXA 4F37F 4GFXA 1NHWA 3NN8A 2YLKA 1TO4A 5ERXA 5DUBA 2OGTA 2JIXD 5BZDA 5K59E 2O7NA 5HILA 1B90A 4UHFA 2Y1WA 2E46A 1EV2E 5GRYA 3ERXA 3CX3A 4J03A 2QSUA 4QTFA 2PK3A 3O3NB 5JEEA 1EFAA 1KOFA 5IBLC 4GLOA 3UCEA 1FLRL 5FNZA 4PCUA 4WW1B 4MYUA 5B3AA 5AOCA 1KDTA 1N6LA 3H56A 1P9OA 4X8OA 4I4TF 3SSOA 1E6OH 4OL9A 1CN4A 1ADBA 2R1ZA 3SODB 4V1DA 4KEAA 1RE1A 2Z4SA 2P79A 4MW5A 4APQD 4UM9D 4XMTA 1K5NA 2CLLB 3TLEA 3KJ4C 1XRNA 1Y0LA 5IJ9B 1NWPA 3RTCA 1TKCA 4GWKA 1L0PA 3GBNH 3AVEA 1CZUA 2ZCLL 3RE0A 4GC5A 5J2TA 5FOUA 4JJ4A 2IEAA 3Q3VA 5FGSA 4OF4A 4GXVH 1ECZA 2IUUA 1U0BB 4DQDA 1PJ2A 4GRWE 3K53A 2C59A 3MGTA 3HCWA 4TRPL 4N8VA 5TF1H 1SQFA 2J4CA 4V0KA 1N68A 4TVBA 2ZYSA 3HP4A 5DSZA 3GR6A 4Q1DA 3RL2B 3E81A 3T5TA 4UQ3A 4NEQA 4D2NA 1H9VA 1WKVA 4J8QA 2QROA 2YWEA 4M1DH 4BNIA 1WIWA 2OYKA 1VCIA 4Z7NB 3DIFA 4NZ8A 5IBCA 3D3VA 3RVVC 1TQBC 4B6GA 3IEVA 2FEDD 2G07A 3BUSA 4ZQGA 4BQQA 2NT3A 3PFNA 4JHWL 1ETZB 2A9QA 4RKRA 3VR1A 2UVPB 1CUBA 2UZ3A 2PUGA 2VWHA 4KIWA 2L04A 4A16A 4C08A 2CIIA 3HMKA 1EXHA 3L2MA 4W99A 3U19A 2FN3A 1VADA 4TX1A 2Q86B 1HL8A 4MXWH 1JAXA 4B6OA 2HMVA 2GC4C 5BQOA 4QGHA 4TYMA 2WXHA 2JFQA 2KI5A 4Q4EA 4FJ1A 4FMCB 1U1DA 4G72B 3L3HB 2F08A 4XNDA 4XRRA 1CZLA 3EGXA 1EVLA 2CE7A 3N5KA 2NPLX 3RYFB 1W36C 1K27A 2L0XA 3S37X 1HX7A 3WJMA 3ROOB 3B85A 4OAWB 1U4SA 3RKSA 3AR8A 4J3OD 4UUOA 1TIBA 5FBRB 2CGZA 5HY9B 2AOTB 3TGXA 3BMCB 4NBSA 2F1OA 4U1IB 2FLBT 3NWBA 4W9GC 5GRVL 1X7ZB 3BD5A 4D8YA 1T26A 1W5AA 1FAKT 5C97A 3CQFA 4P5KB 3LT5A 2CKBA 2JRLA 3AR2A 3ONFA 3PC4A 1G3UA 2X4RB 2OVFA 4URTB 5J7CC 1BW8A 3E05A 4F24A 3IERA 4OJFL 1Q3HA 1OCWL 2X4PA 3H5IA 3KPQB 2G67A 3WBJA 2V4LA 2QLVB 1SCQA 3VRHA 1R5WA 4JLMA 5E99L 4XVCA 4IDLA 1AQKL 1BVNT 4WEMB 1T0UA 2J55A 3SXPA 2EFEB 3I01M 1ZZEA 2GPBA 4MKRA 5JPMB 1UCFA 2ZIXA 1L8OA 5KSBA 3CLEL 3KV3O 1MAAA 2NZUG 1S8FA 1U4FA 4RMJA 1W85A 1N5IA 4B95C 1KNOB 5HX7A 2WXJA 1MFAL 2F1AA 1TW2A 3Q8LA 3SBWC 2EXYC 5D5QA 3ZJUA 3KJZA 3SDSA 5J43A 2QLMA 4YMPA 4FFYH 1HYQA 4NX0A 4B83A 4JLAA 2DY1A 2AZAA 1TZIB 2WYTA 1H19A 5I17B 1D6VH 5I82A 3LNDA 3N87A 2PYEB 3HYCA 1UDCA 4BO5A 1Z5OA 3HBGA 2FGWH 3WHLA 2ZW9A 4ORGB 2J1XA 3EIFA 4IKEA 3E22A 1ZWIA 3D6AA 3INUH 4IVNA 1VESA 5E2WH 3DGFC 1TTFA 1LVHA 4Y8VA 3NH6A 4A27A 5FCDA 2QHRH 3SE9L 1XCQA 4RHUA 3DVIA 3EVBA 3QIWC 3HE7B 4H8WC 1DVXA 4JUAA 5E1AA 1RW4A 1C5KA 1KTVA 4QECA 2ZXUA 1DEHA 2GERA 4R5TA 4GKLA 1SCAA 1MLCB 3PYMA 3CFKA 5LGJA 4EIZC 3AUFA 1V7PC 2XE8A 4RD4A 5C0AD 2ZRGA 3VPHA 1O9GA 4E33A 3D4CA 2H51A 2JK1A 2OV2A 1QQAA 3QPKA 1OC2A 1QIHA 3QX8A 4PGZA 1JGEA 3WB2A 1CTQA 1BQ3A 2QWXA 1HHGB 1E3ZA 2XV3A 3VXOB 5IHPA 4MXQC 2GN4A 2EC9U 2JIZD 4ZVNA 4U6YB 3H2IA 3QDMB 4LXXA 2GK7A 1U8LB 5LOVA 1DC7A 2Q7NA 4HZAA 3L7DA 1XZ0A 2W2OA 2JFFA 2WXGA 1YS4A 1HRKA 4FGJA 5T5FA 2YEZB 3PUCA 3NUZA 4AQ8C 2M83A 1G9MC 3H11B 1KJ2L 4WI1A 4Y9FA 5CILL 2PAFA 4JFFE 3GC6A 1H8HD 2QJOA 4MUHA 1F8XA 2DFLA 1SD1A 1LDMA 3JQAD 4IJ5A 1CSEE 1MR3F 