3K6SA

Structure of integrin alphaxbeta2 ectodomain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
1082
structure length
1082
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 158
structure length 1082
sequence length 1082
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k6sA03
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k6sA04
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k6sA05
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k6sA01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3k6sA02
3EFOA 3V4VA 3QA3E 2WINI 2VDPA 3TVYA 5HGJA 1MQAA 3EGDA 4Z7OA 1PD0A 4G1MA 4MMYA 5KYWB 1L5GA 1JV2A 1U8CB 2VC2A 2M32A 2XWJI 5KYXB 3Q3GE 1ZONA 4CN8A 4IHKA 3K71B 1M2VB 1QCYA 4JDUA 3ZE1B 2ODQA 4BJ3A 1IJKA 1OAKA 1MF7A 2VDQA 3TXAA 4FX5A 3TCXB 2I91A 4WJKB 1CK4A 1PCXA 5KYUB 4WK4B 1JEYB 3NIFB 1CQPA 1AUQA 3PPVA 1SQ0A 2WW8A 1IJBA 3HXOA 5KYXA 2VDKB 3GXBA 4UM8A 3F74A 3FCSB 5LN1A 4NENA 1NA5A 2VDMB 3ZE0B 1M2VA 3V4PB 5E6RB 3BN3A 4Z7NB 1FE8A 3ZE1A 4IXDA 3EH1A 1V7PC 3K72B 4MMZB 1MQ9A 4WJKA 3VI4B 1T6BY 3ZDYB 2VDRB 1JEQB 3NIFA 1LFAA 5KYUA 1DZIA 5E6UB 4Z7QA 4WFQA 4HQLA 2P26A 2I6QA 3PPWA 1XDGA 3ZDZB 1QC5B 1Q0PA 4HQKA 4O02B 3PPXA 2VDLB 5HJ2A 3EH2A 4HQFA 3FCSA 2QTVA 4MMXA 3IJEB 2NUPB 2O7NA 4IGIA 2VDMA 3BQNB 3ZE0A 3VI3B 3V4PA 4UM9B 5E6RA 4UM9D 2ODPA 4M76B 5BV8A 4Z7NA 4A0QA 3ZE2B 5E6SB 5HDBB 3K72A 4MMZA 5KYWA 3T3PB 2IUEA 2XGGA 1RD4A 4NEHB 3VI4A 4HQNA 1U8CA 4WK2B 1U0OC 5KYYB 3K6SB 5E6UA 3NIDB 2VDNB 2B2XA 3N2NA 5FFOA 1JLMA 3K71A 3NIGB 4C2BA 5FFGA 3HXQA 1PD1A 3ZDZA 1QC5A 1T0PA 1BHQ1 3EGXB 4CN9A 4DMUB 4O02A 1IDOA 2ICAA 4PN7A 4G1EB 3EFOB 1BHO1 1YVPA 1M1UA 4XW2A 3T3MB 3VI3A 3ZDXB 4UM9A 4WK4A 1RRKA 2ADFA 3EGDB 4G1MB 4MMYB 4C2AA 4IRZA 1TYEB 5E6SA 3ZE2A 3HI6A 1M1XB 1MQ8B 1PT6A 1L5GB 1AOXA 2XWBF 3T3PA 3FCUB 2VC2B 1M10A 4JX0A 2NVOA 1XUOA 2I6SA 4WK2A 2VDKA 4F1KA 3K6SA 2NUTB 3NIDA 2VDNA 1ATZA 1U0NA 3PPYA 4CNBA 3EGXA 3ZQKA 1M2OA 4C29A 4G1EA 4WK0B 1JEYA 3T3MA 3ZDXA 3ZDYA 2VDRA 1JEQA 1SHTX 3EG9B 1TYEA 3M6FA 1AO3A 1M1XA 1DGQA 3BQMB 5KYNA 3FCUA 1FNSA 2VDOB 1N9ZA 4UM8B 1SHUX 3RAGA 2VDPB 4NENB 2VDLA 1UEXC 1N3YA 3V4VB 1YVRA 3IJEA 2NUPA 2NUTA 3F78A 4Z7OB 1XDDA 1RTKA 1ZOOA 4HQOA 5HDBA 4WK0A 5ES4B 1JV2B 3EOAI 3IBSA 4Z7QB 5KYYA 3EG9A 1MHPA 3NIGA 1IDN1 1RS0A 2X5NA 3E2MA 1MJNA 4F1JA 3TW0A 2VDOA 1ZOPA 3EOBI 4MMXB 2VDQB
chains in the Genus database with same CATH superfamily
1SIBE 3QEGL 2HCBA 2C20A 4BN0A 3AI7A 2VXBA 3JS5A 2GTIA 1CLYL 1YSCA 3K0FB 1FNGA 2VQ1A 3MRBA 3ANYB 4P31A 4YRTA 4UTVA 4TKMA 3A2LA 4IDPA 3Q10A 3AHIA 1DELA 2D5BA 4NWTH 4ZCIA 4PTTA 3NBXX 4N49A 2CDFA 2HDHA 4UNNA 2PDAA 1OAAA 1ZUWA 3I8EA 4E5NA 3Q6GH 5DP2A 1AMNA 2WAHA 4JDTH 5DJ2A 2G9NA 3T6KA 1XQVA 3K09A 3NACL 4PR5A 2X0EA 4HIXL 4OGQC 2QZZA 5GGVL 5GSRB 4QOKA 4XTRC 1U6AL 2DH6A 4EXKA 2YCBA 4JZNA 2BEUB 1QGUB 3AB0C 4ZMTA 1HQRB 4WIQA 3M46A 4FDAA 1ZCRA 2VLBA 2WIIA 4WLFA 3AGPA 4P2OB 1CXEA 4ZYXA 1QJCA 2WZ0A 5HPMB 1L4UA 3D6NB 4S0SD 5DMIL 5C0FB 3AC0A 4GG6A 2VUYA 2WIBA 4CEIB 3H4HA 4H7HA 4YJ2A 3PT5A 4FHFA 5D1XE 2IT1A 3C7TA 3B6JA 3D2LA 5ITBL 3KP1A 3FU6A 4J0FA 4Q1EA 5DBOA 3B34A 4O4HB 4XPGH 1I3OA 1RYFA 4H1LH 3FN9A 2QSCH 1E1QA 2P27A 1WHOA 2HRPL 3OTQA 4OCYL 5HJ5A 1IIRA 4DRZA 3KZKA 4Q05A 4YS6A 2DM7A 3FMFA 3QUZA 2WJYA 1ZGLA 4KI1A 4JJ6A 2UVPB 1VESA 2VLKD 3ARRA 2A0UA 4LTDA 4WN9A 3D85A 2AV7A 3L3OB 3D7LA 2LQRA 4AMXA 3W9UA 1ORQA 1K4DA 3X3GL 3DXZA 3BSZH 1X6LA 5EIAA 1HT6A 4X4KA 4YRZA 4H1WA 5BUQA 1KWKA 2P42B 2VERA 3H2KA 2XZCL 3NK4A 2AH0A 4MGKR 4ITRC 3IERA 2F53B 1FZJB 5E4JA 2GASA 4MMZA 4L3CB 3JZMA 1YTUA 3U83A 2DOKA 4LT7A 3ORYA 3I2NA 1WA5A 2FX8H 2QW0X 2YPVA 1A7JA 5ITSA 2W5UA 2R0LH 5IU6A 5BNWA 2ZYVX 5GGSB 2YYAA 2JFWA 5H70A 5T67A 2X2JA 3HXKA 1UH4A 3KSUA 5FGBA 3SDSA 3GWJA 1NMYA 3CNQS 1CI5A 1U0JA 3CLUD 5E70A 3PWKA 4X2UA 3R6WA 2ON6A 3GMQA 1XRQA 1HURA 2EX4A 4IRSD 2NUTA 2XPCA 1M1YB 1A65A 1KN2L 1ISPA 4HXFB 4M03A 1ID2A 5CEZH 4PJ9A 1D1QA 2ENJA 4PV7A 2HLHA 4EK9A 1PZNA 3PV6B 2H1SA 5DV9A 4RFLA 1PW3A 2IPOA 5C0EA 2QLMA 3QNWA 1CUWA 2YQ4A 2XVKA 3B78A 3M86A 3RVWD 1N12A 2IDQA 4ND5A 1S96A 4MCMA 3IMCA 2ETWA 1KMMA 1TMOA 3ZE7A 4Q9KA 4JI2B 5CFPA 1MF7A 3NOQA 1U8JA 4WK6A 3VU3A 3I6GA 4Z3FA 4CMBA 4ZK8A 2RTTA 2WNKA 5I6KA 1C1DB 5BSEA 4R8RA 1QRUA 2UZYA 2D7DA 4XNMA 2H08A 3A4VA 3FNEA 2QVFB 1UDXA 4NN6B 1WFMA 5BQOA 1AFVH 4X5PA 2BSEA 3N70A 4Q52A 4KXVA 4OKVA 2QMJA 2PA3A 2X0KA 1JF1B 2GSWA 3QSGA 1KMIY 3BH8A 4WK2B 1G8JA 5DVPA 1U6IA 1IBFA 3G9VA 1I1AD 4CSZA 4LRWA 3VISA 1KJZA 5DDHB 4XYMA 4QNMA 1JOIA 3L7KA 4DJEC 5F6HJ 5ITWA 2PMCA 4FZRA 3K26A 4Z7VB 3E8VA 1I4LD 2OR9H 1VMEA 4UBLA 1E2JA 3JD2A 5LB1A 5E7QA 3SNHA 3MR9B 4I1PA 1Q77A 2I6FA 4MJ6B 2PO7A 1VCAA 2HJHA 5LLDA 4X4XB 1AQHA 4DPBX 1SDAB 4NDMA 4RY0A 4U1NA 3HA7A 1VRSA 2VSYA 1SZPA 3BAJA 43C9A 1I9GA 4PJIB 4BV9A 4KDCA 4UINH 1G6RH 4WLVA 1OH8A 3FTYA 1N0IA 1TM5E 1K27A 1MVFA 4H5SB 1YTLA 3KUDA 5FB8A 4L7QA 1M33A 1MH9A 2V5UA 3LZFH 3NHUA 1CZ8L 1DO8A 1EGJA 1OQXA 4XWOC 4KJWD 3ROEA 4H6PA 5EUOE 2WHPA 1IIKA 1HE7A 4YGVA 5I7RA 3E0XA 4D4LA 4JGNA 3M1BB 1NY5A 3LUDA 2Z8XA 1AGBB 2WLZA 3HNOA 1J8YF 2EEFA 3PUIA 4WERA 5DNUA 4X98A 4MI1A 1BX1A 5ELMA 