3HJAA 3QQXA 2ODBA 2OC9A 4C1BA 2XZQH 1JHXA 1E2JA 1T1RA 2PWGA 3MINB 1AZLA 1P45A 2WBKA 2GHIA 1A9TA 1QDLB 5L7XH 4JNCA 4BCCA 1TVEA 3WFEH 5I26A 4U7KA 1NSNL 4G5FA 4R1UA 3BD3A 2R11A 3UPUA 1UFUA 1Z4JA 3QQ3A 4C4UA 3C15C 2A9BA 4WWID 2TMKA 2NNFA 3OUZA 4P05A 1MREH 5HFAA 4RISL 3FCBA 1TB4A 4B3RB 3V32A 3DDNA 1F4YH 4GMTH 2R8RA 1Z8HA 1HILB 3S36X 5DJ0B 3C8UA 5FYJE 1OLOA 1TA9A 4C2AA 4LCCC 1KORA 1TQCB 5EZYB 4L3EE 2ZJOA 1F3DH 1GOFA 1U2EA 3GJEA 3H42L 2AXFA 2I65A 2X0KA 3I4FA 1HFWA 1U1FA 4UAJA 4ZMZA 4P5SA 4PCAA 1D6MA 1T21B 3JQEA 4LEEA 4KAQH 1P9WA 3WIFA 4ILDA 2PYEE 2VDNL 4BIIA 1ZD4A 1AXTL 3CLKA 3BAJA 1CE6B 3L3JB 3KLAB 3UAFA 3I5YA 3ZLQC 3ES9A 3DLTA 3L4SO 5ACZA 2PR2A 3DK0A 1ORIA 2DBRA 3CFTA 1EI9A 5TB5A 2BFDA 2OMBA 2YOAA 5B1SA 2ZOLB 4QRRD 2MJLA 4N76A 1BX1A 4K9EC 1OAUH 1CXFA 3K7EA 1GGBL 4UEQA 4YALA 2VDMB 3TBTA 3QSKB 5CD3A 4LMBA 4Y9RA 2DJMA 1L7TL 4GQBA 2JI8A 3QYPA 4NCXA 4CSPA 1EHLL 3T4EA 1DTEA 4BIKA 3HHRB 5A5FA 2B16A 1XGZA 4JRYB 1S5HA 3PWUB 4PRHD 1GH7A 1OKKD 1KIPB 4L4XA 5D1XA 3IXTB 5K69A 3HS0B 3ZX4A 4RS3A 4MMXB 1W0VA 4YP9A 3OSVA 1U94A 4RIEA 4EHIA 3WDHA 4NHOA 4LBYA 4KMTL 3CLUD 2HQ1A 1MGOA 4AZUA 4FJZA 3HKDB 4TL8A 3GELA 2FF7A 4FGSA 2ZWOA 4Y2NA 1E8MA 3E2IA 1JYEA 1SDDA 5DO2C 3B7SA 1BH6A 4TXVB 3KOMA 1YCSA 3EGSA 2AK2A 4NBKA 2OMVB 3DX8B 2NY3B 2YARA 5E08L 2YXNA 1UB6A 2ZKLA 2HMAA 2WIAA 3DVGA 3WZLA 4PG2A 3QXCA 3JD2A 3F4BA 2OCAA 3GVXA 1II8A 1E1CB 2PLNA 1TZAA 1LL1A 4POOA 4U9IS 4EG7A 4M1OA 3RYHA 1YBFA 5ENVA 3GSXA 2OAAA 1MZPA 1SBYA 5C0JB 3B13B 2CUNA 3HB9A 2VWPA 2XH8A 5IBUB 1VIYA 1WUZA 3X1EA 4GWGA 1PKOA 5I6LA 1NC2D 1IN8A 3QLUA 3T7IA 4MV7A 2WKWA 2V5TA 5KANI 2O57A 5CRIA 2XCTB 4I1NB 1XA0A 1S8AA 2MYNA 3IQIX 5EE1A 3QJHB 4G9FA 4ZRMA 3OCWA 1GADO 4NV3A 1SEVA 3EG9B 2ZJBA 3QENA 4HMOA 1QKKA 3CEMA 2V0CA 3CE6A 4YQFA 1M6VA 1XVIA 3JQCA 2ZQZA 3QUKA 2IPTL 5EHFA 1NUQA 1U9JA 4JQZA 5ER9A 4GUCA 4P2AA 3AERB 3AXIA 4CI0B 2PH7A 2C1ZA 5EU7E 8CGTA 2GN9A 4HAOA 5JOPD 1J70A 3A6ZA 2YR3A 3LXBA 2X2YA 2IDJA 5DYTA 1BZ8A 2BP5M 1IZKA 3QO1B 2H2SC 4LEIA 4F71A 3WYDA 2BSRB 4JU9A 3ZKNC 2EWMA 3RRBA 3L3OA 4B0PA 3GJ6A 4PTTB 4MV6A 4M0DA 3MBXH 4HCIA 1GPUA 2Q62A 1EHAA 1VKOA 3G5TA 2O30A 4F1SA 1GOHA 3V6LA 1CEYA 5ISZA 3I6QA 1MF2L 3HZMB 5EU4B 2OBGA 4K5MA 5FX3A 1E9VA 1ZN9A 4BVKA 4JRYE 4OQTA 3OGCB 1T24A 2VHUA 2IBTA 3OO1A 4QKQA 2RG1A 4RD0A 3CZGA 1JR2A 2L82A 2VXVH 3UWSA 2YQ5A 3MRQA 3QEQD 1Y5RA 3JWIA 2D4HA 1ZV5A 2BGJA 4BZ2L 4YUEL 3CZFB 3LECA 2R1TB 1WMEA 2J3QA 3IAM1 3ZKAA 2RMNA 1X13A 4GRMB 1L4MA 1OP9A 5DULA 1KXZA 2UX7A 4KB5A 3MN8A 2QTCA 5J5EA 2QJDA 1DVFD 3HUJA 4J1NA 5JQGA 4FNQA 1R4NA 4JOBA 4RO0A 4XMLH 5A7GA 1V16B 4C22A 3X1NA 1YY8B 1FUEA 1EG7A 2XN0A 2VP3A 1Y8CA 1KOLA 4ZMYA 2YHSA 2OCPA 5BRPA 3VZPA 4OLBA 1YB2A 2QTHA 5SV2A 2GK2A 1KE1A 5C0EB 3WQQA 1VLHA 2ZSAA 1M8GA 1CE8A 2GFQA 3MTRA 2Q4RA 3TW0A 5AVRB 1KJIA 4I9WE 5ID0A 2DG2A 1YGPA 3MKKA 2XW6A 1MRNA 2OQVA 4GVXA 5EWLA 3THMH 3HNSL 4ZEOA 1CVIA 2ZWYA 3KOZA 4C6HA 1RYFA 2YD3A 2JIXB 4OHYA 4DP5X 2A6DB 4FD0A 5DD0L 3S2YA 5GGVL 1RZJH 2VJXA 4P2RA 3ZW8A 3QORD 4TZKA 4ZPJA 1RZRD 3L3IB 1X7TA 3B9RA 1XMXA 4P3YA 1JZFA 3QMWA 5PNTA 4DILA 3LDHA 2WWVD 4IOSD 1PJAA 2GYVA 5T33L 3VRJA 4XM2A 3V7AE 1AO3A 3VV3A 4APQB 4UM9B 3ZY5A 4TYYA 1J8VA 1YVEI 4OFIA 4I7ZC 4Q34A 3A9SA 1KOGA 3VXUD 2V98A 1M2JA 4IG9A 2GCNA 3QG6A 3Q3EA 3KSRA 5IMMA 4MRMA 2CYAA 2L42A 5ICXA 4Q37A 1CYEA 1XGUB 2Q7YB 4P7FA 4A39A 2WVGA 4G1BA 2HA7A 4DY6A 5E5LA 3EDYA 2DT5A 2FFRA 1IEWA 4O51A 2N1KA 3JVFC 4BFFA 1K68A 3WKCA 2G2RB 2OV4A 4I0CC 2R44A 2YYSA 1XB8A 3KMDA 4C43A 1X19A 4N2BA 2HKFH 4RFSB 1OFVA 4IIGA 1TTPB 1BO6A 4FNAA 4XWOA 3CZSA 3FQWA 1ORRA 1QMUA 3PS6A 3UHOA 4MO2A 4MNQA 1G9NL 3K4AA 4N2AA 1N8SA 4C7JA 1F2TA 4RIIA 3KPNA 3EXG2 2DETA 2VBIA 4RETA 3TEMA 4AX3A 1UXWA 4FINA 4XVTL 4NIYE 4QHLA 4R6UA 3ZHNA 1L4FA 4B71A 3FSAA 4X9YA 1VI5A 3ESCA 3SYQA 4HRVA 4RQTA 3AW5A 5C0FA 3NZHL 3SE8L 2CVFA 4O02L 1SVZA 3LUKA 4UTRA 5BRQA 2DQGL 4PCSA 2R1UA 4JFRA 3OFND 2R8PA 3PNQA 4F7TB 4FFLA 2D59A 1TJMA 2E9WA 2C3UA 1LKZA 1FVDA 4RGMC 4N5IX 1BAPA 3PDIA 4NXMB 4MZ3A 1YQGA 3MRJB 2RAPA 3ECWA 3VFNB 1XDWA 3ZIUA 1BRTA 4J1TC 5JSQA 1SN7A 4ZVMA 4Y5XB 4MDJA 4TNEA 4XB2A 4UM8A 2JSFA 2P5WD 3R7RA 2BSXA 2OMNA 4JC4A 2RGNA 5DQDL 4PJCF 4QOGA 4NZNA 3CCFA 3KHUA 3M1OA 4OGLA 1XQ6A 3BGWA 3QAQA 2UZ1B 5EFIB 5CEYB 2R7NA 4A0FA 4JC0A 4Q47A 3WA7A 3GG9A 2VIIA 1I7PA 2XZDA 4F9GA 4MI9A 2P40A 3GFTA 2DWTA 5IB4A 3JQ7B 3C16C 3DMPA 3QXUA 5ICSA 5BSWA 4WI3A 2QTMA 1ABEA 2FKNA 5C18A 1FA9A 5BNIA 2HK6A 2FD6L 2C1PA 2CR0A 4G5ZL 5GRWA 4I6EA 2P9CA 1WH0A 4M6OL 3VSEA 3VU8A 4Y6QA 1B2RA 4QCIB 5MN5A 4NUGL 1ZLSL 3T3EA 1S7SA 3E9EA 4NS1A 3ED1A 1SOUA 3JRNA 3BWXA 2VGLM 2JLSA 1A7RL 3LBIA 1IXKA 4KLNA 4DEVA 2E8ZA 2COKA 4OUDB 3TTTA 5GRUL 1GLVA 2EKJA 5AVWB 2CHXA 1L4EA 4IBTA 1BFSA 1EJOL 4IOMA 2EVGA 3RS8A 2BFCB 4JT9A 2XI4A 4YAGA 4PH8A 4TM8A 3R74A 1BG9A 4FYPA 1PL3A 1H9DA 1YOVA 5IC4A 2ALJA 1U3VA 3J07A 5KQGA 3BZ4A 2CSUA 3I62A 1P1BA 3QVGA 3UFIA 4HJ0C 4OLWL 1EK2A 3SQRA 2LVCA 1VKXB 3BGMB 3QQDA 4EY7A 1H5BA 4P3WA 2ZULA 4NC1E 5CGMA 4B4VA 1PZ5A 1RUKL 5JDCC 5C0AB 3KM2A 3OZLA 3S37H 4S0XA 4BHUA 4YNYB 2YV1A 1EQWA 3S5JA 1K4CA 4TF4A 2F1RA 3RKDD 1T8PA 3PGKA 4MVYA 5BUAA 1BX2B 4ETNA 1OY1A 3NBFA 1B0UA 2BC9A 1KEGH 1U6AL 3NRPA 5GGUB 1JR4A 5E00A 3T3MB 5BQ7A 2PGAA 4JHAL 1DN2A 4J3SA 3KZCA 3W3ZB 3IB4A 1B4LA 4JDTH 4MR9A 2NY4D 2F9BT 3OM3B 5D85A 2DWXA 5BO1H 3EJQA 4GGPA 4OCYH 3HPJB 4GO6B 1MIMH 4L37B 1V3QE 4G5AA 3K3PA 5LIRA 5JCPA 1FMTA 3PCTA 1CGXA 1XZJA 2P9ZA 3LB6C 4KRFA 2YJTD 1N6KA 3V4VH 3EZ8A 3BXNA 4NBYB 4XN4A 3JQAB 4NI6A 1U8MB 5DM4A 2VF4X 5CZKA 4MB4A 1USVA 4H0NA 2G70A 4X7PA 2FPWA 4PQEA 3ADKA 1OI3A 2J9XB 3IQDB 4M93B 4IIQB 3LZCA 4FGWA 3B1JA 3ABRB 1A7JA 1VL0A 3IDUA 1BXGA 4NO3A 2DOCA 3K32A 3HRKA 3AHCA 1OWLA 4KIUA 4PYGA 1FDRA 4PBXA 2V3EA 2O6CA 5AW6B 5AD1A 5EIWA 1Z38A 5I15L 2J5BA 2FYTA 2C31A 2YN5A 1JG3A 3K3QA 