3KM1A 1ZNQO 1J5DA 2XICA 4HKXA 1NW6A 3ZGZA 3CB4A 4MI6A 4DADA 3GGCA 5TH2B 4IH4A 4JFEE 2D6FA 3WLFA 4RMRA 4V24A 2BBWA 3X44A 1Q0UA 1SUDA 2FSUA 2ZIAA 4Q9BA 4RTQA 3EVNA 4CY1A 2QAGC 3SZKC 4L4VA 3PWPD 3MCLL 2OLKA 3KPLB 3ZIMA 4YDHB 4NPYB 5JQIB 4X7TB 3SOBH 2N0KA 1DAOA 5IEBA 4KKZA 4MGHA 3V2IA 3O47A 2Q3DA 1EXUB 3BDXA 3E9MA 4GG6F 3TWCH 5B2FA 3U62A 1XO1A 4I5EA 1JLKA 3QLVA 2P62A 1ZV2A 2YA2A 4ZXBA 1FYTB 1KYZA 4MVJP 4TYWA 2HFGH 3CGWA 2BSRA 3TG2A 1GW6A 1NC2B 1PZ5A 1NA8A 3BCUA 4NCHA 4LIPD 1S9YA 3KLAA 4CW7A 2YVKA 1D5IL 4PRBB 1H4VB 1YKGA 3LGAA 3HW7A 3GIZL 1OIXA 5HK9A 4W9RA 1HFJA 3ULVC 2CFCA 1SQGA 3GBLA 1TVCA 1GG5A 2FI1A 4G1MA 4B4DA 2MCPH 4EMBA 4OHBA 3LY6A 3AWIA 5FYJE 3S9DB 4FB1D 2XNHA 2D2XA 2AJZB 3EUAA 4PQFA 4J07A 4UANA 1CK4A 4OXRA 3B6KA 4J8BA 4HAUA 3NJIA 1ASOA 3GLHE 1P2FA 4MJ5A 1U9YA 2NO1A 1RJFA 2ZIWB 3O7MA 4I13B 1DRVA 4XPTH 5B55A 1OPXA 3KYKH 4NI6A 1W2GA 4V2BA 3IFSA 3GFVA 2WF8A 2KBGA 1FSGA 5FFNA 1V11A 2VR9A 4LLWA 1NMCC 4MNQB 2NXCA 4A3SA 4EARA 3A9RA 4ODTL 5CD9A 2VXQH 1CUXA 3B89A 1Q38A 2FSFA 4HBQA 5LGHL 1ODCA 4N47A 4RHEA 3JWOH 4KXZH 1H9CA 1CF9A 2O8CA 2AEQH 5DZNA 5E7MA 2OXTA 4ZW3A 4W9NC 3VD9A 3ZN2A 1E3QA 4FNSA 1OH6A 4X6CB 1HOEA 1DXOA 1Z0JA 3GMTA 1CFMA 4EABA 3AG3B 1E8DA 3TPUB 5HFAA 4CT0A 1PG7H 4LWZA 1TR7A 3OPQA 5BS0D 2AMYA 4LNUB 1SUJA 1WBXA 3LCJA 2Q8PA 3F97A 1O08A 3DR3A 4FTWA 4QFMA 4XCVA 4G5ZL 4K8OA 3E9DA 4P58A 2Y1LA 5JRJA 2DKSA 5EH1A 4ORZC 2IGTA 1HTBA 3DHVA 3L7BA 5KOHA 3CVXA 3FT0A 2XNCA 3KZOA 4Q3CA 3EJTA 3N39C 4PJDB 2XZQH 3BXFA 2V7XA 5EJ5A 1OGPA 2EFEB 2O2EA 1YY9C 4XPAL 3QITA 4DP0X 3KPOA 1G1OA 2C3MA 4G2TA 3RY4A 4PYLA 1KY6A 3GHBL 1Y1RA 5DNCA 1YC2A 4B4KA 4OH1A 3V79C 3RW9A 3H4IA 4XGRA 3WBBA 1PE0A 2VNKA 2AQHA 3MT9A 4H1TA 3C6MA 5C07D 3QVJA 4MEAA 2P5EB 4CIDA 2PWHA 3SN6N 3RRXA 3AT0A 4JBWA 4URTB 3JD4A 4PGZA 4A0GA 4KI5D 4EMSA 1Z63A 1OT3A 4RVCA 1YYML 1SUHA 2FB9A 3E53A 1OSZA 5ECGA 5FGSA 4NRYA 4CL0A 1JZEA 4JKPH 5IJDC 5IFLA 4U1LB 2DYPA 1DE0A 4B3SB 3RNKB 3DBRB 4F4JA 2V6IA 1P1FA 5KQSA 4IDDA 2CQVA 3FWKA 2DQCH 1TQCC 1DKMA 3EC2A 3SE3C 1PYOA 3MRDA 2CXTA 3PIIA 1C12B 5DLQC 3MWDB 4K1XA 1T4GA 5EXDA 5K0GA 1JTOA 1V4BA 4DDTA 2IP4A 5E08H 3WFHA 2XN9D 2QLBA 3ZWYA 1QH8B 2IEDA 4F9FA 4PLGA 4AFNA 1JZ2A 4IIFA 2HKHL 2AR0A 3P2EA 2AXPA 1DDTA 3LYUA 4AXWA 1KO1A 5TPWL 4OMDA 2XX1A 4LEOB 3K3QA 1U7XA 1QFJA 3CPJB 4L5FE 1G2QA 2BKVA 5JZ9A 4G5AA 2HTKC 3WLOA 5C52B 4Y6SA 1A6TA 1L4MA 2G63A 4YAQA 3T0GA 3GK3A 4YRMA 3Q9UA 1NXVA 3P0VL 2PGDA 3NN8A 2I27N 2V8LA 3ROKA 3PGLA 1BBJB 2ITCB 2SCUB 4JU9A 5ACLA 4BASA 3FFAA 3RRQA 4F97A 3OETA 5FXCH 4KKAD 3L1OL 4X9HA 4RGQA 3CNKA 2B5MA 1UWKA 3K0EA 2HREA 3JWIA 3EARA 1FS6A 1R0WA 5FV2A 3QX7A 1E7YA 2ZFUA 5ANHA 4MV5A 1L7NA 1NQXA 2PKQO 3IWUA 4MDJA 4RGNB 1SOUA 1YO6A 2R2GA 4PANA 2QJOA 4RRPG 4WUKL 2PUCA 1J00A 3BFWA 3B9RA 2OD2A 4KVFA 1MVUB 1HI6B 1W44A 3MWEB 2BIQA 1H5BB 3AFIA 4Y4KC 1P4LB 2C5DC 2YBGA 3PK0A 4K3DH 1XKLA 2EVWX 1KPGA 4JCWA 4WNQA 2YLHA 3BZFB 2O93L 4BMVA 1AC0A 3VPFA 3TASA 4WEOA 3DKPA 2H2SD 3OWRA 4OUDB 1A3RH 1MIMH 1UANA 3FU9A 2DWTA 3V4VL 4UT7L 1ZEAH 5D6OA 5CILL 4TYUA 3IUPA 1YEIL 4XX5A 3RU9A 3GSQA 3GELA 1G7SA 2QAIA 1XZBA 2XZDA 2X9XA 3RF7A 3AG5A 3CEPB 1AGFB 1PJWA 2GN8A 1LV7A 3F6RA 1Q74A 4TZ0A 1QSFE 4MMXC 1T89A 1MG2A 1JSZA 3X3FH 5B4TA 1K8YB 3W7VA 1BWMA 2AH5A 4FT2A 1SU7A 3KBBA 3VQ2C 1SXJA 3BG5A 1A7AA 2ZR7A 5F7FA 1BVUA 4H2CA 2OZPA 3IEPA 4ETQA 2IDMA 4LWPA 5AVKA 2F9BT 1E9QB 4OLYH 4MJJA 4YHNB 4P57A 1D2MA 3U3JA 1L0XA 1ZJAA 1RXSA 3L6FA 3STVA 1ZJBA 1ZITA 1BIFA 2F74B 3Q1SH 4A2MA 4Y2DB 1DQQB 3KPPB 3JTBA 3C3XA 3HB5X 5JPNC 1U3VA 4MV8A 1IU1A 4OTZA 1YEKL 4P4KA 4B9YA 2FFJA 4K9RA 4BL5A 3ZT7A 3R3WA 4Y2TA 4PJFE 3JQ9C 3FTQA 3OZLA 3FZYA 3SBWC 4A66A 5JORA 4JB8A 1XGTA 3QWIA 1JDSA 2BRUA 4ARZA 4JAMA 4PUBL 5CJQH 3D3QA 1N2CE 4YI3A 3SSMA 1CEQA 3MRQB 2F43A 5DD6A 3WEOA 4EP1A 1S2IA 3H87A 5TV2A 1CNMA 1FBIL 1VF5C 1XGYH 2H29A 5LQMA 5E1OA 2YNMA 2UYLB 1TFHA 4MWTA 3GIVB 4NBMA 3TAUA 2F19L 4WHDA 3TB6A 1MB9A 1QLJA 4Y4HB 2YK1L 2JCCF 4KK6D 1OCZB 1VCBC 4X7DC 5FNVB 3UAJD 1DBSA 3HM9A 3IIWA 3VXUE 1SC6A 2BN4A 4D3ZA 4LNAA 1DL7H 4KP7A 4RDHA 4NE2A 1OXMA 2WFLA 3OY7A 4Q7QA 3QPKA 3ONNA 4LL4A 3SQDA 1GNTA 4BLSA 1Z8FA 3V4FA 4PC3A 2AJSH 3EFOB 4OVUA 4PXAA 3UBFA 2WLKA 1U93A 4MAFA 5IS2A 3QZOA 4BUJC 4H7FA 1WCWA 2Y0DA 2CNWD 1DVFD 1HSBA 3DDNA 1YACA 2HWXA 2ZROA 32C2B 5FRDA 3J7AC 3JSSA 4U1HB 5KX5A 4M1EA 4FKKA 1PBYB 4JRYB 1KIFA 3GRRA 4D9RD 1JFFA 4Q3AA 3GJEA 2ATKA 4WMLA 1YEFL 4CMJA 1WSDA 1NAIA 5JNSA 4C7OA 5MEQB 3B7PA 5DMXA 4TLBA 4YDSA 4KV5F 2BCKB 3VOAA 4UBJA 4JY6B 4INPA 4JGUA 4B81A 4L74A 3PVWB 1OZTG 4HX5A 1RUAH 2VOJA 2GSGB 2VM9A 1CU4L 4KUZL 1SULA 1P91A 5DFVC 5BRNA 5DLDA 4HLEA 3AR7A 3ZT5A 1KFJB 2RHEA 3WK6A 4BGDA 2BBTA 4TRJA 2O5VA 1NXPA 2DJUA 3L3JB 4JREC 2JKRM 2E2WA 3GXIA 3CZEA 4XC3L 3KWUA 4OGXH 5DGIA 2ZJZA 2IXFA 1SCKA 2GSIA 3LUCA 4KQJA 5B8CA 1RXLA 2AJ3A 3FB8B 2AS0A 2D7OA 3H04A 4NDZA 4HF5H 3S28A 5D96B 1ASPA 4BV8A 1DBPA 5BMFH 1P5UA 4JHAL 5ERXA 1AKVA 2LHAA 2YXLA 3BSHA 4XO5A 1X7XB 1P80A 3QFDA 2AZAA 1AQYA 3VXKA 4FP8L 3MO1A 2A0YA 2ROXA 3UMJA 4X7SH 4PJEE 3TH5A 4D3CL 4OIBA 4PG8A 4E5ZA 1OC2A 1W48A 1CGTA 5ICSA 5TD4A 2VO5A 2P2DA 4AKIA 3CHSA 3A4YA 