1K6MA 4Z99A 1OVZA 5BNZA 3OJXA 2GNOA 3P4UA 5IDWA 3B3BA 4B9PA 1OXUA 2PW1A 3D2BA 1E2HA 5CG1A 2NCEA 2P8MA 2R1TA 1KO4A 3QZWB 1H23A 3DVLA 2D4AA 2LFGA 4RE5A 4YHPB 4NZ9A 1TZHB 3TO4C 4B4KA 4WY5A 1DBJH 3S4YA 4C55A 1NPDA 1DVZA 1HSAB 2H6UA 2PX4A 5KYVA 4G41A 3QZNA 3B9BA 3CPSA 4EZEA 1MZVA 4YRTA 4IGAA 5EPMA 1IN1A 1DJMA 2LW7A 2R51A 4TT3A 1G9SA 2OFXA 4HJ1A 3JQGA 1DBML 5KJEA 1H2AS 1IM2A 1S1MA 2YIDA 1KFGA 4BLTA 3F78A 1SR8A 4QRRB 3CRNA 2F8MA 5FDWB 3PNWB 4LFAB 3EJTA 1AC6A 3MCVA 2BSED 1GLGA 3OOSA 2A6IB 4QPZA 2QR2A 6Q21A 1UK9A 2RQ8A 1ACXA 2BUCA 5FB8A 1Z15A 1V5GA 2HRPL 2R0ZH 1JR6A 4LSUH 1C0LA 1ZD9A 3Q8CA 4UFPA 1F8FA 1KVRA 2MTBA 4FLSA 5LUBA 1SG0A 4MQXD 2CD9A 5IAAA 5EDXA 5DNEA 5C0AE 3HA2A 2EJVA 2Y1GA 2COUA 2P80D 2ENUA 3VC3A 1G8PA 3OZFA 4PRHB 3MBWB 3EYAA 4MWEA 2PO6A 4AENA 2XRYA 4NQQA 4KTDL 5LB2A 2HWXA 3G0DA 3SYPA 1DQQA 3V97A 1AGFB 3NIDB 3IUPA 5JHDE 3PSHA 3NVDA 1UM6L 1MHHA 3S35X 4JDUA 3GSRA 5EORH 3VXRE 1DO5A 4W1PA 3PK0A 5FPQA 1VGKB 5DASA 1U42A 3LYLA 1EJ6A 3CHPA 4LPUA 2HMIC 4RYDA 4DJFC 1JFQL 3I9V6 5TQ0H 1JGUH 1HLGA 2F67A 4RACA 4UT9L 5F1IB 1XMQB 4EY4A 1K8DA 1N1EA 1OI4A 3WWZA 2ADJB 3NFSH 3ASWA 3S36H 1DEEB 3HWWA 4ACAA 2F7QA 3BVUA 4DO6A 1J97A 1CUZA 5I8CB 3UMGA 6AT1A 4FNLL 3HG4A 2VQSA 4UINL 2CJ3A 4YRMA 4MDIA 2NW3A 3OLCX 1CGTA 1FL6A 1Z74A 3NYKA 3NVQA 3T5WA 4E41D 1DVUA 4A7QA 1TGVA 1BVNP 4MMZB 2MINB 1A7AA 5DRYA 1FZKB 3OQMA 1JHVA 4M6WA 1OGAE 1KHTA 1U8IA 1FK8A 3CRQA 3VGAB 3D3WA 2XMBA 4H7VA 3Q40A 2PKDA 1NC2B 2I1WA 1YQWA 2R59A 3QELA 2IWRA 2COVD 1U8OA 4BKSC 4UJ5A 5AYUH 4Z7UA 2O07A 2H6PA 4ZAFA 4OZIB 3DHVA 4X1YA 5I7EA 1JLLA 1WVMA 1GU0A 1B6SA 1DVSA 3I9IA 2HTEA 3FO2B 3RWJA 4KHTL 2H8PA 2ZPKH 4F7PB 1K3FA 3DFKA 3G2PA 1HLPA 4JR1A 2W58A 2PUDA 1DQRA 3QLUC 3BPSA 2VDPL 1KMCA 1GL3A 3CY6A 1MAJA 1YB1A 3NK4A 2DM2A 4NYIR 4AP5A 5IJ0B 4C6SA 1YEFH 3ZE6A 4IDHA 2OMTB 2QX7A 2AJVH 4QO1B 1QRKA 4YAQA 2HRGA 4FEAA 1BJTA 1Z4QA 5KAPA 4D6YA 1Q7EA 4FULA 2OQRA 2ITCA 4HAWA 4RMIA 4HKXB 4TMKA 10MHA 1UIMA 4LEOB 1T6YA 5GS2D 3MWYW 1PT9A 3LMJL 5DVPA 2W48A 5JW3L 2XMDA 1T2VA 1ANKA 1H8LA 4YC2B 4OQQA 1G6RA 3U82B 4N7JA 4HPOH 1U7HA 3CE1A 3TNNA 2GY5A 2BJWA 3CFJB 4PRHE 4M1GH 3GINA 1IEBA 4DKEH 1FVHA 2ADFH 1G20E 4GQ9L 4HRXA 2VOTA 3WNBA 1E2BA 3NIDE 3QEQB 3FB5A 3LIZH 1NAHA 1JTPA 3IB3A 3LUDA 3TW4A 4Y2DA 1RJCA 4R84A 3GPCA 1YYML 2FEEL 1ZSNA 1DZ3A 2C99A 3APFA 4J6EA 5T64A 1BMTA 1ITCA 1GTZA 1UAYA 3H7AA 4DC0A 5IULC 3G79A 4WU5B 2EZ0D 3HCFA 3D6JA 5DJAA 4Z5RA 2OTCA 4PJHE 5KWJA 4ZUWB 1NR7A 3CW8X 3OEWA 1DVFB 4XHJC 3H4VA 4MVBC 4R81A 3BWYA 1S7CA 4HGQA 5JZSA 3EOAB 3A3YB 4N1CA 1KXQE 4TMZA 3TPCA 1YPZE 4HAZA 3PWLA 1L5VA 1YY9D 3IUYA 3C6EA 1YTLA 2YMQA 1P80A 4E13A 2FN9A 5CB8A 5FS5A 5CINL 2YL2A 4UDUA 3HKFA 4X20B 2RGRA 3GM8A 1EGQA 1QR1B 2JQMA 3O9WD 4GUOA 3GQBA 4BNGA 5K8JB 2FPXA 3VVVA 3B20A 2CG9X 3EB9A 2O0HA 1IG3A 2Y4OA 5CBPB 5MGBA 4ZXBA 1EHKB 2A38A 1NLZA 4AV5A 3K9GA 4TLLB 6REQB 1UD2A 3G04B 