3BX7C 5EYPB 4LKCB 5D7IE 1SUEA 4BWUA 3O3EB 4NXSA 1KQFA 3OM3B 3EJCA 1JGEA 4UOW1 1WETA 1FAIH 1SKYB 5C0CA 1BQLH 4BFRA 1NZFA 3HCFA 5I7UA 1YEHL 1CI3M 3ILEA 3CVVA 4YAKA 1W72H 1C5BL 4DAGL 4NZYA 3OQPA 3OE4A 4IGAA 3ZE0E 4XDGA 3WKAA 3F7NA 3Q8MA 3NALA 2N59A 3OUZA 3VYVA 3AKZA 1NL0H 3VA6A 4J2OA 3UC2A 5E99L 2DFDA 3KGSA 1F2UB 4NFSA 3LVFO 1X92A 3ISRA 5J12B 3SE0A 4TQ8A 1Z28A 5C08E 3LKDA 2GBGA 3KJNA 1OJ7A 3SE4A 4D26A 1SLXA 4HQKA 3QIAA 3P9MA 1N57A 1QAQA 1NVTA 4IBYA 3E9CA 1F2VA 2A9JA 4NN7B 1AQMA 3LMJL 3LVBA 5ERGB 3UOGA 2H1CA 1PY0A 2IHUA 1U8MB 4OM0L 2WP0A 2GGSA 4EDFA 1S78C 4TS1A 3EUUA 3R7BA 5E3IA 4LK4A 1XTUA 1NAMA 4R5TA 2I24N 2KB0A 1YT5A 3E5NA 5E7IA 1T2AA 4ZJYA 1K5NA 5G0UA 1FG9C 5EKUA 5HJEA 1S3RA 4R2GC 1LTHR 2B16A 1WBZA 2WV3A 2OGTA 3AGVA 3LUPA 3K91A 5TARA 4RS3A 5LGJB 4DP4X 5F89B 1KY2A 5LLTA 3CX5K 2NU7A 2WZBA 4DV3B 1T7VA 1QQAA 1IM9D 3BWUF 3AJ9A 3WUWG 1QYIA 1ZCFA 2IYUA 3VXRB 2DMBA 2V3EA 4WWKB 9CGTA 1J2EA 3TBKA 1N5LA 3G5VA 3CJRA 5D1XD 3PFWO 2BY4A 4UAUA 1B9ZA 4RTOA 4BP1A 2A77H 2X38A 4JRXB 4LVNC 4DCUA 4L8SA 4FQCL 1G2PA 3LT5A 4FYVA 4UXIA 4B73A 4DH2A 2G9ZA 4HUQB 1E3FA 3DBXA 2FA9A 3ZD6A 4F92B 3GX1A 4LCIL 3HNSL 1D7AA 4BB5A 3QHQA 1A66A 3O7WA 1U3ZA 1EZVX 5E2WH 5KG9A 2I4OA 3D2CA 4BNXA 4ES0A 4EHDA 2FFAA 1TM4E 3A31A 3L95A 4ODUB 1A9EB 4DSNA 1P5RA 1FF5A 2Y92A 4ZMOA 3TIFA 5TK4A 4J7RA 1IAIH 3V0EA 2DETA 2AAAA 4FHZA 4UNSA 5A5VA 3V7UA 3WN5C 4BFFA 3AU8A 1QIDA 5FUZL 2BCJQ 2O8FA 1NW5A 1J9SA 2XUIA 4EAAA 1E6MA 2Z6FA 1NPYA 3A67H 1AMXA 4C4RA 5DGXA 5HZGA 2PR2A 2ZE0A 2ZOWA 4ZRGA 4WFJA 2W1NA 2EOAA 4GRAA 1LMKA 1OLSB 4MXVE 2FMFA 2NZVG 2QN1A 3PGJA 3AKCA 1JUFB 1GZHA 1O6TA 3U1SH 3R5FA 2V7QA 1OA0A 4YE4L 1D6JA 2JK5A 5DMJB 4M7JH 2QQLL 3C6LD 3FO1A 2AUMA 1DP4A 1U8OB 2BSTA 4GIAA 2X4OA 2KE5A 3NBQA 1OP9A 2WKLA 4ECAA 2ZZKA 2WQ6A 1Y3HA 1XTPA 1CDZA 4FN0A 3DYMA 4HS3B 4DDVA 5JA9A 3KHTA 4ARIA 3EBLA 1H8ED 1P5FA 2IAMC 2J3SA 1GCGA 2AOUA 3AY4A 4AQEA 4HYTA 2E1PA 1A25A 5FLXA 4GW5B 1FGVH 1S9HA 3E2IA 3QF4A 3ZDZE 3EDKA 2H2AA 3OAAD 1DCTA 2MQ0A 3ROFA 1MRCH 3PWUB 1KA9H 4P2BA 1Z7JA 3EDYA 3W2EA 3K1JA 1MUUA 3ROOA 3WGYA 2EE0A 2YQGA 4IGBC 3JAKA 2F1AA 3G2KA 2KZKA 1ZGAA 4NRDA 3AIIA 2XV1A 1FFPB 4UUOA 2WIKA 4AGQA 1RI6A 4LASL 3U19A 1N5DA 1GVHA 4KNVA 1NBWB 1F38A 3CFCH 4JM4H 4FIDA 3TO4D 3I7LA 2HJLB 1GIAA 4RCZA 1X2BA 3ZQKA 2JLQA 2VSKB 1GGCL 5ID0B 1E1NA 1F4AA 3U7JA 2YOGA 4R7DA 2AQ8A 1N7MH 5FHAH 5HIJA 4YMVA 4ZZ0A 3RASA 1ODIA 5D72H 1E8YA 3OJEA 4JLRB 1FTNA 1W8IA 3TRIA 3NT0A 2QD4A 4ONGH 2AF2A 3UANA 3NATA 2QT1A 1GY2A 1XQYA 5SX4H 4PCLA 3IJYA 1Y1PA 5HVNA 3TEXA 4XNBA 1EB8A 3BMQA 3V97A 1CTNA 2H3KA 4L3EA 1W0JD 4ZT5A 4NAVA 3AWEA 3GJYA 4JLOA 5DVLA 3MT7A 3ZE1B 2ZREA 2CFOA 3NHYA 2VK4A 1JLSA 1CP2A 4JI5B 5ALCH 2YXEA 3KYOA 3ESZA 4DNQA 5ALUA 5DWPA 2VUUA 1QUNB 2IIJA 3PC3A 5FO9A 2HG0A 5L3VA 4RX4A 5DMGC 4XDYA 3HN5A 1V5JA 1QZUA 3P4MA 4BVEA 1H15B 4OLUH 2WKSA 1FEZA 5ANRB 4F33A 8OHMA 2AGVA 3PP4L 1OF0A 4MAYB 2YMXH 1EM8B 3L48A 1D7OA 1K92A 4EY7A 4YAWA 1N8NA 4HLZH 5D5HA 2Q76A 4GS7C 4QUDA 3EBPA 1TFPA 4JFED 1ORIA 2DBJA 3OAZH 5BUPA 3GJ7A 1IC4L 1RIUH 1XXFC 4JJ5B 4Z7WB 3ISWA 5EF0A 5PGMA 4ZS7H 2AX3A 1F8TH 1WUKS 2VDRA 4E54A 1JKFA 2O6LA 2BNRA 4MS6A 2XTJA 4GRLD 4FLMA 3TEZA 4X9GA 2AJLI 2OBFA 4AE1A 2EHJA 5E2VL 3ES9A 1DS6A 4X0NA 5AK5A 5DD0L 4EXPX 4N68A 2RR3A 3E05A 5IESH 4ZUWB 4OVKA 3QOFA 2EIEA 1SBTA 1JB1A 3LEVL 2I0SA 4LXIA 4OBRA 4XBEL 3DO8A 2FWMX 3TVMD 3LXRA 4PZPA 1JAHA 2PT9A 2GPAA 1S2LA 3J2PA 4IHKA 3MBEB 5IB1B 3K96A 5IXYA 1AD0B 3E5HA 1UM8A 1KMQA 5C8JB 1GZUA 2J41A 2Q4OA 1O4VA 1J8DA 3LZLA 1MQKL 3X0DA 4DV0B 4DT1A 1X1SA 3ZQ4A 3QHYB 3NTCL 4N2DA 2M8XA 4Z77B 5FYJD 1PV2A 2J7PD 3VNYA 3TA3C 2P46B 3HB3C 4RETB 4HWBH 3MLBA 2YC1B 1EVTC 3R1IA 5BSTA 1JXDA 1KDTA 3F6PA 4PJBE 3NDRA 3O8LA 1GZPB 1TW3A 2HJSA 2G6BA 1JPUA 3F2LA 2IPKA 2XYRA 3BBPA 5K09A 1GQRA 3SJCA 2C1PB 4H8UA 5LA6A 3JROA 1VPWA 2CUNA 5GS2D 2QZPA 1RSZA 5CSZA 1ZVVA 1E5AA 2DN7A 3T3MB 4QJ3A 1K9TA 1ZDSA 3ARBC 2GA8A 3MUEA 3IPRA 4LMRA 3CN7A 1WICA 5IQ9B 3BSSA 2IEGA 1MC4A 3V5DA 5JW4M 1NW3A 4MVJM 4I5FA 2VSMB 4CA4A 1ZHNB 2VJDA 3JWEA 4BRUA 4YTEA 3QE2A 2FT7A 3PHIA 4N18A 3GFQA 1S5HA 3WAGA 2EEPA 5JI2E 3G6AB 4EN3B 5AVYA 4B4VA 1DEXA 3ROMA 1NC4A 3ZI4A 5KTEL 2GHQA 2HDWA 5TX7A 5BRZB 2FSEB 3PIQA 1LB1B 2ZRBA 2WTBA 3RF6A 1AI1L 1WOYA 2VLJD 1P7HL 4H20H 1B3IA 3QU7A 5KOYA 5SWSA 4RGOL 3RIFK 2N0SA 2A78A 5TQ0H 1L1EA 1TYQC 2ADIB 1YCGA 5ISMA 3G5ZB 1HOXA 3AF2A 4ND4A 2WINA 1I1FA 4C54A 5KHLB 1PIFA 3MTRA 3JSAA 1A6UL 2YGOA 5B1CA 4KGDA 1DJZA 2FPXA 4D3FA 3L7JA 4NRZB 2CHGA 1QFMA 2EW8A 3CVHB 5AKRA 2HKMA 4MWFB 1S7TA 5CBAB 4CEJA 4OJFL 1UZMA 3VFUB 2D9CA 4DN3H 1FUUA 2B9VA 2JEOA 1HYSC 3FYEB 5CDYA 3PA6A 1RMFL 2COUA 5EIIB 1EFAA 3GOQA 2E9SA 3VNVA 3RTQC 1DE4B 1E1RD 3X2SA 1I0LA 1M54A 4L5BA 2ZIXA 3VQLA 3HUJE 4Q4LA 2PMEA 1FX1A 4MB0A 5BNFA 4J3BA 4YHKL 5AVSB 5IJ9A 4NJMB 3JXAA 4C4XA 5DJ6A 1OCWL 2F1IA 2GPSA 2D54A 1EP2B 1JWUB 3HN7A 4QGFA 2CSUA 1RSYA 1CDGA 3NCEB 2A0KA 2W6CX 3PFKA 2GEDA 1X5LA 3UIYA 5IAGA 3EA4A 2MQCA 2Y2WA 1MHPH 1IO4C 1AA9A 4C4SA 3QXTA 5H37A 5MN4A 5FCDA 3TW0A 1TOXA 1BCRB 1P31A 4KQEA 2N01B 2VP3A 2J1YA 5FLKA 5ALHA 5J11C 5KVAA 1L5GA 3ETBF 2HMWA 2DPKA 1PEYA 2QAJA 3EYAA 3AAZA 5CJ8A 3AVTA 2O54A 1IHXA 4N0UA 2HXCA 3ECCA 3OKEB 3EC1A 3WK8A 3CIQA 1KELH 2XKNA 3UFXB 3LHPL 3H5NA 5AOIA 3ADPA 4CNIB 2MOGA 4W81A 4OU3A 2XWRA 1D3CA 4BGLA 2AL7A 5HDQH 1X8JA 4NARA 2PM8A 4ISCA 4L6AA 4PJXE 2JJTC 2YJGA 3ITNA 4XLZA 1U58A 4LC0A 4WXMA 3C3KA 1RK0A 3SYCA 3T8YA 4WKOA 4GO9A 2E7DA 2JGFA 1C08B 1H0KA 3HZRA 4EVRA 2HAZA 2AI0H 4P92A 1ZGHA 5CFZA 1I4FA 1KMNA 1R0RE 2HYMA 3OJOA 4Q93A 3I72A 3W3AD 5IF0A 2H5LA 1U8CA 4QA9A 2HTEA 4UDXX 4GMDA 3IVKA 4GUAA 1DDHB 2VLIA 4LHXA 3P26A 2Q7YA 3D1LA 4HC1L 4EYQA 3TI7A 3BT2H 5CM8B 2ASVA 4RKEA 5I9QC 3I2FA 4BQBA 4L9LA 1DJIA 4U1GC 4Y9GA 4N12A 4KQ2A 5B4VA 1W6RA 4K9EH 3Q6MA 3E22B 5I30H 3N76A 2LFGA 4PSRA 2R1VB 1AJ7L 3KYBA 2K2QB 4KGJA 2VDLH 4XM1A 2ZYAA 5IAJA 5DQ9A 3HR5B 1RM3A 2IV3A 5HVWA 4GM3A 1FL3A 3OT4A 4KREA 3PABB 3K0CA 3MXWL 3WGVB 1P84K 3H2PA 3N5AA 1TTPB 2Z98A 2EINB 2V0CA 1ZJ6A 5MERB 3GCDA 3ORVD 2Q8BH 3GP8A 2AJBA 1WCXA 3BP6A 3MUGA 4XBPB 4LCUB 1SEPA 1NXTA 4EYOA 3MZLA 1DCLA 1XZGA 3FQRA 2VYVA 4BMPB 3OKYA 4CCWA 3HDGA 2PLRA 1U31A 3GEFA 1N4DA 4LLUB 4KIWA 2FR8A 3IKTA 4CF5A 4UUPA 3P9SA 5ILTH 4RY8A 1P9NA 3H8VA 1IARB 2Z31C 1GKEA 1S7WA 4MJIB 4G6AC 1Z0AA 4JSTA 1CVIA 1H22A 1OSPH 3TL3A 4XCFL 1GCUA 4I0WB 1J6UA 3ZWXA 1E7UA 2QVGA 1PLCA 5LA6F 4LDOB 4BFCA 3LB6D 4GXQA 4QUAA 2OXHB 4N5EC 5AVVB 4G4IA 5TDHB 4GAGL 5J6SA 3CMOL 1BFOB 1M1ZA 1MWAA 2BFBB 3T99A 4LLQB 2IQ9H 1QSFD 1XL6A 1OREA 3OPMA 1BAFH 3D6JA 4FCWA 2VHJA 1HIMH 2VQ6A 4M5ZH 3G1UA 4GG8A 4WFKA 4NS4A 3DTYA 4OFQA 1ULTA 4J2HA 1TO1E 3ONFA 1JPNA 4FJ2A 4XNDA 3PFFA 4EW3A 4YDIH 4P5MA 3RC9A 1U8UA 1MN4A 2IH9A 2QSVA 1WPRA 4PLFA 2R0ZH 3K1AA 4P8QA 2AFHB 4MA0A 3SDCB 4I87A 1I32A 4LAJH 2UYHA 5JDIA 4AYWA 3O9MA 5EP4A 5K59F 1U2GC 4IY1A 4UT6H 3ADCA 4WAFA 3ZR5A 3WS3B 1WV0A 5CP3H 5JPCA 4Z3OA 1TRKA 1PJSA 2C7VA 1JTVA 3LYAA 2CHDA 4PY7B 2JVIA 4D0KA 2GIXA 1G291 2JJ8A 2JIMA 4O2CA 3LDAA 2FH8A 3TCXB 3W9SA 1UT1A 1U28A 4GECA 1SQ0A 4LLVA 1KEEA 1MJGA 5IP4A 1UP6A 3EZFA 4QEDA 3ORJA 1JHTB 2WSMA 1UWEL 4K2UL 1KMHB 3SDXE 2OTWB 2G75A 3RZCC 3HOGA 3PGCB 4GI7A 3WFJA 4OYRA 3IV6A 1JI3A 3RS3A 3EI1A 3PGVA 2R7MA 2BJMH 3VFSA 3EEQA 3F90A 2PO5A 1BQEA 2BHRA 4EUPA 2ZJAA 1Z6XA 4IMIB 4N9QA 3BHMA 4ZDHA 5EWMB 3VKFA 3FYIB 2Q4RA 1M0TA 2W22A 4B96A 3OXSA 4ZCPA 3OJLA 2YJ6A 1GV1A 1E65A 4WO4D 1SJVA 5IFAH 4KJXA 4JP8A 2MR5A 5KVEH 3A8TA 2H4WA 1JHVA 4AIIA 4MGIR 3OKKB 1U80A 3GGDA 2IA5A 3ICCA 3PUJA 5AD1A 4XB6B 4X61A 2OZ4A 2W9DH 4J3OG 3GHPA 1JV2B 4N41A 3FZGA 3CDFA 4KVNH 2Q0ZX 3K4HA 1IN6A 2VDWB 4F8QA 4UT9H 3S8FB 4BIMA 5C8YA 3BVUA 2VLLA 4YY3B 1NEZA 5IUKC 3MHTA 1KFEB 4CTKA 4E36A 1ML4A 5ETUB 1MDFA 2AFIE 3UJPA 2WSBA 5JNYA 4OFYD 4HKJB 3B2XA 2OULB 5FF9A 3FCSB 3QUXB 3FTZA 5AJAA 3GSUA 3V6ZA 5HPYB 4FMKA 3KCNA 4N0EA 4HGPA 3WD5H 4W4OC 5IQOA 5ICGA 1SGKA 3Q2CA 4LXUA 3ETEA 2VTFA 1NOIA 1EPFA 1V3LA 3B5TA 3I2GA 2PKCA 4NO3A 3P5BA 1NCOA 5DM2A 4RDBA 2O20A 4AJJA 2Z3WA 3V0WL 5F44A 5FDWA 1QWOA 3NAMA 3IMBA 5EESA 4MGYR 3O1IC 3A05A 2X5PA 4ZAKB 1BSVA 2C4FT 4QRJA 1GKUB 3ICVA 4KKPA 2Z1DA 3PGFH 2POQX 1SKUA 2ZKWA 2ARWA 3G2HA 3UP1A 4L2IB 1LE9B 4S3MA 4RFNC 4X1IB 4JM2B 2DYSB 2IFFH 3FI0A 1YS6A 3FUTA 2NUAA 3CE1A 1JPFA 2QFRA 4CZ2A 3H4MA 1N6DA 2XJKA 1JTDB 1SOVA 3OY2A 3W77A 3VJ6A 2FH6A 4UQ9A 4XVOA 4QELA 2X1XR 1IZ9A 2PWDA 1SVKA 4BJ5A 3AEXA 2XBMA 4IOMA 1RI5A 2XXAA 4KMSA 4QRFA 3ZTEA 2IUPA 3HCOA 1LPSA 2WT4A 2Z1PA 2EEAA 4HIIB 4KBYA 4I77L 3HDTA 5KVGE 3P9ZA 1RK1A 4EB3A 4ZODA 5H2BB 4FMDF 3TFKD 5HHNB 2EYSA 3JVEA 3QDMA 5CF3A 3A4NA 1RWQA 3H0TA 3VXTB 4EVIA 3LCRA 1OILA 1DIBA 1DOHA 4F3NA 3TXYA 4GW1A 4I18B 5AIAA 2OMWB 2ZLBA 3IRPX 3O84A 5DWQA 1T1YA 1FB5A 2X7JA 3GJ8A 3HP1A 2QX7A 5D6DC 2Z83A 4M6ML 2REXB 1UACH 3NHKA 4PZUA 4GFDA 3L1HA 1L3BA 2R00C 3O4LB 4CMCA 1JV5A 4ELMF 3BUYA 1P72A 2DLCX 4FQHB 4P1ZA 3UHAA 1W2HA 5BW5A 4OJNA 4E1VA 2FHBA 3UUWA 1CB4A 5C2WB 1HAWA 4IRZA 1IFHH 3DZHA 2IADB 3NI2A 3B85A 2P1DA 4YDQA 3QPBA 4BFIB 3V7AG 1TQ8A 2ZE5A 4DUZB 4CDRA 5C0OE 4NAUA 1A1OB 2JVJA 4OD0A 1XBRA 4C6SA 5CB6A 5I73B 1FNSH 1GL4B 1E27B 3UXMA 4HD5A 5J4MA 1N3YA 4I8XA 4HBCH 2GNAA 2BZ0A 1S7QA 1SYSB 2VS1A 3LE8A 4R16A 2BKUA 3FTNA 5HMMA 2ZOSA 5GJSH 4JCMA 3DCJA 1FH5L 1R3JA 1HH9B 2VP6A 4PRPE 3IYLW 3L5XL 4G6JL 4MMYA 3N43F 1TJHL 4YC2C 4HDKA 3WTBA 3PNWA 1JHYA 2DBLL 3HY3A 2MYTA 3ZXSA 4KTVE 2JSFA 2JHFA 3SWWA 3UMYA 4J0KA 1IVYA 3L5WA 1N2BA 4IG4A 5LP6A 1LRJA 3QQDB 1A5FH 1RURH 1PZFA 3VG9B 2WD7B 3W9EB 1LE5A 4UE6A 1WB5A 2R47A 2V2TB 5IR1A 5CXCB 2XKAA 3PFHA 1IZJA 2XYGA 4B3HA 1L5HA 5I5MA 2OPBA 3R06B 3SAJA 3AL9A 5FQNA 1MC8A 1UGNA 3A7EA 4OJEH 5EMHA 43CAA 1EBUA 4YCLA 2FLMA 5FEMA 3VUFA 4B85A 1Y7TA 1R0BA 2ARJA 1KDJA 5TFSL 1Z5WA 4B3JA 4LE2A 5AVUB 5BUZA 1EQAA 3U1VA 1KO4A 3ZT6A 1XD1A 4ZCQA 1AR1C 1R5BA 4O2LA 3TSCA 4IJ5A 1X87A 4PRYA 4NRXA 2PEYA 5AESA 1NWPA 3H9CA 1Z35A 2O3SA 4H18A 4QRHA 1GKOA 2BNQB 4WRRA 1Z2AA 3KH4A 5GJWC 4G8CA 4M8SA 4XSGA 4Z7QE 1P17A 1NFIB 1P4UA 2C7PA 2FZLA 4FQ5A 1DN2A 5HHXL 1B4TA 5HHOA 4OHXA 2X44D 5LNK1 1MAAA 5T3ZE 4CADB 1ESZA 3K9WA 3SZGA 2Q3CA 1YEGH 2LTQB 3C48A 1BQHA 4RY2A 2HJFA 3TJZA 2PQ2A 3G0GA 1K06A 2EO7A 3F62A 3T7DA 3QLJA 1ETZB 2X6QA 4TTAA 3K70C 3EZJB 4OZHA 2G72A 1G5RA 1DSYA 3SS7X 1H0HA 5EZIH 1NBMA 1V3MA 5L9DL 