4AG3A 1A5TA 1X5KA 2QM7A 4TM7A 1KB5H 5F88A 1SU4A 5A43C 1AHKA 1Q1PA 5A2JH 1GPKA 1XZNA 1GCUA 1UOQA 1JNXX 3KPUA 3EVFA 4W82A 4OZIE 2QDKA 2J8OA 1R0AH 4S1SH 2VTFA 3OLXA 1L5ZA 2IFFL 3QORB 1PR1A 2BFPA 3P1JA 3REOA 3DV9A 4DHLA 3B1XA 5GJSH 1YNKH 3HE7C 5AW7B 1H1TA 2BEVA 4UANA 3I9OA 1P2CB 1BFVH 5F51A 2W42A 3IMWA 1GITA 2J7PD 1RPKA 3P73B 3I2CL 2WHXA 5JCJA 3A0RB 3N91A 2YC2C 3QVJA 2IS1A 2R9HD 5TK4A 3VXUB 2CF6A 1WXHA 4S1DD 3CXDL 1PPIA 2ZCUA 3Q5GA 3Q7SA 2LV4A 5BR4A 3RNQB 4KGJA 3DGGB 3AFNA 5LWYH 4LUCA 4EDFA 5JG7A 3BL5A 3CSGA 1KGXA 2HSEA 2I6SA 2FCAA 4G0QA 1MHPA 3THYA 4BK5A 1JYSA 4Y9SA 4YT2A 2PYIA 1RPJA 1XBTA 4L8YA 3ZY3A 5K05A 3TCNA 1NYQA 1BZEA 4CVXA 4B4WA 4PWFA 3CZJA 2JBAA 4OU3A 4DDHA 1REQB 1WXGA 3DYVA 1KBWA 3DMRA 4Q9CA 4RTKA 2IYTA 2IH8A 4X83A 2X6BA 1ZL0A 2KJQA 1GG9A 1KTJA 3PUKA 3WMFA 2PUHA 2IW3A 4OQFA 2VLRB 1YIDA 5MHTA 2FUEA 2WOYA 2ALAA 1FUYB 3G2JA 3ZV6A 4X97A 4HQLA 3QULB 4KXXA 1TCAA 2V37A 1JU9A 2MMGA 4HDNA 1SCIA 3UGEA 4YXLH 4KC0A 5CAEA 1EUQA 4KPFC 4JPQA 3QE5A 3E35A 2QY9A 2PVCA 2HJVA 4Z3IA 3KJQA 1MX9A 3FETA 3JV6A 2DYSB 2IV8A 2YCBA 4XWOC 5FLXA 1C9YA 3TBBA 1OF2A 2HSIA 4JY4A 1UZUA 4NOKA 5CJOL 1T0OA 4M89A 3IFOB 2JRCA 3VDRA 2FP4A 1OANA 3R4VA 2IANE 5CDUA 1G21A 3PR1A 4HUKB 3ZHKA 1N6HA 2OYCA 1DNPA 4OZ4A 1MVYA 4IS6B 4DUGA 4JKIA 4PCYA 1VEMA 5DF1A 4DW2H 1RZ8A 4N65A 4NNXA 5E4JA 5GZ1A 1E3WA 3VNYA 1R1DA 2P5WB 3RC1A 3TW8A 1NCAL 3PX2A 2EE9A 1O96A 4FM9A 1YE3A 5KVGH 3K92A 4AW7A 4XE5A 4R7NB 1H4QA 2DYPD 4C4BA 4ZGWA 4A23A 5IT2H 4YBQD 2WB7A 2F1JA 3KR3L 2BSSA 4YPGB 2JFPA 5ALKA 1NOFA 4JL5A 3IXAA 2VRWA 3PNYA 3MRRB 3H1AA 3LWDA 4C8XA 5C46F 2RGNC 3SYRA 3EXIA 3FOMB 2OPBA 4AIZB 2W60B 1C12A 2Y07H 5LDGA 2W2XA 2GIYA 4Y5YA 1MFMA 2JJ2D 1BMDA 4M38A 2HMTA 1YEGL 2FQDA 2PKCA 3N58A 1NBCA 3RRQA 5C3LD 3NC1C 4RVOA 4TOYL 2A9FA 1OHHA 2O72A 5CNIA 2EKLA 1XMSA 3K09C 1ZJ6A 4LECA 2WD7A 3TECE 5FDYA 2Q6WA 3WIDA 5C71A 3CHYA 3IT8D 3HS0C 3B9KD 1ND0A 4I1VA 1UWEH 1GAFH 4MMXC 3RFXA 4BO3A 5AKEA 2Q3FA 2HPZA 1GT91 3UBTA 1JL8A 1A2KC 4IRZA 1YRAA 5FKAB 2O54A 1SVIA 3STXA 1OAZH 5DC4B 1A7PL 3VACA 2CGRH 3CFBA 2ZB8A 4ZBJA 2BXYA 2CFIA 1ZLVH 4II2A 1S78C 4F1JA 4MQFB 1NPJA 1JVBA 2OL3B 5EJ5A 2EDOA 4DIEA 3EDQA 2QHXA 3BUYA 5F1SA 3ZQ9A 3DV0B 3E9DA 3GVIA 5A3QA 4M8QB 2VLRE 2ZX7A 2AMLA 5AK6A 5ANHA 3NFNB 3UC9A 1OIWA 3WEXB 3KH3A 3BAEH 2DR2A 2D3NA 1MI5A 5TE4L 2PWYA 1ZJ4A 4QDTA 3DD1A 4P6VF 1UADC 3NOIA 1X5XA 3OB8A 4YR7A 1LPBB 2F54D 1M1YA 2QGEA 4XPFL 3UMRA 2EIKB 1H5BC 4HDMA 3G85A 2NY4B 3T61A 4CI9A 4CMHB 4Q7MB 4X3OA 1I1CA 1LP9F 4IIUA 2WFZA 4FJYA 1JK8A 3HCVB 4BWFB 1XTUA 4OHVA 1IC4L 3GBLA 3L7EB 5DHSA 4YT5A 1PYWB 7GPBA 3GZPA 1GIAA 4M46A 4DGIL 3B7GA 5I0VA 1WIUA 4XMPH 3SYAA 2RK4A 4JFPA 4PGCA 4Z3GA 4IFEA 2H4EA 1C9SA 1E3IA 2YGPA 2DQTL 3R06B 5I23A 4AL8C 1WCBB 3RFZA 5E2VL 3FT2B 1Q83A 1HFEL 2VR5A 4NQZA 4KKVA 3TFKC 4LEOA 4DVRL 4K3JH 2WXIA 5K9OA 2BWJA 1GAWA 5DE3A 4CBZA 3JQ8A 2R68A 2QR0B 4GPBA 3UYPA 2AMGA 4OFWA 3DYMA 1X5GA 5I1JL 3EJZC 4OW6A 2ESVA 2XNAA 5BN1A 2H26B 5I19L 3SQLA 5JNTA 3RYMA 4G37A 2VH5L 3P2OA 2FTKE 1CEQA 3EPLA 5LWHA 3BPCB 2E5FA 2PRIA 3ILQD 4BMSA 4KZEL 5H3LA 2DLNA 3L7JA 1DSSG 1BAFL 1YN7A 3U3ZA 4YDSA 2WK1A 5E95B 2YQGA 4RA6B 5BR1A 5EHGA 4NECA 4JROA 5AR1A 4ZUSB 1F5WA 3RJ5A 4HLUA 4BP8A 2X3AA 1ZXXA 5C2BH 3GXFA 5I9BA 1POWA 3FTVA 3TEWA 3BZEB 1A2OA 4I3GA 2QSZA 1WMFA 2OMZA 1FFPB 1TQTA 2R7LA 3GMLB 3TPUA 4Y6SA 1IGMH 5FCSH 3MJ7B 2DU8A 5JHGB 5TQ2B 1DQJA 3IEAA 3R7FA 3LS5H 5FO8A 3S7GA 2WMYA 4P46D 4HXFB 2R2BB 3GO1L 2I3BA 4XPZA 2OYRA 2RH8A 5CR9A 5D8JH 4XPIB 2VDWA 4QJ4A 2VPZA 4L3CA 2NQ8A 3N6XA 5DK0A 1FF9A 2FX7H 4F1WA 2UUCB 1A1SA 3PX7A 5DSCA 2E6PA 2EVIA 3PDJA 4KKLC 3LZNA 2FHBA 1NEUA 1A6PA 5DT2A 1Q1NA 1FGNH 4GZ3A 4F11A 2O4UX 4PZ9A 3VGBA 4DLBA 3DUFA 4OVUA 4MASA 4EYSA 3QEMB 1G43A 1P1VA 4JHUA 3TZBA 1XGYL 1O7DC 5JMOA 4EJ1C 3SBRA 3MCKA 5JLZB 3KK0A 4PONA 1FRQA 3UZUA 5AI9A 5LB1A 1RQRA 5AW7A 3KKMA 3VD2A 4X6YA 1JILA 3HNOA 1E67A 1HEJC 5JJCA 3H75A 2ZUCA 2I3ZA 3TRFA 2X8JA 3ZC3A 5LUAA 1GGJA 3TMKA 1NMZA 3T3PF 3HBLA 1AD0A 1EFVA 4PIVA 2H3NA 3UTOA 2M1KA 1Y4ZA 3D4LA 2BHNA 2FWLB 2Z34A 3BL6A 4PFQA 1FFHA 2XVYA 4MPDA 4OJQA 2ED6A 1QB7A 3QOXA 4NBUA 5C3IA 3AJ7A 4PG4A 5IW3A 2EE0A 5JBQA 4E41B 1PQWA 3JQ9C 2FH8A 1TETH 1CTOA 1XF9A 2ECOA 3QCUH 4KYIB 5C7IO 3PX3A 5KNBD 5J59A 3BSZH 5AI6A 2PP8A 1CS0A 3HAEG 3PQ3A 3BXGA 3X3FH 1SF3A 2Q3ZA 4MVJP 1PZMA 3CZQA 1JDTA 2X5OA 4N2NA 3FCYA 3IJHA 1NA8A 1K97A 1BA2A 1XNJA 5C7OO 2Q8NA 4ARAA 1YVDA 4AUUA 5A2AA 1PLLA 1FRFS 3ILPA 3RSHA 3IMEA 1M2VA 2J07A 3AB3A 3PZBA 3FQUB 4PJBF 3JASB 4YRSA 4X0KB 2OBNA 1GSMA 2YASA 3N0WA 4JS0A 4U0QB 5AW1B 3F6IA 2J1YA 5LP6B 1G7QB 4PHCA 2PWZA 2QLJA 4BJHB 4AEIL 4JGUA 2A1WL 3VH8B 2X6RA 1W4AA 5JCZA 2FEDC 1G7HB 5IHHA 1A8SA 1GN8A 1DFGA 2NZIA 3VTFA 1HDZA 5ESDA 5DB4A 3T0GA 3HYRA 3M46A 5TPWA 3K16A 4YRAA 1AUXA 1H3UA 2P7TB 2GFHA 4QEDA 2Y06H 5JUEH 1I3OA 1W49A 3S35H 4P4UA 3OC8A 2IPMA 4J2HA 3BH9A 3H99A 4DN4L 3GP5A 1L4YA 3CRRA 3OLGA 4QO7A 3P2KA 3WO0A 1G5AA 2PSHA 2FNWA 3D4PA 2OJEA 4GUDA 3AJEA 3UHFA 4YBHA 4NDMB 5CN2A 1GZ3A 2JF0A 4Q9DA 4X61A 1MPAL 1FAIH 4JLVA 1GT6A 3RWIA 4GBGA 3TBWA 4IOIA 1H8OA 1DTUA 1W6UA 4AICA 1L0XA 5GPBA 4J3OC 1MX3A 2AX4A 3OQ3B 1VLMA 1KEWA 4URHA 1WGVA 2XVXA 4CSSA 4ABYA 1OWRM 1NUTA 2J0VA 3RYTC 3WLJA 3CG0A 3HKBA 1DC4A 3IE1A 3P1VA 4Y5XC 3A22A 4KLRA 5KSOA 1CQIB 5JVDB 4KUEA 4R2XA 1B23P 5F21B 3F2VA 4QTXA 2XPGB 4XCFH 4JHZA 3LTVA 3US0A 3ZQXA 1UK6A 1Y4SA 4CU2A 3P9MA 5KYWA 3QUSA 1MO6A 3ITDA 4HPWA 3ZHFA 2W70A 3ZGIA 1YUHA 4DRYA 1T20B 4WDIA 1E0KA 4J6IA 4CUJA 3G0BA 5F9MA 1T3LA 1V11B 3I3DA 1X1CA 1CFSB 1F4XH 1G7LA 3V48A 1RJLA 3M81A 3HRHA 2NU9A 3RUGB 1JN0A 3MUEA 3O9WB 4I9XA 5K5EA 2B08A 4HOZA 4E41E 1EZ4A 4HVAA 5K03A 3BEDA 3VJ6A 1JG9A 3V5DA 4JFFD 3UG4A 4H7JA 1S9XB 1F38A 4V0OA 1I6WA 3P0IA 3SEQA 5JA8B 4YJKA 2H31A 2XLLA 1A8UA 2VKXA 1IBCA 3KJNA 2CLFB 1P4LB 3P9KA 