5BQ5A 1LDNA 2WWTA 1TU2A 5JCJD 3A0FA 1W0KA 4YYEA 4AZSA 4XQ9A 2X3CA 3FPAA 3LXBA 5J1TB 4AUMA 3DMYA 2CK0L 2OFPA 2OO7A 3CKMA 4ZOZA 3DV0B 2GXSA 3ESMA 4RNRA 3CBKB 1BOGB 4RQQA 3IKKA 3WLEA 1NOJA 5IWCA 5I8ZA 3E2HB 3K0WA 5C0BA 3HKCA 5I1AB 4YRNA 3TEUA 5HDBB 2IGFH 4LPWA 1NKTA 3E7FA 3RGVB 5SZKB 5HX7A 2ODAA 4HVLA 4O4LB 5CIQA 3AUFA 1B73A 1HXKA 1T0BA 5DMKA 5CBEB 4QWMA 4DMCA 3WNIA 4D8PA 2FRVA 3C5ZD 4LGPB 1W76A 4GBJA 5CW1A 3GDOA 4LQFL 4NAMA 1BCSB 1PDKB 4EZEA 4PF1A 1XVTA 3ULVH 2GRJA 3EOAB 3T1NA 5FO7A 5TPWB 4RTPA 1C7JA 3C3DA 3JQAD 4NBNA 1OC4A 4X9IA 5E7JA 3HZKB 3D4NA 2GILA 4M89A 2G80A 1B2WL 1VCHA 3S8WA 5IJ0A 4PPTA 2FGZA 1NEPA 1LI4A 3ZWMA 1UTCA 5E03A 4NO2A 1W6LA 4OI4A 2EBWA 4CKBB 5DSZA 1UOLA 1NNEA 1RI3A 1U8PB 3T0EC 3AFLA 1KSRA 4R4BA 2HD4A 2OW6A 1G21A 1NCDL 1FQJA 2JLVA 3QYPA 3VFMB 3RWFB 3QXUA 3M17A 4KIJA 3ELUA 1ADWA 1KQOA 3U37A 5I1CL 5EIEA 3E1GA 4C0SA 3KWMA 1ZNWA 5GISL 4JEHA 3OP4A 3QK7A 8ATCA 3DMMB 3B6IA 2KQUA 3PEFA 4XOUA 3RSOA 3KNBA 5BVHA 3U16A 5JW4Q 2GCYB 4WVRA 3D5QA 3I75B 2Z95A 5L3RA 3BG1A 2YRLA 4EKYA 1P1ZA 3VI4B 1JWSA 4P5SA 5AHOA 1G8YA 5CAEB 1ZA3B 1Q0PA 3H8WA 3WDMA 3KPRB 5IQ7L 1TVEA 5BVGA 2BUCA 1UK7A 2Y1EA 5KBYA 1NFQA 1YUKB 1KBBA 2OMVA 4GD3Q 4KO7A 1DBBH 3MRFA 3T8VA 3GUVA 5AW5A 4QFBA 4K7JA 3ZHCA 1Z47A 4IPTA 4AULA 3VTAA 3LX4A 3OB8A 4D43A 5GZ3A 1U9ZA 3FWZA 4QOSA 4APQB 3U0BA 4V1CB 1SOQA 2CWRA 4Y9TA 3KQNA 3FCUB 2QPAA 1USZA 4WVLA 4KVPA 2H1WA 2PS3A 2WJJA 4GI3A 5L7XH 4PM1A 3UW3A 2ODNA 4HC4A 4DKTA 5AW9A 1G9TA 5CCKH 4REQB 4R97C 4KNSA 5I18H 3P2JA 3IILA 2X9NA 2CMRL 3V4VB 5C97A 1FWXA 5C0DA 2H4EA 2PYDA 4PCTA 4KC0A 1V37A 1XF2B 5CUSL 1W8OA 2VDOH 5CCXA 4OJYA 1W47A 1LNUA 1UDWA 4DYHA 3CWQA 3OG4B 2FZEA 1NURA 2GEQA 4BTVA 3PEWA 2IS1A 2OYCA 4P2AA 1AUOA 2NY3C 2P7TA 3QU9A 1ILSA 3JYQA 2G25A 4RVOA 1MQSA 1DBAH 1MJ8H 1Z16A 5BW7A 2B5OA 3K0KA 2WXPA 1JPJA 3O8BA 2BGIA 1RVFH 1YMHB 4MIYA 3O4RA 3QBDA 1G43A 1GGUA 3IQDB 1REQB 3HI1B 3ZBQA 1J1PH 3NNDA 1WM1A 3JZYA 2YC2C 1FZTA 4W6QA 3GSOB 3FFCA 3D2TA 3INUH 5E2JA 1KYWA 2Q3HA 2GPWA 4O1HA 2DWOA 5JJCA 3KLHD 2NW6A 5AAWC 2BTQA 3TX4A 1GTJ1 1QHIA 2OYSA 1K88A 3UFIA 3MV8B 4GE0A 3W6NA 4K8RD 5DRZA 3PNQA 4UQLA 4WK4A 3T65B 3CX3A 3WWCA 4K9EC 1OIWA 3JTMA 4LJ9A 1I1OA 4Y3UA 5A9SB 1OV8A 1M67A 1YA8A 3EXFB 3PFUA 4XX1G 4KB5A 4DAEA 2J8OA 3E6HA 1GXSA 3ZLUA 1KENH 1KCRH 4OB5H 3KUUA 4GDMA 3IVXA 1Z29A 1DHKA 1TD1A 1L5WA 2NNCA 5EBLA 3DK2A 1C7EA 3TM5A 4JO4H 4OZHF 1E2KA 2NX2A 3ZY4A 2XBUA 4JYZA 1BA9A 4HDMA 3LY8A 2UY6B 2WVGA 2XTMA 5I1HH 5HHPB 1LV8A 5AAMA 1VL8A 1NI4B 4YBRA 1NIFA 3M6UA 5JYDA 4N25A 4DN4L 2V7HA 1ISFA 3RDTB 1X1BA 2BMAA 1KRWA 3ABMB 5JALA 3ULSA 4X84A 3TH4T 5GTDA 1R3LA 5KDOB 4BFLA 4F15C 4BZ2H 2D0HA 2CVOA 3DX9B 5CR8A 4APXB 4PAGA 4F5ZA 3MSCA 2QW8A 2R5WA 3NHBA 3NT2A 4WOPA 2RGWA 3TSWA 2C9SA 1O9BA 4C43A 5C53B 1CUEA 4LC1A 3GLGB 1ST3A 4QO7A 1IHUA 4PYIA 3ZKMC 5KYYB 5E3HA 1RIFA 1TK2A 4JNKA 2WV7A 2WJVA 3JV4B 2PWZA 5DX1A 3R76A 1ESMA 5KVSA 2YD4A 1NDUA 3HZMA 3GJZA 3HDQA 1L7AA 3PF2A 3S5LA 3PKIA 2IQAB 1FO0L 2F64A 5C7YA 3ELWA 2IMNA 4GZMA 1SJEA 1CQYA 2BFWA 1HE8A 2PGNA 1T6ZA 1GTRA 4TVSA 3I0MA 1PUJA 1EB9A 5CT8A 2JA2A 1XF4B 1R3KB 2CE7A 3OLWA 5IT9g 4PP2B 3RFZC 2WAYA 3U4BH 2NVUB 5I8WA 1Z75A 5EPEA 1EEQA 3P9KA 1UPFA 3P9PA 1O7DE 5HFJA 1FMCA 4YXHL 3M49A 2XRAH 1VKZA 1F6AB 3EH3B 2JQAA 2WM3A 3DX3A 5LG1A 4N6RB 4KXAA 1J1OL 2V3DA 3APDA 2DX7A 4FLOA 3DZBA 1AG0A 1D6EA 4P80A 2I0FA 5JDSB 1RZFH 4MA3B 4FMVA 1A1MA 1ZHOA 2VT0A 3KS0J 2YBRB 2VJ8A 5KVMC 2BOVA 3UB3A 3Q5DA 1ZIAA 4LC9A 4NSNA 2TAAA 3ARFA 1NVKA 2B25A 2BSQA 1A47A 3OZWA 5JIDA 2L18A 2QTNA 5L0QC 2QN8A 3EVCA 2NX5B 3QEQB 3RGGA 1P74A 3EGVA 3LIZA 1ECYA 4OL0A 4UQOA 5CTJA 2G6TA 5K1VA 1JUDA 3MOAL 2ITDB 4ZTOL 3SQRA 2X14A 3GDFA 3MZTA 4PAMA 3O8DA 4LYGA 3IFNL 4MVYA 5A4KA 2QRGA 3F4BA 3PI7A 3JVIA 3Q3GA 1IB6A 3BDVA 4B3DA 1AUXA 4KO1S 2GK4A 3MGKA 2QE7D 1U8IB 1BQUA 5ERYA 5JNRA 3ZR4B 3CF6R 3EKCA 2D2VA 3HO1A 2FOIA 4YCCA 3CUTA 3WFBH 1QE3A 5KUTA 1GS8A 3EEBA 2R8BA 3LUFA 5DA4A 3LRTA 2K6WA 8FABB 1NKSA 5BT9A 5DK0A 1L7OA 2Z4TA 2I3DA 3G5LA 4L8VA 4MI9A 4RPGA 1XB2A 1LSJA 3WJLA 1B6UA 3OLCX 2MSPA 3MKSB 3H2GA 1VPOH 4RELA 4YROA 4K9NA 1BW8A 1I8KB 1MDTA 4OIAA 4GNKB 2WJ6A 4LY3A 4ADGA 1T7YA 1SZNA 4E3WA 5BRQA 4ZYLA 2YAQA 4EEKA 1U7TA 1E50A 4MQXD 5KSAD 3VR3D 1VKXA 3CZQA 3FUCA 4FXTA 1DO2A 2GBAA 3D9QX 1SN2A 1FP4A 2FZVA 4DGUA 2FBJL 1C1XA 2P47B 2BK8A 5EOQL 3RN1D 3M5DA 4OOFA 3RRYA 4Z2AA 2ZX6A 3WXBA 3L3GA 4LSQH 3D6AA 3BWVA 2TRHA 3O0RL 2NDGA 1T66D 1BD2E 1FNNA 4N14A 3T1VA 3FUFA 3JD3A 3L3HA 4AW9A 5BVJB 1T36B 1WFNA 1Q92A 3AQYA 1BMDA 5IW3A 5DURB 2JH3A 3ZV5A 4ZMQA 3VR5A 2ZUQB 1TA4A 1BYPA 5CFRA 3R24A 5LQCA 4U31A 2QRUA 5DR5H 3QRGH 1CJCA 3TYFB 4DAOA 4RIGA 5FFFA 4ZOYA 3CC5A 2BIMA 2AXHA 1Q72L 3ETNA 3GY0A 3T0WA 3VXOB 3SPHA 1WQ4A 1BDMA 4MDEA 4FULA 4I9NA 3FQWB 2VPZA 4IXTA 3AERB 1MFCH 4P98A 5JHDE 2YMUA 5AFAA 4L0PB 4E5XG 4TSAL 3TIEA 3ITKA 4QUIA 4J7UA 3MCG1 1ODSA 2VBFA 5DCLA 1UH2A 4AUEA 1ZOOA 4DR1B 2AC2A 4DCOA 2RHCA 2C5LA 4CQLB 1MEEA 4NZNA 4HBGA 3R6DA 5AKLA 4WACA 4GOND 1SVCP 1G9HA 5SX5H 5I24A 2LU7A 3PY9A 5IB3B 1Y18A 3PP3K 5AKKA 4TKVA 2GPYA 4RZQA 2XTSA 4HDNA 2F6AA 3N9IA 3Q7QA 4NC1E 1EANA 3LZPA 1SIUA 