4HGMA 4RZKA 4XP6H 3QJXA 1OP4A 3HXLA 3F7YB 2YV3A 2ICWB 3VXQB 4U7TB 3W8RA 1INEL 4FQLL 1RXIA 3DE1X 1SEPA 3KYAA 4ZXBC 5KBKA 1KGIA 1FPTL 1OIVA 4BNDA 1D4OA 4CBPA 3ETBF 1A7UA 4IDPA 1AKRA 5HHOA 1LSSA 3TUJC 3NS7A 4RTSA 3AEXA 1HDXA 1Y7TA 2ZTUA 1WTCA 5FYJD 2R7MA 1CF4A 3ZE0B 2A0XA 1MOPA 2I25N 2WOOA 3OE1A 4E94A 4Q3AA 4OZFG 4L3ED 4M7LH 1IM3B 1OKEA 3EJJX 1SXPA 3OUUA 5EOCL 4WW2F 2GDZA 4KKAD 3AJ8A 4L08A 3GSVA 3SDDD 4KPHH 3HCVA 3ZLJA 1N3LA 4D1YA 5DHYA 5J3JA 2YV4A 2W81C 3A70A 3QIWA 1HI9A 3NP4A 2CCWA 4PIPA 2PYED 2G08A 3GRYA 3F7KA 4D45A 3VPDA 4NX2A 2YS4A 2IHUA 3FRJA 4B32A 4ZQCB 4BZPA 1IFGA 3VTAA 3X2QB 5C1MB 2PCLA 1PJBA 3SQMA 3IEPA 2UUPA 2ID9A 1PYGA 3OD1A 4JKMA 2R85A 2X58A 5JASA 5GADl 5D72L 3JARB 2YD8A 1RYEA 1WE2A 4U5QA 5EXPA 1PKEA 3V7MA 2XOKA 5EG6C 3VYOA 2B3IA 4L0DA 4XVJH 1OILA 2HN9A 3E23A 4B3SB 3Q5TA 4LGPB 5KVGE 3K9NA 3SAJA 2Y2TA 3BFXA 4GLRH 3ZE2F 4R8VA 1RZKC 1N6RA 3VX3A 2PX2A 4RELA 5ADOH 3E9MA 3QHQA 4X94A 4U1HB 1RHJA 3C45A 4UVIA 3M4ZA 4P32A 4M93C 4ZC8A 4QNNA 4HDKA 3HN8A 2X9NA 5C3TA 1UK8A 3WMGA 4TKVA 2XOXA 3HV2A 4HNGA 3GGPA 2DWUA 4GQIA 4BU1A 4OZHA 1KERA 3ECAA 5IQ9A 2IWEA 5IMLB 2IXEA 5A9SB 1Q7CA 1DEDA 4FZEH 2XA1A 1YJDL 4C07A 6LDHA 4E70A 2PWEA 4P7GA 1OV6A 3JWDC 3B12A 5FO9A 1W581 3SO3B 3RI3A 2AGJL 2NRDA 4BQNA 4G2NA 2C2MA 4BFJA 3MUGA 2I99A 2OB1A 3B1UA 4NQVA 1X87A 4M03A 1W19A 5C35A 1CC1S 3GLUA 2KM1A 1RI2A 4AO6A 1Y7HA 4TRMA 1KMHA 3K71A 2WWXA 2YK1L 1M3IA 3VYUB 2JH2A 3DVRX 2OC4A 5B53A 2PMWB 2WUBL 3D0AA 1T1XB 5HS6A 5EZQA 1OT1A 1GXSB 4YRZA 4WUUA 1KLGA 3BF7A 4OEHA 3LPAA 3DSFL 3ZS8A 1V7ML 3A6OA 2UDPA 1KCRL 1R47A 2DYPB 2HJLB 2ZSHA 3OPYB 5KHAA 2ARJA 3EFOB 4LU5H 3FY4A 1YR6A 1K72A 4NENA 4N8EA 1JL3A 5SX5H 4RV9A 2WVTA 3U60B 2EX4A 3QKWA 2CVQA 5E5UB 3ZE0E 4L5CA 4EO4A 2DBQA 2ZBGA 1SN0A 2QT0A 1QLEH 3RIXA 3F1KA 3QJUB 1S2EA 3EDDA 1OLUA 1T2AA 3G6KA 4XYLA 1FLTX 1EUCB 1UASA 1MJFA 4B46A 4BTVA 1DGQA 2LOEA 3ZKMC 1FSGA 3KLBA 4GP4B 3KLSA 4ARIA 4KK6D 4DM7A 1P72A 1B4TA 1VB5A 4H1LH 4L9LB 2C9CA 3PRYA 4YWJA 2UWEF 3B9KB 2X12A 5KEIA 2I6TA 1XNQB 4ZEVA 4PRPA 2HU5A 1FX1A 1XMJA 2EDMA 1SYVB 2XDQA 4PJ8D 5H0IA 1JUFA 4B4DA 4A6YH 4XEUA 4M00A 4Y5YC 5HGBB 2H00A 1JVLA 4YROA 1CUGA 1EWQA 2ZI3A 1XX6A 5BQ5A 5A0TA 1PZBA 4LY6A 4DT2A 3TJRA 3ZHVA 2Q76A 4P07A 3K1ZA 3CIFA 1IBLB 1P4BH 3ARVA 1RABA 2HFJA 3OXSB 1LUAA 3DEAA 1W72A 5LA6F 3VA6A 3O74A 1M7GA 1N5YH 5CB4A 5H9WA 5DJXA 3FPSA 3N6RA 2OK8A 4J0JA 2PL9A 3QBTA 2IGFH 3PUUA 2X4TB 4YAIA 5HE9A 1CFJA 2QFPA 3W2HA 1O75A 3IJPA 4OREX 1Q0RA 3IFSA 4PQXA 2M2IA 3FB7B 3EDJA 4IKIA 1RULH 4D9LH 2XD4A 2R2EA 2QL5A 1KPVA 4MCZB 4IUDS 2F54B 3VFTA 1CJTC 3ACBA 3WSWA 3IHKA 3VGAC 2D73A 1JHLL 3GRAA 4D9NA 4PF1A 4K5LA 4B6PA 4KXWA 3FUTA 3CZ4A 3KPTA 4KTVE 3N8NA 4IIFA 5IM7B 1VSVA 5IFAH 3T15A 4X8GA 4IBOA 1JGVH 2FK8A 1MCBA 1EFPA 3CVBA 1ZIXA 5EERA 1QQTA 1QH1A 4Y4HA 1U30A 2GYYA 3O4OC 1YJ5A 2EYSA 1G5RA 4X1KB 2IYUA 4R97C 1A1NA 3VKGA 3OM8A 4AQEB 5A4FS 3C39A 4C2BA 1LO4H 1NGPH 1V71A 1ZSHA 5BOVA 2NYYD 3KLLA 3EOZA 5KC8A 2HM7A 1R5IA 4JQCA 2JFGA 2BPBA 1HHKA 4MW9A 3GBVA 5EJ4A 3FKUS 3AY2A 4UEKA 5FUOL 1RXVA 3RX9A 5G1PA 1N2IA 2DMBA 3B82A 5CFRA 3GROA 3PDOA 4ABTA 1M7UA 4I9WD 2ZB7A 3KXKA 1Z5UA 3B38A 5LQKA 1II0A 2IOFA 1G17A 1DBVO 1DP4A 1DAPA 3GLQA 5A62A 3FB8A 3DI2B 2XXMB 4GLBA 3U6RB 1Q0ZA 3MUY1 3C75A 4V2BA 2JJ1D 4FGKA 5DSXA 5CCBA 5JBIA 3ZCRA 1RP8A 3ZWYA 4AM8A 2NADA 3F6RA 4YC2C 3P0VL 4YXHL 1IUNA 3BZFA 2LCQA 3C5SB 4CA4A 1JE0A 2RBEA 3IQZA 3VHXB 2V7QA 5F6IC 5DJ6A 3K1YA 4KXAA 1SVKA 4IINA 3IV7A 2J9RA 4J4PA 1BQSA 2IOIA 5DJCB 4B2YA 2ILTA 3N53A 2SICE 4KVNL 5DD1L 1ZAYA 1A6UL 5EZLB 4Q4DA 4EA9A 4P46B 1HEZB 2H4XA 1QLFB 4MA3A 2PIDA 5I7WA 3L0OA 3HJUA 3GAZA 3TSAA 4HLUC 4KUGA 2PJRA 5I7OA 1QZNA 1DVFC 5HDOA 4JLPA 5L40A 2O3JA 1A5FL 3RFRA 4YHHB 2VLLB 4GRWB 3A3KA 1XMIA 4G81A 4NLAA 4GRAA 2AQKA 2IYRA 3KYBA 4HSGA 4YJ3F 5E9JA 4BDVB 3UO1H 3SJBA 3UTCA 2HG5A 4TSCH 2B5IB 2VP2A 4FHZA 1HESA 4JBNA 4Z3OA 4N0UA 1EP2B 3L77A 2I4IA 4YAWA 2WPDA 3DVAB 3D7NA 2A5LA 4UF7C 5BSGA 3VXQA 4LCUB 1URLA 3S40A 1H3EA 3S2SA 1VYVA 2DH2A 1FUIA 4CG1A 2EQ5A 4TROA 3W39B 1NBOA 2FZVA 1U6JA 1PD6A 3M5DA 1DO6A 2IOFK 4EZKA 1XGTB 5GJTH 4XB6B 3G49A 5MI0B 3T4UA 4Z7VA 4AG4L 1KFKB 4F12A 3AU0A 5HGHB 3RGBA 2FT8A 3AETB 1V8FA 3VTTA 4U6SA 2VJYA 4IDFA 1FBIL 1QWUA 2B35A 1EFTA 2WC7A 3E7JA 2V9CA 4GUPB 4AC4A 4N68A 1V3MA 4RA0C 4KTYA 4EQ3A 3SXUB 3RSZA 2O5EA 4XOBA 3VO0A 1ZIAA 1FXSA 3ZUGA 4RAHA 2GD6A 4Z7WA 3PF9A 4JR2A 1GFIA 1M8PA 4OI9A 1NBVH 4I48A 2FLRT 4LSQH 2VAMA 3NPMA 2JLZA 4XMZA 4WERA 4BFWA 2XCIA 2P5SA 4P92A 4X0EA 3R75A 4ND4A 2LCIA 2B4AA 5GIRB 2BK8A 5I1DB 3QDHA 5ICZA 4UOZA 4NMMA 1HKLH 3HLKA 3CUYA 3RTAA 2YFHA 4RQBA 5BR7A 2VHQA 4ZI3A 4A7PA 4Y30A 5GS1B 1N5LA 1R8QA 4OXKA 2E9GA 1QE5A 4URFA 4A0GA 3L01A 1JHTA 5AVXB 1R3LA 5KNDA 1QPPA 4Q4CA 1YC2A 1IBGL 3ENQA 4IJMA 3FQ2A 2BGNA 1HMPA 1GFSA 1D5IL 1LVUA 1W76A 2PH5A 1F45A 3GF8A 1OZUA 2VW6A 2A88A 1OH7A 2RD0A 3T41A 4P57A 5H2BB 4XYMA 1P5ZB 3DWFA 4XZUA 2WU3A 3GEEA 5INTA 4NSNA 3ZTJH 2OZEA 3IELA 3EVNA 1P1JA 3BVPA 1OUMA 3HZOA 3ZY4A 1G9XA 4W1RA 3LG2A 2FETA 1ULSA 3G1WA 3RIMA 1C0KA 4EPTA 3VSUA 1PL7A 1VMIA 2J48A 4EVQA 5ITBL 2EDBA 4HZIA 2ZE0A 3KAKA 3CF4G 3G6DL 2PT7A 5P21A 1AA6A 3I4LA 3DMHA 4I77L 3QIUD 3HL4A 4DM4A 1HLDA 5BUCA 2F8SA 25C8H 2FQGA 3T3IA 5K2MA 2QUAA 2ACKA 5K1NA 1UEJA 1RYMA 2H4FA 2ZIWB 4AJWA 4D9KA 1FDSA 2RBLA 3D5TA 1G1OA 4DQOL 3H1TA 5DBHX 3L0SA 5IR1B 5CYPA 5AOVA 5B6PA 1ADQL 2KMWA 2PWDA 3GIDA 4GPVA 2R47A 1VJ1A 1EWRA 4LHUD 4M8UA 2WVVB 4BNXA 4NFBA 2BJVA 3BORA 3TI9A 3SX4A 5JAOA 5IKCB 2AR0A 4FN4A 1D5XA 2WMOB 3RGVD 3UERA 3EO0B 2AANA 1ZSDA 1GZPB 3MBED 4QHTA 1MA3A 4D8WA 2FG7C 5JFGA 4AMKH 1V7CA 2RCYA 1FZQA 1ZD1A 2ZWPA 1IDOA 1QBGA 1HI6B 3E5HA 4J7UA 3IRUA 2O93L 3G13A 1QEXA 3LF2A 5DNUA 2NXJA 2AT1A 2RC6A 4X5OA 3V79C 3BMNA 4Y19E 5KOIA 4Y7DA 1YI1A 4MHSA 1TQ8A 4NP9A 4O5LH 1RJFA 4LRNH 4XMUA