3D81A 4OBWA 5AVZA 1DDOA 3LKPA 4Y5YB 4R40A 4K5PA 4PTUA 5DXAA 2GVYA 3F7VA 2FEKA 2WJ7A 3IJ9A 1PR1A 3DOHA 4YVDA 2AFVA 1WUYA 2B1OA 4JE0A 5MENB 1Y9EA 1MZPA 2ZRCA 4JY7A 4F7DA 2FGKA 2X3YA 3HB7A 3TKYA 1X80B 5GGRY 4OI7A 4H5IA 2K3HA 1FHNA 5AW2A 5F1IB 2FUNB 4U1KA 2IOMA 2AOTA 3A3YA 2VHYA 3R5XA 3N9GH 5EJIA 3J81A 4HWZA 2BY3A 4KKLC 2EE6A 3N6YA 4O8ZA 4ZDKA 3BRDA 3N87A 2M9MA 3PNKA 4GSDH 2FZ5A 1HHGB 3UJIH 3C1TA 3FKSD 3GPEA 2XG4A 2PWAA 3SICE 4DUPA 4CGZA 4XPIB 3GXUB 2NO7A 5E9AA 3M81A 4UEWA 5J13B 3VGAC 1M1NB 3PWNA 5A3IC 3EEYA 3M89A 3QBJA 5NULA 4IHJB 2AI1A 4L0DA 2BSSB 4JLJA 1IY0A 3VTTA 4JVSB 1BPLB 1HWGB 1MNAA 4Y1TA 3AOEA 4YALA 1UXWA 3RG8A 3CLEL 1F17A 1A1NB 1T20B 3NP4A 1LBTA 1XL4A 1VA4A 3TTUA 1WEJL 4LHWA 1TVHA 1N1DA 1F8UA 4CT5A 3RTAA 1FPTH 1EJFA 1CETA 1YR7A 1ZYUA 1N7HA 1W0VA 1YRHA 2BMDA 2XA1A 4ZYUA 5K4GA 3T09A 3QRWA 4A63A 2G4GA 4HN9A 5AW6A 1QLWA 1FS4A 4N39A 3IEAA 5H0IA 4XCNB 4N82A 5T3XL 2XQKA 1O94D 3FPXA 3PNYA 1BEZA 3IBYA 4QARA 4JGBA 3BL5A 3IQZA 2EXYC 4P23B 4EGFA 1U2QA 4OP1A 1JERA 2NTSP 3QWRA 4N0YL 1JKJB 5A7FA 1ZK2A 3N59A 3BVDB 1F4PA 2C3PA 1DLHB 1EDDA 2NSHA 3SF0A 3OM9A 2IDCA 1DTSA 1PZCA 1D0VA 1IZZA 2J56H 2VFAA 2J72A 2OL3A 3NTRA 1RXYA 5F33A 1AZLA 4MYPA 3K2BA 4HKBB 2ATCA 3LV3A 3TZVC 4MZIA 2Q5OA 4YPGA 2X53A 1XR8A 4O2WA 4NQEE 5E0FA 1M3SA 1OHHD 4YDRA 1MFNA 4UC0A 2FPMA 2YXNA 1EVEA 1C16B 1DSFL 2LU5A 2VW7A 2BBSA 3DZKA 1F4LA 4H44C 4ZI8A 1OU4A 3DB1A 3Q2OA 1C0PA 4QAQA 1GOHA 2QQGA 3BVTA 2D0FA 5D85A 4CBVA 1O95A 2I07B 4Q18A 2C9ZA 5LBSA 4NENB 1CR0A 3KPUA 1LEKA 3C0KA 2XODA 4OF4A 1VPLA 1M6UA 1V6AA 2HRDA 1T3GA 5FYKL 5KN5A 5DRXB 3WHKA 1B00A 4Y1RA 4N7JA 4OB6A 2W6MA 3RVVC 2ZI9A 3H9HB 4L1TA 3PTZA 3BL8A 4XHJC 2XKJE 3FLAA 4EHKA 4H0GA 1GKLA 3QLUA 1VHPA 1RZ8B 3MJ9L 1SY6A 3RBXA 5C0GB 4AOWA 1TU4A 4A36A 3LRMA 2GN2A 5EHIA 2XWCA 3GLKA 5CNIA 1ZS2A 3GFUA 5IIEB 5FA3A 4IDAA 3BHJA 5FAXA 1QSEA 3I53A 1CICD 1Y4AE 4K81B 5DT1H 1YK1A 1YL5A 4DV6B 2LLNA 4CSPA 2R2BA 2NADA 3FRUB 3ESRA 4XCYA 2DKMA 4ROSA 3UO1H 4MA4A 1UCBL 2K8MA 3BKCL 4UBDD 2P4AB 4ZI5A 2PXYA 3M5CA 4JZYA 4OXQA 1ZSNA 3MLSL 3UHFA 3CIOA 2WM8A 4TXLA 1MHEB 5D70L 3FYCA 5E5MA 5F64A 5EEXA 2ARKA 3AS2A 4AMVA 1NUHA 2QBYB 2YOFA 4DC1A 1E3SA 4C2AA 4I8DA 1W5FA 1KFAH 2JIPA 4CFSA 2CLRB 5T5FA 1ATZA 4LFHD 2BFPA 4EDWL 3RK1A 1XLVA 2G28A 2XPGA 1OLXA 3VNBA 3VFRB 4HZ1A 3PVCA 4RK0A 1G7PB 3C6BA 3ZTCC 3TTTA 2NMVA 1JNJA 5FI5A 2A3RA 3P9XA 1HCYA 1RAFA 3SYMA 1ADCA 2A94A 4OTXH 2JKLA 3IUSA 3QGMA 4K3JH 3NEXA 4C4KO 1Y3CE 4IYJA 2QYOA 2JCWA 1E1KA 1ZW1A 2ZJ3A 1XB3A 4M02A 1JBEA 3PHCA 1IN7A 2QU7A 1MI5E 2FZKA 2MQGA 3KYCA 4YP0A 3PLNA 2ICWI 3GBPA 3GVPA 1JP7A 3EODA 1XGKA 1CR4A 4C01A 2K5UA 2FR1A 3FTCA 2QN9A 1YIDA 1SHYB 4IDJL 4PRPD 5HYSG 1XQ6A 3RBAA 1PJ8A 4DDKA 1XMVA 5CEXB 4JI7B 4AKPA 2OYKA 4DO5A 3HB1A 1GP2A 5J4HA 1A6VL 3NANA 2BONA 5LN1A 1HAUA 4HH3C 4JQIA 3QOYA 2XQJA 5DBIA 2FMTA 1GTSA 3EH1A 3C6ZA 2EGGA 1E28B 4KK8C 3VQMA 5GS1A 2A74A 3D1MC 5D2CA 4WW1A 2EF0A 5DHSA 4D0GA 5LBVA 4UU7A 3EXG2 3QXCA 2UY7A 4PBDA 4LSVL 3BQNB 4O3TB 3H3PL 3QXJA 4NJOA 2J0QA 3RYMA 4WEBH 1E6KA 3RJOA 4PW9A 4X45A 4LCWA 2J6EL 4BINA 1MCOL 1DUVG 3C6SB 3AO0B 3P3RA 4A2CA 3TEFA 2CV0A 3CN1A 2JJSA 3CLTD 4BWWA 3FPFA 1R12A 2I0TA 3MLRL 1WVMA 3OJCA 1P84J 1Q83A 3TOCA 2YFHA 4WVFA 1CZUA 1MREL 1Q1BA 5KU1A 1VLQA 4Z7OE 1U3JA 4MNHA 1GM5A 1WE2A 5IFHH 3LX8A 5IHPA 4G3YL 3HTXA 1SHSA 1K2DB 3UJ6A 2I71A 3A4EA 1RPQA 4POYA 1ZN2A 4MXQD 3IPCA 4M4RB 5T1KB 2Q7AA 4I1OA 1CJMA 1PJTA 4Z5XA 5EWIH 1YPZB 3QYAA 1JHOA 3KD3A 1WP6A 4JVOA 5TQ2L 1RLWA 1D5WA 4D41A 2TSBA 1CJUC 4OQ1A 2LKDA 2IH2A 3QUMA 3SC2A 1T21A 4C0JA 1QGUA 1XA4A 2ISCA 3FMGA 1G1YA 2A88A 1FFDA 1E5LA 2WU4A 3QIBC 5BZDA 1RABA 4G5YA 4O9HL 1TA9A 2CL7X 4KO8A 1EE1A 5FUWA 1KVQA 3A3NA 1QQDB 1D7DA 3A58B 4P2OA 4F2MB 3PD1A 2JCCA 5HPMA 3BKYL 4KXQA 4NOFA 5C0FA 4X8LA 3E9NA 3DURB 4XGKA 5I9TA 3KRTA 4ZXPA 2PWFA 3RWCB 4CEIA 3EXHA 5E8PB 5AW1A 5ANMA 1YQVL 3EYOB 4FQIL 4GKNA 4PG2A 2BZDA 2ZANA 3NBKA 4JO3H 5C3UA 2IHJA 4A8HA 2XWPA 1BDYA 3OM8A 4R1OA 3TCLB 4OZUA 5CP8A 3CH4B 4C14A 1J5OL 3JTEA 5MHSE 1XCLA 4JN1H 3NHFA 1KYDA 5J6HB 2VZEA 1E2PA 3VSVA 2ZWVA 1RVDA 1G3MA 2IANA 4PLTA 3IWVA 2SBTA 2WB7A 3LH2L 3W8FA 3AM5A 5BUSA 5JSZA 4R3SA 1T0PA 4H7JA 3L8MA 1H4QA 2JGDA 1AHPA 4I4NA 5F2EA 3D3JA 4TKLA 3SCZA 1JQ5A 2AJXL 1GTMA 1MQ8B 3EGOA 4CMGA 1ZGGA 3P19A 2FDBP 3VO9A 2CLCX 4X6LA 3QR2A 5FKPB 4LE1A 2JASA 3VNUA 2CALA 1UXKA 1P6FA 1OXYA 5B6JA 2R6HA 1FOEB 3BGFC 3D34A 1PX0A 1XFAA 5E9DA 4M7LH 3NS7A 1JD7A 1OW0A 4NJAH 1YL7A 4OR1A 1E4OA 1PKQE 1XJQA 5DO8A 2R48A 1CDJA 4OZFH 1B8OA 5B1SA 1JHZA 5T1DL 4CJXA 4RXMA 4XWGA 4TVPL 3CZUB 5A40E 3LKOB 1YVDA 2P9CA 1UOEA 1K7EB 4C6TB 5FCUL 2QQFA 2MMXA 5EIHA 4PPNA 1CJSA 4BFVA 1NUGA 4YSTA 2ECFA 4TS3A 3IUBA 4XEUA 2FEPA 3FYUC 1G98A 3MXVH 3KU1A 5AM5A 3H9GA 3CS3A 5H35A 3E9RA 3W5SA 2QP9X 1AUQA 5EHXA 3VPGA 4D0CA 5LZ2A 3AXLB 1NFKA 3FSOA 4BP9A 2Q4TA 4XOAA 2OC9A 2B7DT 1M1YA 1VMAA 4ZPTA 4H26A 4PBZA 1JS4A 4E13A 2OGSA 1U3HB 3EMVA 5CXPA 2Z1NA 5F9OH 1II8A 4DW8A 4FG6C 3UBHA 2ACEA 4X50A 1FFXA 2C8LA 4R0LB 1XZIA 1DXYA 5DM0A 2IPUG 5DIZA 3ZHBA 4FQXD 3G2LA 2L4OA 2P9HA 2AJUH 2BSCA 2EIDA 2SODB 5I74C 5EF1A 1LX6A 1UT2A 3I6LE 1K4YA 1NGYB 4Y19B 3HNTL 4JRLA 3BRSA 3U3RA 4ZUSB 4AQDA 4BRWA 5D84A 3RWDB 1QYGL 4H77A 4EIWA 4UM9A 3QRBA 3OAWA 4RZ2A 2EDJA 5E00B 2IZ7A 4L0MA 4KG7A 5AWNH 1SKQA 1HHJB 3VD1A 2YV5A 2G0NA 2WFMA 6FABL 3TCTA 3VO1A 3QIUD 5CJPA 2XETA 4AMGA 3P27A 5CCGE 4KQ3H 3OKAA 2PUWA 3GRKA 3C85A 4L8WB 1JGIA 1TCCA 3V42A 1J8HE 2HQ1A 3N07A 2NY2B 5EU4B 3SP1A 4U02A 1CJKC 4LSRH 4QRTA 1K7YA 3RU3A 4LFCB 4EG3A 1ZUNB 5BOVA 4DCSA 4CU7A 4HWEL 3ZTNL 4FZVA 1MJ7L 3AVUA 2DI9A 1JDVA 2IH3A 3Q7TA 1JECA 3LNTA 5LYYA 4AG4H 3E0GA 3EIOA 1MN6A 1NVEA 3TQIA 1GAQA 1PIGA 2J85A 1N7IA 2VSDA 2DIJA 5F7YC 2OCJA 1D5MA 3MXOA 3QISA 1DT5A 3GEWB 1APBA 4HXGA 1WHSB 3EI2B 4N5NA 3K32A 2B20A 5FORA 3H2BA 5L6MB 4BUZA 3QHZL 5IAAA 2X1VA 3CVWA 1O6VA 4BQ6A 4ODHL 1UD5A 4F84A 5CB8A 4Q4HA 1M57B 5FKQA 3IJEB 1S8AA 5SXMA 1QF6A 1IAOB 1KAEA 2D59A 4JFZH 3KT6A 2R8ZA 2FPSA 1BFVL 1WMFA 4MPRA 3PF9A 5DYWA 1RJZA 2OCIA 1V1RB 4MYSA 1U2DC 2D1QA 2PYEE 2X3BA 4DIEA 3UWSA 4M29A 3WJJC 2CSPA 2XVZA 4KK9C 1NMSA 4G9EA 1XXLA 4XXDA 1XD2A 2H8GA 3QI7A 1RCYA 1AGBA 4AQOA 1I6LA 3MTGA 2QHXA 2XUPA 5C86A 1BIIB 1VDZA 1XMEB 5D8JH 2W48A 3Q7IA 2WYTA 1QR4A 4Y1AE 3QKRA 1KEGL 6NULA 3UJ3X 3TD6A 1PG5A 5C7IO 5TH2A 3L2LA 1Q57A 4GKSA 1DBQA 1JCVA 3MUOA 2N1MA 2ZT7A 1I7RB 2OGUA 4BNZA 4KPHL 4JLAA 4ZMLA 2C58A 2R1WA 3HZVA 1N33B 4G80B 2R4SL 4Z1PA 3K9BA 2PUEA 1HORA 1QHGA 5D4QA 4O51A 2B4RO 2GC7C 3T9EA 2AKRB 3KPLA 3IFLL 4JA0A 4NPYA 1F90L 4JWTA 3NA9H 2OHOA 1N10A 5G4KA 1WXGA 3O2DL 2NXYD 3JYLA 4O5LH 4HB2A 3PXTD 1IBYA 2ODQA 5C31A 4V0MA 1FYTA 1PW5A 4BX3A 2OHJA 3TL5A 2X0UA 1NC2A 3PQ8A 3HWWA 4MO2A 4O4HF 4YQEA 2CCKA 1CX9B 3AL3A 4JB9L 3TTXA 4I0CC 1ZH6A 3I02A 3SGDI 1W5SA 1M7GA 1MO4A 1MRFL 4MW4A 4J76A 2Y2YA 6YASA 5HTSA 5DM1A 5JANA 3WEXA 3FLBA 3STUA 4YAIA 1FLRL 2G76A 2WWIA 2A0LC 1W8NA 5FBQB 2WQ7A 4OAQA 4MAAA 4LGRB 5CA1B 4ETWA 1Z62A 2XN0A 3FQXB 7CGTA 3LY7A 2EG5A 1H23A 2ZWAA 3AJDA 4XO9A 5AG8A 2C77A 2AJZA 3TMKA 5JS7A 3HKZA 1OTTD 1IN8A 3RIHA 1RCUA 1BWQA 1RJYA 4FEYA 1LWJA 3EYFB 1Z5LA 1V54B 3V1NA 1IHPA 3AETB 4DTCA 3QEUB 4GX5A 3AHFA 1X7QB 1SBZA 2AQPA 3C8DA 4KZEL 1IBZA 4RISL 3RIGA 4O2EB 1Y34E 1FVEA 2GEUA 2EH8L 2VDUE 3OPUA 4MNQA 1V41E 3M9WA 4WNAA 3TZCA 1IBRA 1YN6B 5F7ZA 5ALTA 4RY9A 5DGTA 4PRNB 1JK8A 3OEED 4TRNA 3ABGA 3TBVA 1E9BA 4L3FA 2FUQA 2QKSA 2IOFA 3MINA 2JGRA 5EUBA 1SD1A 1W5AA 4UHFA 4QT4A 4EQ6B 4ON9A 1OGAB 2HZHA 5GZOC 3MRCB 3TPUA 4DOHE 4TSFD 3WEBA 4DVRH 4HCIA 4R5VA 3TIDB 1GLNA 3AFNA 4JLNA 1TPXC 5CIPB 1R9NA 3EFDL 1KEML 3M9LA 2QNIA 2PO6C 3OWOA 2BIOA 4EHNA 2JGMA 4I0PC 4F8YA 4JUSA 3SBQA 4IIQB 1KOFA 2HQBA 2CKBL 4MLZA 5BV0A 1DQLH 5A5FA 5I1IH 4B0OA 1N78A 3A6OA 3WE1A 1Y89A 1A8IA 4F38A 1OM3H 3QKUA 1UFUA 3MU3A 2ID9A 1CEYA 4L2LA 2ZUCA 2D3VA 4Y5XB 4TUJA 2DF3A 1OLOA 3BCDA 4PCSA 3ZYCA 1SUBA 5F93C 1R88A 2EE2A 2I4MA 3PNBA 3NH6A 3VSCA 2KZBA 3ELAT 4UNVA 2VDNA 4F21A 2G1UA 4UMFA 2X70B 1XXDC 4IDNA 1DG1G 3G0CA 2O2IA 3K9LA 4H4NA 4KROD 3ANTA 4PWJA 5DFTA 1BC5A 3ZGXA 5BN3B 3ANSA 3OSZA 2WZ5A 1U30A 3HC0B 4PRLA 2R4RH 2X2FA 2ZB7A 4RPLA 1LK7A 3W11C 2EO1A 3R3XA 4E32A 1R8XA 3MLWH 3RCBA 3DFMA 4YVNA 4Z7VF 1KXQE 3N0WA 2Y1WA 5A2LH 2XEDA 2D7JA 1D8AA 3ARDC 4FG4A 3TCKA 1KN4L 4JOSA 2OBMA 1N3IA 3LH8A 3FROA 4Y7OC 2GM4A 2JD2A 3VM6A 2D2OA 1WZ2A 2RB4A 1JBKA 1IEXA 4KYIB 1NN3A 4A10A 1TW2A 2LAGB 4NNPH 1A8JH 3CH8A 1DKQA 3TBYA 4HEME 1J5PA 2OAGA 4B17A 1NKOA 5DK4A 2EIHA 1E79D 4ZAXA 2W18A 5DWUH 5E6UB 4WFQA 1HZLA 5HYJA 2EJWA 5DHYA 3FT9A 1QH8A 2AZMA 4QD2E 1MAKA 5J47A 2HG5A 2VO8A 3VGPA 3OCWA 3TSYA 1BD2D 1WGOA 5K8UA 4FKZA 1QATA 4IKJA 5DJ5A 3L4BA 4ZZFA 5MGBA 3L1IA 3WENA 2M1KA 4QRPE 4XX1E 4JKOA 1GL7A 2QX8A 5TDNA 3PQ7A 2HPZA 4L8DA 4ZGWA 4EOWL 2DGDA 2FNAA 1QRNE 1ZC4A 2OXFA 5J4YA 2EDBA 2J55H 5IM4A 2FATH 3LHFA 5IV2A 4Z8LA 3M1OA 4WH0A 2QRVB 2YHUA 3A6BH 4MYWB 1J0BA 2KZ1B 2W07A 3BK7A 4GIBA 2VR1A 5A5DA 3QUYA 5JHDD 4Y5VB 4FFBA 4TQUS 3VMMA 3JQEA 2B15A 1TTAA 3H9SE 4YDJB 5TF0A 2VRCD 1S7CA 1VGEL 3EEOA 2ZDQA 4MS4B 4PIPA 2VC2L 2PJRA 2VIIA 2P5PA 3PS6A 1KLFB 3PHOA 2Y1OA 4IJ3B 5H37G 3FNRA 2CR6A 4NBLA 5COAA 1MT0A 4LECA 5D6CB 4OQTL 2BGLA 5JSYA 5BR7A 3WB1A 1ZI6A 3HG1E 1V7NL 1MVUA 1HI6A 5HI4D 5MF6A 2ZJBA 5F7NC 1Y98A 3QBVA 2OWDA 3SYAA 2H8PB 3DC2A 1R18A 1WD5A 2I67A 4E5PA 2OV6A 2Z57A 2KI5A 2OZLB 1Y63A 2ERXA 1RLUA 4G11A 1PJBA 2P5WE 1T4DA 3F7PC 4EEXA 3B9KD 4IDQA 3BZFA 4EB8A 3UK6A 4JFFE 3SQLA 2HA3A 5JHGB 2WSSA 1MFDL 4KQIA 5M94B 5ALKA 3VR4A 3EPRA 4JG0L 5JXED 2CN2A 4OUDA 4RZIA 4GL2A 1LK2B 5A2AA 1R5MA 4LNHA 4ZSOB 1OQAA 1KGUA 1Y9DA 2BDNH 3CVCA 4Y9DA 4LRUA 3SQXA 1CY1A 5JCOA 4GUPB 2GQ0A 5C0AE 2B83A 1OAXH 5IWLC 5SWZA 2YNPA 3T71A 1MX5A 1F11B 4UU9A 4YAOA 3DH0A 1IGCH 1AO0A 3IPYA 1P5VA 3F2IA 5KS9B 4NCC2 1NVMB 4LCBA 5MP6H 1KORA 2GJKA 3WYEA 1ZXQA 1U81A 3TE7A 2X9LA 2VIRB 3CCCA 5EMLB 2C0QA 4WJZA 3M7OA 3OTOB 5FHBH 4U9UA 2Y77A 4KN9S 2YUVA 821PA 5TE7L 3I9KA 5MFPA 5GS0D 5IMLB 4B6ZA 1YMVA 4X6CF 3UBXB 4WXPA 4YHNA 5EBMB 5EBGA 1H6BA 4JBIA 4IVPA 5M5VA 4ZEWA 1AGRA 2FJ0A 2VXVH 2COEA 2ILTA 3CQPA 2H1FA 4L8FA 3LIPA 4DRXB 3MCYA 1DQQA 4JZOB 2MTAA 1VBMA 4HETA 3P11L 2G3ZA 1LTXA 3TQQA 1BGVA 3IAM6 1ZWIB 4I1IA 5I0ZA 2H1PL 1GV0A 3MV11 4KN6A 5TMDA 4ZCLA 1G4UR 5KBNC 1VHLA 3UPRB 4R8KA 2ZUUA 5DEGB 4ZFQA 3SQOA 3LHAA 3H7LA 1MMFB 3S35H 3H5TA 3PE7A 1HDXA 1UODA 5ESWA 1AP2A 1MKYA 1T9DA 2F48A 2QKIC 4L3HD 1KJMA 2ATIA 1CBUA 4MTCA 4V33A 4JO2H 3O82A 5DQDH 5LCXA 4JQVA 1NAHA 3ZU5A 4PTYA 3GXMA 4ABQA 3EAGA 1E69A 5E4IA 1YNOA 3LFHA 1WU8A 3ALPA 3GBMH 1XCBA 4WSOA 5FNZA 3VNQA 1G9MH 2JF1A 3SSAA 1MAML 4MA1C 4ZFGL 4X9FA 2OO3A 4BHUA 5P8WA 4NQED 4IBZA 4IKPA 4DKXA 3L4KA 2J0UA 5EEYA 4UU1A 1DMSA 1HTYA 1RHQA 1EIWA 1P53A 2XQ0A 1TVMA 4LLYA 2VKWA 3F5MA 3THYB 3HBZA 3O73A 2WU3A 2Q0XA 4OXKA 2ZJ4A 4WW2B 4FEAA 3EFOA 1XVAA 2BM3A 1LI7A 2X7LA 5DLYA 1DQIA 1AXTL 1UM5L 2P8MA 4MJHA 1RYYA 3E4DA 3R7FA 1CGYA 1XTVA 2C1EA 4KTEL 1ZD5A 3O9WB 5C7ZA 4ALAL 4NYMQ 4N5UA 3MBXL 2IVFC 4UM7A 3EIXA 1A0QH 3I3SR 3K05A 5I4CA 2PL3A 2Q49A 1HSAA 2HX1A 5FYQA 1C8VB 1PBYA 4X8CA 5DJ0B 4JRYA 4BGVA 1T3SA 3ELBA 4BNTA 3VE0B 4DZRA 4M62H 2WWOA 1K6QL 4DR7B 5TPZA 4L8BA 2J2ZA 3C75H 5MEQA 2BP7A 3GJXC 3WL4A 4FA1D 1EVKA 3CUWA 5DEFA 2C0PA 1NUAA 4JY6A 5HIKA 1G59A 1XJWA 1YZKA 5D87A 3AKDA 1F02I 2OI9B 3WNNA 1AQUA 3RBVA 1URLA 2R62A 1NVVQ 2YRPA 3OVUB 5IM4F 2FP3A 1PDVA 1PDOA 1TFRA 3QNZB 2AEEA 2B69A 1AGDB 1RMTA 3QDHA 1XXHB 2ETXA 2YHBA 3KXLA 5AFU3 2G07A 1KG0B 4JI6B 4FN4A 4TVOA 4FFZH 2FGWH 2P8SA 1K8IB 3RWHB 4FTDA 1JI0A 2DY2A 3BH4A 3FB8A 2HF7A 3RAJA 1MUJB 2X0FA 2RAUA 3RPBA 2QZ5A 4Z8FH 4P4GA 5EUKA 1WP9A 5C2BH 3GLQA 1X7XA 1INEH 4RZSA 5BXYA 4O8CA 4R9UC 1J12A 4MX8A 2NOYA 2H7CA 3OA2A 4M48H 5ACZB 1PX3A 4DVGA 1FFYA 3HE6A 4GS5A 3GL9A 3MJVA 1AGEB 3B7TA 4M6OH 1NEZG 5CLZA 3WGUB 3ZHLA 4Z4GA 1OX4B 2VEDA 1ZR4A 1MI5D 1EBAA 3T0AA 3OD3A 4OFVA 1JHLL 4JHLA 4BO5A 4CV3A 2WBJB 2CO7B 1VPDA 1BVNP 4XVSL 2C8JA 5EYPA 4JYPA 3W1WA 1N7JA 4RACA 4EO5A 3O3EA 2DYKA 4L4TA 4HGQA 2AX4A 2JI1A 1JJIA 3BTVA 2CZCA 3NEPX 4CR7A 5E23A 2ZQ5A 3TEYA 3Q5TA 4MQTB 2X2HA 2DMRA 4X5RA 3IS3A 4NSXA 4POOA 3GI9L 1HFKA 3N1UA 4P53A 4MRCA 4DTIA 3ZHFA 1II4E 1GGBL 5DCWA 3CN4A 2DWCA 2AC7A 4ALJA 1CL7I 1N64H 4F7PA 1I3CA 3MS4A 4BRZA 1N2IA 3OMAB 3E7DA 2L04A 4WUUA 2DJMA 4JFVA 3CH1B 3QIWD 1X0VA 4FNUA 3VW3L 1PWHA 2PJDA 3WIHL 4MQFB 1IGFL 3B3BA 1K5GA 3H9ZA 1X19A 3SE7A 3G17A 2VAAA 4XCCH 2DHEA 3AH8B 2QPSA 1DANU 3ZDQA 1JMVA 3OHSX 3B7FA 1NJ5A 5D5ME 4ZMPA 4KN5A 1M7XA 4I2XE 4PJGB 2WIGA 4HOXA 5C51B 5B3SB 2C3VB 3FQTB 1CGSL 1XB6A 2QTRA 4P4SB 4JPIA 1N8ZB 2A6KB 4RWZA 2W2MA 3AF0A 3EBAA 5JD4A 3Q8BA 3D7SA 3LNIA 1HYQA 25C8H 3TBCA 2IHNA 4X7CC 1P5HA 4ARSA 1XIWB 4BAZA 2NSQA 2B4CL 3LXUX 3WNOA 3ILYA 4M1MA 4F8NA 1ZS9A 1F4HA 3ZUCA 3GQFA 1GGMA 2BI7A 4MXWL 4GQZA 3LGSA 3USES 4YXKH 5LGJA 4JR1A 4FDTA 4EBQH 5F89A 1NICA 4PREB 4P0TA 4L23A 1FP5A 1YMUA 1Y48E 3EZYA 1D9KD 2QVZX 4DGIL 1FO0B 5AYUL 3I52A 1BO6A 1A9PA 2ZSIA 4ZAYA 4UVDA 2UUDK 3M1LA 4Z95L 1COWA 1T4KA 2HHHB 3AR5A 3I9PA 3IJSB 2W60A 3K6JA 5EHGA 3NIGB 4JRXA 4QIRA 4JQYA 4O5OA 3AXSA 3PTAA 3D3WB 2XB9A 1S5IL 4AEIH 1P9OA 1XWFA 3ZDXB 1QFYA 1IUPA 5MHSD 4NLLA 3QWFA 5I48A 2XL3A 4MWSA 3S4SB 4GMBA 3IT3A 3TO2B 5A05A 1YI0A 1QHHB 3RSSA 2ZKYA 1ORSB 1DZ3A 5AFSA 3UVLA 2ZTBA 1SHWA 2A67A 3L4WA 2WB1A 2JBAB 3D6UA 3PI6A 1XNRB 3COWA 1AHWC 2ECPA 1MF2L 2J30A 3F3KA 2W00A 4YSOA 3N41B 3VFTA 1IRAY 3H9EO 4PYMA 2W0SA 1K5PA 2X5NA 2R29L 3W5UA 3UEZA 4Z3EA 2W2OA 4I1SA 1SCUB 1PTJA 2P2NA 4YC7A 1S2EA 1SUPA 5KINB 3CISA 4XNUL 1VACA 1A88A 3LT2A 3SEQA 1NIPA 3OX3A 1GUDA 3JRWA 3FUHA 3S2UA 4PQRA 4RVNA 3CLUC 4PJ8A 3TXAA 5JSKA 1A69A 4E2ZA 1M75A 3AJ8A 4TQEL 1KRXA 1UD3A 3HVDA 4IRSC 2COKA 3O2VH 2C4NA 1BQRA 5KOJB 2AGWA 3QULB 5I6NA 3QE5A 1U8OA 1HK6A 4OLWH 2E47A 2H4YA 2RKWA 4HXAH 1F3RB 3IPFA 3RVWC 3FAKA 3BE4A 4Z9XA 3VMOA 2GRUA 1FTSA 5EJFA 4P32A 2O50A 3HR6A 2SKCA 5CDFA 3STWA 3HV2A 2RGXA 2UV8A 4JIGA 2X4TB 3MRIA 2Y9RT 3WE6B 2XRFA 2H1LM 4GW5A 1IZYA 4ENSA 4UEJA 3VHXA 1DBJL 3G0HA 5D2NE 4HGNA 3OZXA 1XF5B 1ZH8A 5JMOC 4S05A 3S97C 5GM1A 3PWUA 4DCQB 3KUKA 1UJ5A 3PJFA 1ZANL 3AX6A 4NB7A 3N6VA 3LVQE 3APNA 2GFBB 2Y5EA 3D06A 2K7FA 4C47A 4WWOA 1CY0A 3ZWCA 1AZBA 1HEYA 1H66A 3FU0A 1B42A 3EOZA 3HP7A 1FFPA 5KZCD 4OYLA 1O57A 4QWWA 3JQBA 2HPOA 2QSUA 5EJ4A 1I1AC 1NLMA 4EL0A 1DEHA 1J5CA 4II2A 1EFPA 3T1YB 2F5AL 3FIJA 1SZCA 4A08A 2AOXA 4C08A 2QHRL 1B0IA 2O8NA 3MJHA 3ROPA 1J8HD 4PZ0A 5FM5M 3ZDYE 5DZLA 3L5IA 3W5IA 1JZIA 4AYMC 5J1AB 1P2DA 4Q3NA 4K7PX 4QHMA 1W34A 1KIPA 2QQNH 5LCVH 3QKSB 1DQMH 1V6CA 2X4GA 5E1IA 1T2CA 2WWKT 3CYFA 2PRZA 3M4NA 1SKMA 1I8UA 4DKEH 5EU6B 2JB6B 1ZTXL 1WW3A 3O6FA 3HR4A 3I0ZA 4ELMA 1D4FA 2XBTA 2F6RA 4CKEB 3HRZB 1NCIA 3DCNA 1PGNA 3HMWH 2NVWA 3NGBB 4UZUA 5AYQA 4A0QA 1O77A 4LPVA 5DUML 4KLRA 5GJVC 4KJWC 3TEWA 4AXXA 2HFJA 3O8OB 5FV1L 1CIDA 4BNGA 5CEEA 2ZZNA 5JUEL 2FQWA 4ZICA 3HC4L 1K7SN 1U4FA 4JY5H 3D7KA 1D7CA 1SK9A 2WZDA 2IOQA 5EZ6B 2CEAA 2GBLA 3IT1A 2J4DA 5IT0A 5EC1B 3L9RB 3RIKA 1H15A 4PTZA 3T7AA 2FFRA 1FJXA 1Z26A 1ERNA 4B0PA 3DC0A 4UTBL 4RYLA 4M1WA 4JQCA 4R9VA 4G8IA 1TD9A 1N59A 2CBQA 1ODFA 2JKTM 5DBGA 4M83A 2IYRA 2B08A 2VUOA 4J49A 3VU8A 3DYIA 1ECCA 4UTAH 1HT0A 1ZOLA 2JDID 5DE3A 3FXIC 3GRZA 3I9NA 2GD1O 4YHBA 1FFBA 3A6ZA 1NH6A 3DNFA 4CG2A 1KJ3L 5I9LA 4RMNA 4JJ5A 3GEMA 3OOSA 4PBTA 3SM3A 1HL9A 5EZJA 3LCYA 1O97D 2GAOA 1CY2A 1TYJA 3R9WA 2H0AA 2VYCA 4NQCE 2PA0A 4UB0H 1P7YA 2XOEA 5DJZB 2CNZA 4BO6A 1FVHA 5J7CC 1K68A 4RVDA 3I76A 3BIWA